--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 12:35:03 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/PE/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -413.22 -416.15
2 -413.24 -416.64
--------------------------------------
TOTAL -413.23 -416.43
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893412 0.089697 0.378004 1.490698 0.857451 1467.01 1479.46 1.000
r(A<->C){all} 0.168571 0.019418 0.000101 0.452683 0.133660 192.04 247.46 1.003
r(A<->G){all} 0.159544 0.019322 0.000068 0.443841 0.123872 170.29 245.11 1.000
r(A<->T){all} 0.168504 0.021095 0.000340 0.463655 0.128234 209.28 248.90 1.000
r(C<->G){all} 0.166569 0.021447 0.000035 0.478987 0.124437 145.76 186.09 1.003
r(C<->T){all} 0.163120 0.020770 0.000021 0.475406 0.120855 133.26 151.94 1.001
r(G<->T){all} 0.173692 0.021294 0.000035 0.469612 0.131926 202.60 217.82 1.011
pi(A){all} 0.154126 0.000416 0.113746 0.192489 0.153706 1120.87 1236.07 1.001
pi(C){all} 0.242046 0.000590 0.194374 0.288774 0.242117 994.91 1110.42 1.000
pi(G){all} 0.354126 0.000726 0.299925 0.404674 0.353881 1338.91 1363.83 1.000
pi(T){all} 0.249701 0.000612 0.200545 0.298421 0.249272 1286.09 1341.58 1.000
alpha{1,2} 0.401400 0.221764 0.000154 1.343454 0.238121 896.79 1104.21 1.000
alpha{3} 0.456107 0.240622 0.000226 1.463940 0.300139 1356.35 1428.67 1.000
pinvar{all} 0.994574 0.000040 0.982326 0.999998 0.996670 1299.83 1340.39 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -396.356626
Model 2: PositiveSelection -396.356629
Model 0: one-ratio -396.356643
Model 7: beta -396.356621
Model 8: beta&w>1 -396.356608
Model 0 vs 1 3.400000002784509E-5
Model 2 vs 1 5.999999984851456E-6
Model 8 vs 7 2.6000000048043148E-5
>C1
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C2
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C3
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C4
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C5
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C6
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=102
C1 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C2 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C3 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C4 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C5 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C6 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
**************************************************
C1 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C2 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C3 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C4 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C5 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C6 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
**************************************************
C1 GL
C2 GL
C3 GL
C4 GL
C5 GL
C6 GL
**
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 102 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 102 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3060]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3060]--->[3060]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.454 Mb, Max= 30.627 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C2 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C3 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C4 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C5 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C6 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
**************************************************
C1 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C2 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C3 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C4 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C5 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C6 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
**************************************************
C1 GL
C2 GL
C3 GL
C4 GL
C5 GL
C6 GL
**
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
C2 ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
C3 ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
C4 ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
C5 ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
C6 ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
**************************************************
C1 CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
C2 CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
C3 CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
C4 CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
C5 CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
C6 CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
**************************************************
C1 TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
C2 TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
C3 TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
C4 TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
C5 TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
C6 TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
**************************************************
C1 CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
C2 CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
C3 CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
C4 CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
C5 CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
C6 CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
**************************************************
C1 CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
C2 CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
C3 CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
C4 CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
C5 CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
C6 CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
**************************************************
C1 TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
C2 TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
C3 TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
C4 TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
C5 TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
C6 TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
**************************************************
C1 GGGCTA
C2 GGGCTA
C3 GGGCTA
C4 GGGCTA
C5 GGGCTA
C6 GGGCTA
******
>C1
ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
GGGCTA
>C2
ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
GGGCTA
>C3
ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
GGGCTA
>C4
ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
GGGCTA
>C5
ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
GGGCTA
>C6
ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
GGGCTA
>C1
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C2
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C3
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C4
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C5
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C6
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 306 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579782822
Setting output file names to "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 714912677
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9127725198
Seed = 839034260
Swapseed = 1579782822
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -684.842666 -- -24.965149
Chain 2 -- -684.842666 -- -24.965149
Chain 3 -- -684.842562 -- -24.965149
Chain 4 -- -684.842626 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -684.842666 -- -24.965149
Chain 2 -- -684.842626 -- -24.965149
Chain 3 -- -684.842666 -- -24.965149
Chain 4 -- -684.842626 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-684.843] (-684.843) (-684.843) (-684.843) * [-684.843] (-684.843) (-684.843) (-684.843)
500 -- (-422.562) (-421.458) (-427.416) [-422.879] * [-429.029] (-430.945) (-424.710) (-434.514) -- 0:00:00
1000 -- (-422.792) (-421.447) (-420.479) [-422.603] * (-426.804) (-424.119) [-417.226] (-425.016) -- 0:00:00
1500 -- (-423.795) (-419.819) (-421.244) [-421.927] * (-426.435) (-426.574) [-422.282] (-420.097) -- 0:00:00
2000 -- (-422.843) (-420.722) [-424.323] (-421.698) * (-419.828) (-427.164) (-421.001) [-427.014] -- 0:00:00
2500 -- (-425.450) (-419.790) [-421.109] (-434.973) * (-420.464) (-431.255) (-423.913) [-419.346] -- 0:00:00
3000 -- (-424.145) (-419.817) (-420.668) [-420.280] * (-429.594) (-419.134) (-429.896) [-422.315] -- 0:00:00
3500 -- [-421.017] (-421.905) (-421.166) (-420.678) * [-417.583] (-424.886) (-422.654) (-418.939) -- 0:00:00
4000 -- [-423.731] (-426.730) (-429.325) (-426.469) * (-423.399) (-423.681) [-421.214] (-422.203) -- 0:00:00
4500 -- [-427.997] (-419.383) (-427.052) (-422.962) * (-420.195) (-417.246) [-428.879] (-425.860) -- 0:00:00
5000 -- (-427.224) (-418.879) (-424.975) [-418.604] * (-419.852) [-421.210] (-422.985) (-425.329) -- 0:00:00
Average standard deviation of split frequencies: 0.074826
5500 -- (-422.133) [-421.297] (-429.902) (-423.350) * [-415.549] (-419.643) (-425.402) (-426.074) -- 0:00:00
6000 -- (-420.045) (-426.498) [-427.861] (-419.085) * (-428.776) (-419.303) [-419.145] (-423.577) -- 0:00:00
6500 -- (-418.058) [-420.743] (-421.654) (-425.978) * (-424.889) (-423.049) [-423.531] (-419.236) -- 0:00:00
7000 -- (-427.832) (-421.796) (-418.038) [-421.041] * (-423.424) (-419.188) (-424.370) [-420.224] -- 0:00:00
7500 -- (-422.904) [-417.811] (-424.228) (-423.198) * (-423.081) (-432.066) (-426.059) [-425.823] -- 0:00:00
8000 -- [-424.283] (-425.491) (-420.287) (-430.270) * (-434.756) (-417.633) [-421.114] (-425.739) -- 0:00:00
8500 -- [-429.916] (-432.976) (-421.413) (-419.224) * [-418.994] (-426.717) (-424.096) (-432.196) -- 0:00:00
9000 -- (-420.428) (-421.645) [-421.102] (-436.103) * [-419.954] (-418.371) (-421.390) (-425.728) -- 0:00:00
9500 -- (-422.880) (-417.904) [-423.984] (-426.405) * (-422.170) (-422.578) (-424.652) [-422.363] -- 0:00:00
10000 -- (-422.924) (-418.784) (-426.684) [-415.994] * [-421.682] (-430.207) (-437.882) (-427.623) -- 0:01:39
Average standard deviation of split frequencies: 0.069448
10500 -- (-420.356) (-432.417) (-423.609) [-420.004] * (-425.618) [-426.692] (-420.017) (-430.337) -- 0:01:34
11000 -- (-423.727) [-423.097] (-423.039) (-426.850) * [-428.096] (-427.806) (-421.064) (-424.098) -- 0:01:29
11500 -- (-427.405) (-422.948) [-418.229] (-421.093) * (-423.754) (-419.032) (-423.554) [-419.317] -- 0:01:25
12000 -- (-425.662) [-422.387] (-444.745) (-417.195) * (-427.612) (-420.596) (-426.255) [-422.964] -- 0:01:22
12500 -- (-421.858) (-425.104) (-430.831) [-419.473] * (-431.760) (-426.925) (-426.117) [-423.540] -- 0:01:19
13000 -- (-423.283) (-424.472) (-423.924) [-421.891] * (-426.112) [-425.274] (-421.608) (-423.674) -- 0:01:15
13500 -- (-420.728) [-420.739] (-425.892) (-421.399) * (-418.626) (-424.645) [-419.303] (-425.681) -- 0:01:13
14000 -- (-424.449) [-420.981] (-425.186) (-421.572) * (-434.611) (-423.372) (-430.368) [-425.630] -- 0:01:10
14500 -- (-429.648) (-435.187) [-423.233] (-425.700) * [-420.821] (-418.370) (-423.046) (-422.987) -- 0:01:07
15000 -- [-420.474] (-425.700) (-423.218) (-431.605) * (-414.062) [-422.211] (-430.664) (-428.240) -- 0:01:05
Average standard deviation of split frequencies: 0.045667
15500 -- (-416.724) (-412.611) (-424.651) [-421.449] * (-413.022) [-420.043] (-426.519) (-412.105) -- 0:01:03
16000 -- (-425.049) (-414.980) (-427.417) [-420.615] * (-412.749) (-423.084) [-419.596] (-414.258) -- 0:01:01
16500 -- (-427.664) (-411.914) (-426.140) [-419.024] * (-414.022) (-418.555) (-429.670) [-417.588] -- 0:00:59
17000 -- (-423.193) [-411.909] (-431.286) (-422.284) * (-412.616) (-439.171) [-428.205] (-416.389) -- 0:00:57
17500 -- (-427.670) [-413.553] (-422.960) (-425.736) * (-413.223) (-420.932) (-420.462) [-415.744] -- 0:00:56
18000 -- (-435.035) [-413.138] (-424.271) (-432.126) * (-413.034) [-426.316] (-419.808) (-414.880) -- 0:00:54
18500 -- (-419.118) [-413.906] (-423.134) (-412.975) * (-412.232) (-428.573) (-422.092) [-412.585] -- 0:00:53
19000 -- (-418.527) (-412.227) (-422.576) [-413.208] * [-413.529] (-427.229) (-419.776) (-413.020) -- 0:00:51
19500 -- (-419.206) (-412.772) (-413.392) [-415.044] * (-412.975) [-427.723] (-415.600) (-414.672) -- 0:00:50
20000 -- [-427.351] (-414.883) (-413.453) (-414.378) * (-413.170) [-421.217] (-414.712) (-417.040) -- 0:00:49
Average standard deviation of split frequencies: 0.042769
20500 -- (-425.192) (-413.284) [-413.593] (-413.106) * (-415.729) [-426.492] (-416.145) (-415.444) -- 0:00:47
21000 -- (-424.441) [-413.068] (-414.438) (-415.223) * (-413.971) (-420.365) [-412.520] (-418.627) -- 0:00:46
21500 -- (-414.526) [-412.318] (-411.702) (-412.608) * [-413.430] (-419.335) (-412.478) (-413.814) -- 0:00:45
22000 -- (-414.163) (-414.978) (-413.620) [-411.868] * (-417.858) (-426.132) (-413.425) [-414.466] -- 0:00:44
22500 -- (-416.390) [-414.663] (-416.626) (-413.310) * [-414.506] (-424.999) (-416.084) (-412.657) -- 0:00:43
23000 -- [-415.988] (-413.916) (-415.130) (-415.655) * (-412.505) [-426.092] (-416.184) (-414.777) -- 0:00:42
23500 -- (-413.724) (-412.740) [-414.686] (-414.233) * (-417.246) (-426.721) (-414.664) [-414.525] -- 0:00:41
24000 -- (-412.779) (-412.661) [-415.852] (-414.428) * [-413.261] (-428.570) (-414.984) (-418.346) -- 0:00:40
24500 -- (-413.613) (-412.364) [-413.058] (-414.195) * (-416.724) [-419.970] (-417.672) (-413.512) -- 0:00:39
25000 -- (-413.469) (-415.371) [-418.705] (-412.666) * [-416.545] (-425.098) (-415.656) (-417.360) -- 0:00:39
Average standard deviation of split frequencies: 0.045759
25500 -- (-415.266) (-415.242) [-413.363] (-413.010) * (-414.248) (-424.980) [-412.483] (-413.206) -- 0:00:38
26000 -- (-412.727) [-414.386] (-412.331) (-411.823) * (-413.581) (-427.464) [-414.841] (-417.472) -- 0:00:37
26500 -- (-412.118) (-417.197) (-413.965) [-412.175] * [-415.359] (-424.901) (-412.957) (-419.444) -- 0:00:36
27000 -- (-412.887) (-415.089) [-417.693] (-412.662) * (-412.238) (-428.745) [-412.989] (-413.537) -- 0:01:12
27500 -- (-418.751) [-412.324] (-418.121) (-413.253) * (-414.439) [-422.358] (-414.625) (-414.434) -- 0:01:10
28000 -- (-418.649) [-412.172] (-414.993) (-412.103) * (-414.790) (-430.905) (-415.060) [-414.150] -- 0:01:09
28500 -- (-416.291) [-414.943] (-419.920) (-413.333) * (-414.355) (-418.417) [-414.771] (-411.865) -- 0:01:08
29000 -- [-411.714] (-415.451) (-417.988) (-413.826) * [-412.650] (-424.968) (-413.257) (-419.732) -- 0:01:06
29500 -- [-411.510] (-414.890) (-415.721) (-413.780) * (-414.180) (-423.910) [-415.155] (-417.491) -- 0:01:05
30000 -- (-415.233) (-412.028) [-412.106] (-420.034) * (-413.996) [-417.759] (-412.883) (-413.330) -- 0:01:04
Average standard deviation of split frequencies: 0.035136
30500 -- (-416.668) [-415.365] (-413.209) (-421.084) * (-413.668) [-419.644] (-414.075) (-414.128) -- 0:01:03
31000 -- [-414.615] (-415.250) (-412.433) (-417.244) * (-412.521) [-425.843] (-413.667) (-414.705) -- 0:01:02
31500 -- [-414.343] (-414.294) (-413.436) (-413.707) * (-413.920) [-420.153] (-413.423) (-413.027) -- 0:01:01
32000 -- [-413.892] (-414.992) (-414.176) (-415.597) * (-413.074) [-418.882] (-412.723) (-418.598) -- 0:01:00
32500 -- (-415.939) (-415.076) (-414.339) [-413.118] * (-414.458) (-420.749) [-412.105] (-413.708) -- 0:00:59
33000 -- (-413.889) (-414.496) (-415.204) [-415.627] * (-413.192) [-420.172] (-415.994) (-414.347) -- 0:00:58
33500 -- (-412.944) (-414.007) [-415.645] (-415.110) * (-412.247) (-423.704) (-413.087) [-415.813] -- 0:00:57
34000 -- [-414.732] (-413.012) (-415.927) (-415.534) * [-411.860] (-427.285) (-414.252) (-418.933) -- 0:00:56
34500 -- (-413.356) (-414.341) (-413.543) [-411.875] * (-412.010) (-423.451) [-412.438] (-413.340) -- 0:00:55
35000 -- (-413.337) (-417.459) (-413.475) [-412.619] * (-412.509) [-416.032] (-415.088) (-413.182) -- 0:00:55
Average standard deviation of split frequencies: 0.038037
35500 -- (-415.720) (-414.547) [-413.450] (-412.526) * [-415.267] (-423.877) (-414.148) (-413.467) -- 0:00:54
36000 -- (-412.679) [-414.143] (-412.542) (-413.156) * [-417.444] (-422.245) (-412.292) (-421.096) -- 0:00:53
36500 -- [-412.797] (-416.420) (-412.420) (-413.229) * (-413.792) [-425.419] (-412.538) (-414.660) -- 0:00:52
37000 -- [-413.007] (-416.124) (-414.242) (-414.911) * (-413.112) (-423.583) [-415.750] (-416.560) -- 0:00:52
37500 -- (-414.382) [-412.913] (-417.216) (-414.226) * (-414.251) (-424.452) [-412.291] (-412.950) -- 0:00:51
38000 -- [-413.374] (-413.420) (-413.385) (-412.096) * [-412.565] (-426.044) (-412.316) (-415.214) -- 0:00:50
38500 -- [-415.818] (-414.443) (-412.645) (-411.860) * [-414.457] (-419.818) (-411.711) (-414.785) -- 0:00:49
39000 -- [-412.897] (-413.333) (-413.209) (-412.966) * (-413.181) [-422.130] (-415.426) (-416.380) -- 0:00:49
39500 -- (-413.738) (-412.884) (-415.339) [-413.263] * (-414.151) [-421.288] (-412.790) (-414.784) -- 0:00:48
40000 -- [-413.933] (-416.450) (-413.281) (-416.544) * (-413.730) (-427.863) [-413.676] (-415.251) -- 0:00:48
Average standard deviation of split frequencies: 0.034196
40500 -- [-412.185] (-415.649) (-417.043) (-414.726) * (-418.767) (-421.658) (-412.010) [-414.482] -- 0:00:47
41000 -- [-412.817] (-413.199) (-414.489) (-413.825) * (-414.417) (-421.156) (-414.786) [-412.391] -- 0:00:46
41500 -- (-413.435) [-414.337] (-413.118) (-414.092) * (-414.397) [-421.933] (-414.486) (-414.825) -- 0:00:46
42000 -- (-416.058) [-414.825] (-412.350) (-417.135) * (-414.546) (-423.489) (-413.266) [-414.202] -- 0:00:45
42500 -- (-412.566) (-415.963) (-415.524) [-411.805] * (-414.499) (-421.117) (-414.939) [-415.598] -- 0:00:45
43000 -- (-415.326) (-416.311) [-419.289] (-413.573) * (-415.525) (-430.256) (-413.698) [-414.556] -- 0:00:44
43500 -- [-413.627] (-413.917) (-418.085) (-414.312) * (-414.814) (-430.921) [-413.174] (-414.533) -- 0:00:43
44000 -- (-412.489) (-413.673) (-414.446) [-414.460] * (-416.911) (-421.270) [-413.175] (-413.555) -- 0:00:43
44500 -- (-413.722) (-412.888) (-413.490) [-414.074] * (-412.000) (-418.192) (-413.710) [-412.437] -- 0:01:04
45000 -- (-414.919) [-412.086] (-412.824) (-413.966) * (-412.687) [-421.045] (-412.710) (-413.334) -- 0:01:03
Average standard deviation of split frequencies: 0.033672
45500 -- (-414.359) [-414.343] (-414.186) (-412.948) * (-412.526) (-421.675) (-412.069) [-417.125] -- 0:01:02
46000 -- (-413.011) [-412.716] (-417.090) (-415.306) * (-414.317) (-420.852) [-414.947] (-413.996) -- 0:01:02
46500 -- (-413.290) [-416.050] (-413.143) (-421.484) * (-412.219) (-431.727) [-412.450] (-415.974) -- 0:01:01
47000 -- (-412.705) (-412.484) [-412.951] (-412.949) * (-414.014) [-421.646] (-412.142) (-412.558) -- 0:01:00
47500 -- [-413.473] (-413.371) (-413.586) (-418.768) * [-413.696] (-420.019) (-412.377) (-414.847) -- 0:01:00
48000 -- [-412.378] (-412.943) (-415.791) (-413.325) * (-415.195) (-430.389) [-413.374] (-413.335) -- 0:00:59
48500 -- (-414.200) (-414.402) [-413.431] (-412.623) * (-415.589) (-430.023) [-413.663] (-413.184) -- 0:00:58
49000 -- (-412.159) [-411.897] (-417.396) (-415.121) * [-413.654] (-416.113) (-417.268) (-415.658) -- 0:00:58
49500 -- (-412.330) (-411.839) (-415.070) [-412.967] * (-413.321) [-417.648] (-414.372) (-415.183) -- 0:00:57
50000 -- (-415.214) (-414.420) (-413.037) [-412.191] * (-412.399) (-414.341) [-413.264] (-415.452) -- 0:00:57
Average standard deviation of split frequencies: 0.029308
50500 -- (-419.482) (-413.278) (-416.369) [-414.905] * (-413.627) (-415.127) (-412.510) [-412.973] -- 0:00:56
51000 -- (-415.937) (-415.738) (-412.977) [-411.678] * (-412.056) [-413.135] (-416.036) (-416.395) -- 0:00:55
51500 -- (-416.916) (-418.807) (-419.354) [-413.341] * (-416.510) (-416.432) (-414.285) [-413.054] -- 0:00:55
52000 -- (-414.634) (-416.486) [-419.324] (-414.425) * (-412.982) [-413.466] (-414.204) (-412.706) -- 0:00:54
52500 -- [-415.379] (-412.597) (-415.571) (-412.469) * (-414.045) (-416.454) (-412.726) [-413.582] -- 0:00:54
53000 -- (-414.413) (-417.594) [-414.189] (-412.484) * (-413.630) (-414.547) [-412.941] (-419.559) -- 0:00:53
53500 -- (-412.211) (-418.406) (-414.661) [-413.446] * (-413.246) [-414.738] (-416.165) (-411.808) -- 0:00:53
54000 -- (-418.693) (-414.992) (-413.417) [-412.827] * [-413.648] (-412.147) (-415.013) (-412.691) -- 0:00:52
54500 -- (-419.528) [-416.911] (-416.043) (-416.159) * (-415.774) (-419.433) (-414.140) [-412.180] -- 0:00:52
55000 -- (-414.539) (-414.393) (-415.333) [-413.238] * [-412.892] (-422.503) (-412.339) (-413.987) -- 0:00:51
Average standard deviation of split frequencies: 0.030127
55500 -- [-413.997] (-413.733) (-413.481) (-412.328) * [-415.965] (-419.717) (-412.956) (-413.063) -- 0:00:51
56000 -- (-413.992) [-417.179] (-415.241) (-413.658) * (-414.812) [-413.429] (-414.695) (-413.779) -- 0:00:50
56500 -- (-417.105) (-413.179) (-413.093) [-413.800] * [-413.262] (-416.844) (-414.551) (-414.092) -- 0:00:50
57000 -- [-414.712] (-412.289) (-413.069) (-417.531) * [-415.297] (-417.766) (-413.540) (-413.949) -- 0:00:49
57500 -- (-413.347) (-412.344) (-412.727) [-415.450] * [-412.926] (-414.026) (-414.473) (-415.722) -- 0:00:49
58000 -- (-415.292) (-412.920) (-415.832) [-415.753] * (-413.372) [-416.113] (-420.612) (-413.239) -- 0:00:48
58500 -- (-419.020) (-415.753) [-412.810] (-413.790) * (-412.789) [-413.514] (-416.809) (-417.727) -- 0:00:48
59000 -- (-416.412) [-413.065] (-414.963) (-413.617) * (-414.525) [-413.352] (-414.560) (-413.434) -- 0:00:47
59500 -- (-413.241) [-413.000] (-415.327) (-412.722) * [-414.351] (-413.316) (-413.931) (-414.659) -- 0:00:47
60000 -- [-416.038] (-415.783) (-411.710) (-412.954) * [-415.532] (-421.084) (-417.183) (-412.713) -- 0:00:47
Average standard deviation of split frequencies: 0.028060
60500 -- (-412.351) (-414.217) [-414.875] (-413.230) * (-414.709) (-418.095) (-412.744) [-412.010] -- 0:00:46
61000 -- (-416.116) (-412.908) (-412.717) [-413.578] * (-412.752) [-415.907] (-414.725) (-413.043) -- 0:01:01
61500 -- (-416.679) [-413.489] (-415.624) (-414.153) * (-412.544) [-412.722] (-413.949) (-417.130) -- 0:01:01
62000 -- (-414.163) [-413.541] (-413.812) (-414.011) * (-413.758) [-413.708] (-415.855) (-412.937) -- 0:01:00
62500 -- (-413.954) (-419.583) (-412.857) [-412.480] * [-412.580] (-415.289) (-413.240) (-415.380) -- 0:01:00
63000 -- (-414.424) (-416.339) (-414.480) [-412.688] * (-414.934) [-414.159] (-412.506) (-417.314) -- 0:00:59
63500 -- (-415.484) (-416.114) (-413.156) [-412.321] * [-413.971] (-413.513) (-414.623) (-417.682) -- 0:00:58
64000 -- (-413.982) [-412.128] (-415.464) (-413.474) * (-411.988) (-412.312) (-412.585) [-413.302] -- 0:00:58
64500 -- (-412.619) [-415.631] (-414.247) (-416.183) * (-413.044) (-415.705) (-412.661) [-413.933] -- 0:00:58
65000 -- (-414.767) (-414.046) [-417.960] (-413.212) * [-413.944] (-414.144) (-412.803) (-412.657) -- 0:00:57
Average standard deviation of split frequencies: 0.026189
65500 -- (-414.362) (-413.276) (-413.620) [-414.296] * (-413.391) [-413.860] (-414.069) (-414.113) -- 0:00:57
66000 -- [-415.756] (-412.490) (-413.835) (-412.913) * (-412.800) (-415.409) [-413.369] (-424.184) -- 0:00:56
66500 -- (-416.756) [-413.447] (-413.677) (-412.718) * (-413.891) [-412.100] (-414.411) (-415.009) -- 0:00:56
67000 -- [-415.149] (-412.921) (-413.234) (-414.640) * (-412.649) [-412.611] (-412.853) (-417.869) -- 0:00:55
67500 -- (-415.462) [-412.608] (-412.373) (-413.051) * (-415.048) (-412.786) [-414.728] (-413.341) -- 0:00:55
68000 -- [-415.701] (-415.045) (-415.911) (-413.777) * (-413.155) (-417.711) [-412.577] (-412.363) -- 0:00:54
68500 -- (-418.378) (-411.622) [-413.177] (-411.862) * (-413.445) (-414.055) [-417.202] (-414.598) -- 0:00:54
69000 -- (-416.303) (-413.675) (-414.484) [-416.236] * (-412.602) (-414.778) (-419.673) [-413.864] -- 0:00:53
69500 -- (-416.573) (-414.547) [-416.376] (-413.794) * (-417.801) (-413.312) [-412.753] (-413.608) -- 0:00:53
70000 -- (-413.107) (-413.767) (-414.872) [-413.052] * (-413.397) [-413.125] (-412.972) (-412.490) -- 0:00:53
Average standard deviation of split frequencies: 0.028685
70500 -- (-415.913) (-418.700) [-415.588] (-412.251) * (-412.981) (-413.241) (-412.989) [-413.491] -- 0:00:52
71000 -- [-413.286] (-415.722) (-416.073) (-412.501) * [-413.645] (-413.963) (-412.621) (-416.575) -- 0:00:52
71500 -- (-413.723) (-414.984) (-416.519) [-415.182] * (-412.446) (-414.381) [-413.700] (-413.263) -- 0:00:51
72000 -- (-415.246) (-412.208) (-416.382) [-412.416] * (-415.101) (-414.341) [-413.894] (-414.619) -- 0:00:51
72500 -- (-412.032) (-412.639) (-413.032) [-414.634] * [-414.241] (-415.011) (-413.396) (-413.664) -- 0:00:51
73000 -- (-413.653) [-412.481] (-413.229) (-413.519) * (-421.665) (-414.238) (-416.737) [-413.157] -- 0:00:50
73500 -- (-412.577) [-414.854] (-414.737) (-414.214) * (-416.213) (-413.110) (-414.210) [-413.021] -- 0:00:50
74000 -- [-412.847] (-413.637) (-413.168) (-413.733) * (-416.292) (-413.459) (-416.709) [-414.571] -- 0:00:50
74500 -- (-415.039) [-416.078] (-416.312) (-413.058) * (-414.373) (-414.039) (-415.700) [-413.057] -- 0:00:49
75000 -- [-413.873] (-414.774) (-415.212) (-415.389) * (-412.048) (-417.602) [-413.599] (-417.746) -- 0:00:49
Average standard deviation of split frequencies: 0.029708
75500 -- (-415.313) (-413.528) [-417.000] (-416.893) * (-413.717) (-418.203) (-411.629) [-416.104] -- 0:00:48
76000 -- (-415.787) (-412.640) [-414.178] (-412.759) * (-418.136) (-413.008) [-413.169] (-421.335) -- 0:00:48
76500 -- (-415.920) (-413.798) [-412.902] (-416.063) * (-414.828) (-412.531) (-413.964) [-413.139] -- 0:00:48
77000 -- (-418.542) (-412.308) (-412.273) [-416.300] * [-412.686] (-417.034) (-420.274) (-414.971) -- 0:00:47
77500 -- (-419.084) [-412.341] (-413.291) (-419.507) * [-414.039] (-417.244) (-412.974) (-418.581) -- 0:00:47
78000 -- (-415.316) (-412.185) (-412.465) [-412.859] * (-415.176) (-414.045) [-412.244] (-415.131) -- 0:00:59
78500 -- (-413.551) [-412.202] (-419.449) (-412.372) * (-416.661) (-413.167) [-413.565] (-414.140) -- 0:00:58
79000 -- (-414.741) (-412.944) (-412.955) [-413.880] * (-415.381) (-413.568) (-414.185) [-412.683] -- 0:00:58
79500 -- (-416.257) [-414.164] (-417.335) (-413.663) * (-414.115) (-418.736) (-414.369) [-416.337] -- 0:00:57
80000 -- (-414.279) (-419.699) (-415.407) [-413.124] * [-413.327] (-419.543) (-413.043) (-414.153) -- 0:00:57
Average standard deviation of split frequencies: 0.030450
80500 -- (-414.170) (-415.793) [-415.434] (-415.058) * [-412.784] (-424.104) (-413.559) (-413.123) -- 0:00:57
81000 -- [-412.174] (-413.283) (-415.521) (-412.145) * (-413.093) (-413.544) [-414.320] (-414.154) -- 0:00:56
81500 -- (-412.151) (-412.803) (-413.869) [-412.820] * [-413.150] (-411.964) (-413.921) (-413.062) -- 0:00:56
82000 -- (-414.435) [-416.220] (-414.782) (-415.709) * [-415.644] (-414.764) (-412.843) (-414.787) -- 0:00:55
82500 -- [-412.769] (-413.317) (-412.946) (-414.299) * (-418.907) (-411.671) (-414.902) [-413.064] -- 0:00:55
83000 -- (-412.959) [-413.857] (-412.375) (-412.563) * (-414.839) (-413.373) (-414.702) [-412.197] -- 0:00:55
83500 -- (-412.916) (-413.538) (-413.488) [-413.848] * (-415.308) (-412.790) (-415.183) [-412.504] -- 0:00:54
84000 -- (-414.749) (-417.376) [-413.072] (-414.916) * (-415.560) [-412.844] (-413.826) (-413.481) -- 0:00:54
84500 -- (-414.829) (-413.566) [-412.526] (-414.133) * (-412.407) [-414.664] (-412.017) (-413.404) -- 0:00:54
85000 -- [-415.628] (-414.574) (-415.551) (-415.638) * (-419.701) (-412.232) (-413.719) [-414.428] -- 0:00:53
Average standard deviation of split frequencies: 0.025319
85500 -- [-414.570] (-415.473) (-412.703) (-414.255) * [-416.073] (-411.923) (-414.180) (-414.632) -- 0:00:53
86000 -- (-414.647) (-417.068) (-414.412) [-413.200] * (-413.429) (-413.305) (-412.256) [-414.824] -- 0:00:53
86500 -- (-414.990) (-416.300) (-415.961) [-412.565] * (-413.967) [-413.736] (-413.271) (-417.631) -- 0:00:52
87000 -- (-414.635) (-415.148) (-412.270) [-415.650] * [-413.662] (-413.850) (-413.294) (-414.916) -- 0:00:52
87500 -- (-414.876) [-421.544] (-413.815) (-413.462) * (-413.128) (-415.545) [-412.400] (-418.329) -- 0:00:52
88000 -- (-414.109) [-416.668] (-412.013) (-412.856) * (-413.386) (-413.362) [-413.080] (-415.132) -- 0:00:51
88500 -- (-412.286) (-411.900) [-415.281] (-413.754) * [-414.579] (-416.637) (-414.009) (-416.313) -- 0:00:51
89000 -- (-412.262) [-413.409] (-415.402) (-413.526) * [-415.492] (-415.223) (-417.663) (-414.231) -- 0:00:51
89500 -- (-414.881) (-414.390) [-412.922] (-415.604) * [-412.289] (-412.023) (-416.263) (-414.010) -- 0:00:50
90000 -- [-414.810] (-412.607) (-415.619) (-420.892) * [-412.985] (-412.147) (-413.073) (-413.684) -- 0:00:50
Average standard deviation of split frequencies: 0.024697
90500 -- [-412.360] (-413.459) (-416.222) (-414.175) * (-413.593) (-417.062) (-413.345) [-414.906] -- 0:00:50
91000 -- (-412.321) [-413.410] (-417.781) (-415.672) * (-413.226) (-411.930) (-416.736) [-414.727] -- 0:00:49
91500 -- (-413.752) (-412.554) [-415.744] (-412.740) * (-413.230) [-413.375] (-413.840) (-417.391) -- 0:00:49
92000 -- (-414.835) (-412.439) (-413.676) [-413.447] * [-413.686] (-413.365) (-414.197) (-420.640) -- 0:00:49
92500 -- (-414.174) (-412.993) (-414.768) [-415.395] * [-413.488] (-415.029) (-413.272) (-417.345) -- 0:00:49
93000 -- (-412.617) (-413.131) (-412.123) [-412.878] * [-413.879] (-414.286) (-413.527) (-418.519) -- 0:00:48
93500 -- (-412.143) [-414.687] (-418.332) (-411.768) * (-412.544) [-412.559] (-415.925) (-418.951) -- 0:00:48
94000 -- (-414.310) (-412.308) [-414.090] (-413.316) * (-416.923) (-413.958) (-415.302) [-414.980] -- 0:00:48
94500 -- [-415.583] (-413.343) (-412.615) (-411.763) * (-413.786) (-412.716) (-413.809) [-415.923] -- 0:00:47
95000 -- (-412.135) (-414.949) [-414.864] (-414.915) * (-415.688) (-413.667) (-413.234) [-415.073] -- 0:00:47
Average standard deviation of split frequencies: 0.021824
95500 -- (-411.643) (-413.188) (-413.593) [-412.551] * (-418.869) (-419.038) [-415.544] (-413.786) -- 0:00:56
96000 -- (-412.097) (-415.143) [-413.517] (-414.688) * [-415.273] (-415.599) (-416.290) (-412.187) -- 0:00:56
96500 -- (-412.603) (-414.217) [-411.827] (-413.038) * (-415.090) (-414.983) (-413.605) [-412.216] -- 0:00:56
97000 -- (-412.953) (-415.684) [-414.403] (-417.196) * (-416.162) (-413.671) [-414.792] (-421.447) -- 0:00:55
97500 -- (-413.237) (-415.289) (-412.019) [-413.035] * (-414.496) (-412.299) (-412.676) [-415.368] -- 0:00:55
98000 -- (-416.304) (-416.444) [-413.051] (-413.504) * (-418.335) (-411.798) [-415.082] (-414.444) -- 0:00:55
98500 -- [-413.505] (-414.557) (-413.764) (-414.601) * (-414.159) (-414.540) [-413.917] (-415.595) -- 0:00:54
99000 -- [-416.961] (-412.627) (-414.626) (-415.785) * (-413.894) [-412.017] (-413.110) (-414.571) -- 0:00:54
99500 -- [-418.182] (-414.369) (-413.718) (-413.574) * (-412.206) (-413.300) (-413.400) [-413.025] -- 0:00:54
100000 -- (-412.430) (-414.591) [-412.935] (-413.985) * [-414.784] (-412.019) (-413.741) (-411.702) -- 0:00:54
Average standard deviation of split frequencies: 0.022312
100500 -- (-413.541) [-415.655] (-415.425) (-414.869) * (-415.210) (-414.762) (-415.959) [-414.389] -- 0:00:53
101000 -- (-422.993) (-414.114) [-416.792] (-413.558) * (-412.984) (-412.276) [-414.747] (-415.409) -- 0:00:53
101500 -- (-417.452) [-415.692] (-416.352) (-412.175) * [-414.233] (-412.798) (-417.904) (-417.762) -- 0:00:53
102000 -- (-415.123) (-416.438) (-413.801) [-411.994] * (-412.116) (-412.709) [-415.880] (-412.797) -- 0:00:52
102500 -- (-413.903) (-415.008) (-413.157) [-412.204] * (-413.012) (-415.971) (-415.247) [-413.196] -- 0:00:52
103000 -- [-415.056] (-412.560) (-414.322) (-414.871) * (-412.051) (-413.029) [-415.004] (-412.167) -- 0:00:52
103500 -- (-415.899) [-417.217] (-413.776) (-414.113) * (-415.069) (-413.595) (-415.037) [-412.512] -- 0:00:51
104000 -- (-412.882) [-417.949] (-413.462) (-414.641) * [-414.938] (-413.429) (-414.539) (-414.029) -- 0:00:51
104500 -- (-412.167) (-415.346) [-413.296] (-414.057) * (-413.794) (-413.679) (-413.131) [-411.884] -- 0:00:51
105000 -- (-412.240) [-412.386] (-412.497) (-413.321) * [-413.521] (-414.305) (-413.672) (-412.333) -- 0:00:51
Average standard deviation of split frequencies: 0.021495
105500 -- (-412.237) [-412.718] (-414.733) (-420.239) * (-413.551) [-413.908] (-415.378) (-413.110) -- 0:00:50
106000 -- (-412.883) [-412.750] (-412.296) (-421.027) * [-414.264] (-415.478) (-415.377) (-416.258) -- 0:00:50
106500 -- (-412.911) (-412.812) (-416.527) [-412.669] * (-412.521) (-412.986) (-415.084) [-412.305] -- 0:00:50
107000 -- (-413.517) (-419.976) [-414.750] (-418.435) * [-413.419] (-412.555) (-413.813) (-414.880) -- 0:00:50
107500 -- [-412.247] (-417.662) (-421.521) (-414.826) * (-414.702) (-412.797) (-413.525) [-415.424] -- 0:00:49
108000 -- (-414.026) (-414.130) (-415.952) [-413.264] * (-414.490) [-413.320] (-413.218) (-415.064) -- 0:00:49
108500 -- [-411.771] (-417.475) (-415.436) (-412.248) * (-413.851) (-416.547) [-412.484] (-415.884) -- 0:00:49
109000 -- (-413.060) (-415.520) [-416.290] (-415.262) * [-412.466] (-414.379) (-412.305) (-412.925) -- 0:00:49
109500 -- (-414.258) (-417.630) [-413.372] (-414.483) * (-416.538) (-413.363) [-413.767] (-412.494) -- 0:00:48
110000 -- (-415.501) (-413.352) (-413.668) [-413.599] * [-413.037] (-413.887) (-416.816) (-414.839) -- 0:00:48
Average standard deviation of split frequencies: 0.019879
110500 -- (-412.969) (-413.216) (-413.737) [-413.873] * (-415.510) [-414.470] (-415.968) (-414.218) -- 0:00:48
111000 -- (-412.255) [-415.440] (-413.266) (-414.050) * (-414.244) (-414.246) [-414.579] (-414.252) -- 0:00:48
111500 -- (-412.521) (-413.843) (-416.509) [-412.252] * [-416.396] (-414.547) (-415.969) (-413.970) -- 0:00:47
112000 -- (-414.443) (-413.126) (-413.605) [-412.901] * [-412.726] (-413.421) (-414.643) (-414.532) -- 0:00:47
112500 -- [-412.486] (-415.325) (-413.435) (-413.232) * [-414.550] (-416.825) (-415.640) (-414.067) -- 0:00:55
113000 -- (-412.825) (-412.483) [-415.406] (-416.423) * (-413.941) (-414.711) (-412.392) [-412.737] -- 0:00:54
113500 -- (-413.470) (-417.421) (-414.360) [-414.374] * (-414.065) [-416.968] (-419.927) (-417.179) -- 0:00:54
114000 -- (-412.975) [-416.235] (-413.200) (-415.159) * [-413.146] (-413.874) (-419.706) (-414.525) -- 0:00:54
114500 -- [-412.061] (-416.876) (-413.375) (-412.689) * [-412.627] (-413.607) (-413.276) (-414.725) -- 0:00:54
115000 -- (-414.376) (-411.726) [-416.283] (-417.075) * (-413.210) (-412.068) (-412.138) [-414.776] -- 0:00:53
Average standard deviation of split frequencies: 0.020558
115500 -- [-411.882] (-413.739) (-414.496) (-414.054) * (-413.010) (-412.289) [-414.679] (-414.540) -- 0:00:53
116000 -- (-419.734) (-417.475) [-414.465] (-412.043) * (-412.786) (-412.436) [-413.034] (-417.323) -- 0:00:53
116500 -- [-411.779] (-412.104) (-416.287) (-413.150) * (-414.992) (-411.923) [-412.588] (-413.769) -- 0:00:53
117000 -- (-412.321) [-412.330] (-419.139) (-414.540) * (-416.354) (-413.243) [-414.063] (-414.447) -- 0:00:52
117500 -- (-417.538) [-414.190] (-414.126) (-413.046) * (-416.337) (-414.772) [-413.071] (-416.205) -- 0:00:52
118000 -- (-416.853) (-412.369) (-415.524) [-411.650] * (-415.001) (-415.206) (-412.858) [-413.222] -- 0:00:52
118500 -- [-415.703] (-412.891) (-413.603) (-417.844) * (-415.595) (-412.781) [-412.197] (-412.552) -- 0:00:52
119000 -- [-413.725] (-415.518) (-412.938) (-412.881) * [-413.633] (-414.774) (-415.138) (-412.767) -- 0:00:51
119500 -- [-412.243] (-414.228) (-413.499) (-414.029) * (-414.094) (-420.131) [-415.507] (-413.049) -- 0:00:51
120000 -- (-412.319) [-413.015] (-413.975) (-413.017) * (-414.233) [-413.498] (-413.688) (-415.218) -- 0:00:51
Average standard deviation of split frequencies: 0.018384
120500 -- (-412.243) (-414.910) (-414.329) [-412.592] * (-412.778) (-415.217) [-414.295] (-413.410) -- 0:00:51
121000 -- [-413.108] (-414.076) (-412.859) (-412.190) * [-415.786] (-413.386) (-413.644) (-414.217) -- 0:00:50
121500 -- (-415.658) (-414.931) [-412.481] (-414.446) * (-414.047) [-413.085] (-411.708) (-412.322) -- 0:00:50
122000 -- [-414.368] (-415.767) (-413.868) (-419.330) * [-412.009] (-416.408) (-412.562) (-414.634) -- 0:00:50
122500 -- (-415.085) (-412.892) [-416.419] (-420.155) * (-412.332) (-417.226) (-416.748) [-415.537] -- 0:00:50
123000 -- (-411.819) (-413.749) (-414.253) [-416.155] * (-413.645) [-415.741] (-416.690) (-415.377) -- 0:00:49
123500 -- (-413.763) [-413.152] (-412.464) (-414.104) * (-413.608) [-416.074] (-412.397) (-417.717) -- 0:00:49
124000 -- (-416.705) (-413.582) [-416.255] (-416.219) * (-419.176) (-411.823) [-412.526] (-415.134) -- 0:00:49
124500 -- (-420.730) (-414.682) [-416.845] (-414.942) * (-418.174) (-415.942) [-417.671] (-414.344) -- 0:00:49
125000 -- [-417.744] (-414.619) (-413.832) (-414.579) * (-413.678) (-414.327) [-413.102] (-412.822) -- 0:00:49
Average standard deviation of split frequencies: 0.019954
125500 -- (-414.585) (-414.162) [-418.623] (-413.486) * (-412.538) (-413.777) [-411.986] (-414.653) -- 0:00:48
126000 -- (-416.712) (-412.682) (-414.865) [-415.709] * (-413.568) (-411.609) [-412.800] (-415.058) -- 0:00:48
126500 -- [-414.150] (-413.136) (-413.210) (-415.709) * (-415.547) (-412.494) (-414.211) [-413.682] -- 0:00:48
127000 -- [-413.992] (-414.842) (-414.863) (-412.576) * [-414.559] (-416.651) (-414.621) (-416.340) -- 0:00:48
127500 -- [-414.163] (-412.068) (-414.202) (-415.796) * (-416.356) (-412.401) (-412.640) [-415.344] -- 0:00:47
128000 -- (-420.197) (-413.687) (-412.649) [-419.800] * (-414.446) (-413.269) [-418.779] (-413.585) -- 0:00:47
128500 -- [-412.861] (-416.529) (-413.305) (-413.447) * (-412.588) (-416.150) (-414.381) [-412.386] -- 0:00:47
129000 -- (-413.883) (-412.778) (-414.259) [-414.085] * (-413.999) (-416.466) (-412.927) [-412.655] -- 0:00:47
129500 -- (-415.579) (-413.542) (-414.031) [-413.866] * [-416.600] (-413.479) (-412.665) (-412.827) -- 0:00:53
130000 -- (-416.339) (-412.198) [-413.821] (-413.687) * (-414.400) (-414.611) (-413.328) [-415.666] -- 0:00:53
Average standard deviation of split frequencies: 0.019041
130500 -- (-413.995) [-413.201] (-417.601) (-414.624) * (-412.610) [-415.531] (-413.389) (-414.527) -- 0:00:53
131000 -- (-414.858) [-413.520] (-414.622) (-412.728) * [-412.228] (-414.534) (-414.133) (-415.253) -- 0:00:53
131500 -- (-414.608) (-417.863) [-414.147] (-412.382) * (-414.590) (-412.179) (-413.825) [-416.119] -- 0:00:52
132000 -- (-413.926) (-413.301) [-413.849] (-414.189) * [-415.484] (-413.226) (-415.844) (-417.455) -- 0:00:52
132500 -- (-412.360) [-413.443] (-414.768) (-412.929) * (-412.322) (-415.416) [-412.521] (-413.165) -- 0:00:52
133000 -- (-415.254) (-416.348) (-412.706) [-413.037] * [-414.826] (-412.916) (-414.971) (-414.893) -- 0:00:52
133500 -- (-413.468) (-414.244) [-412.933] (-416.449) * (-417.292) (-415.221) [-412.956] (-412.015) -- 0:00:51
134000 -- [-412.138] (-412.440) (-411.906) (-415.624) * [-415.924] (-414.433) (-414.517) (-419.874) -- 0:00:51
134500 -- (-415.269) (-416.465) (-413.028) [-413.814] * (-413.398) (-413.077) (-412.784) [-412.275] -- 0:00:51
135000 -- (-413.511) (-413.972) (-415.998) [-412.917] * [-412.651] (-412.462) (-412.893) (-413.154) -- 0:00:51
Average standard deviation of split frequencies: 0.019574
135500 -- (-418.092) [-413.286] (-415.223) (-413.081) * (-412.422) (-413.647) [-415.980] (-413.725) -- 0:00:51
136000 -- (-415.398) (-417.498) (-415.194) [-413.177] * (-414.734) [-413.755] (-414.579) (-415.438) -- 0:00:50
136500 -- [-412.937] (-413.349) (-415.870) (-420.756) * (-412.604) [-412.842] (-413.775) (-413.839) -- 0:00:50
137000 -- [-413.768] (-413.602) (-413.124) (-415.902) * (-415.206) (-413.830) [-415.640] (-414.932) -- 0:00:50
137500 -- (-417.044) (-411.999) (-415.345) [-413.156] * [-416.595] (-413.851) (-419.749) (-413.915) -- 0:00:50
138000 -- (-411.817) (-414.454) [-414.498] (-412.497) * (-413.455) (-413.070) (-412.602) [-412.049] -- 0:00:49
138500 -- [-411.970] (-412.073) (-413.201) (-415.880) * (-412.902) (-417.711) (-412.258) [-414.636] -- 0:00:49
139000 -- (-413.547) (-411.915) (-418.339) [-413.465] * (-412.174) [-413.288] (-413.166) (-415.314) -- 0:00:49
139500 -- (-414.471) (-412.607) [-414.458] (-415.437) * [-413.197] (-412.836) (-417.387) (-413.598) -- 0:00:49
140000 -- [-413.177] (-414.685) (-413.011) (-413.089) * (-412.475) [-415.302] (-415.108) (-415.299) -- 0:00:49
Average standard deviation of split frequencies: 0.019549
140500 -- (-413.030) (-412.729) [-413.880] (-418.841) * (-413.446) [-414.362] (-413.710) (-411.976) -- 0:00:48
141000 -- [-412.870] (-413.457) (-419.605) (-413.809) * [-413.906] (-414.128) (-413.653) (-411.770) -- 0:00:48
141500 -- (-414.002) [-413.980] (-416.881) (-412.770) * [-413.273] (-414.958) (-417.491) (-412.726) -- 0:00:48
142000 -- (-413.311) (-412.994) [-414.572] (-412.754) * (-414.776) (-412.138) (-414.844) [-418.873] -- 0:00:48
142500 -- [-414.675] (-414.922) (-413.913) (-417.161) * (-415.563) (-414.672) [-416.532] (-414.492) -- 0:00:48
143000 -- (-413.570) (-412.832) (-416.601) [-418.305] * [-415.079] (-413.820) (-414.638) (-417.724) -- 0:00:47
143500 -- (-414.801) (-412.167) [-416.612] (-414.675) * (-413.820) (-415.089) (-415.563) [-413.259] -- 0:00:47
144000 -- (-425.609) [-413.095] (-417.858) (-412.853) * [-414.557] (-412.666) (-415.873) (-414.824) -- 0:00:47
144500 -- (-414.867) (-413.936) (-413.916) [-414.648] * (-413.670) (-412.873) (-412.500) [-412.265] -- 0:00:47
145000 -- (-416.334) (-412.602) [-415.348] (-413.848) * (-412.443) (-414.356) (-412.999) [-413.655] -- 0:00:47
Average standard deviation of split frequencies: 0.017758
145500 -- [-411.973] (-415.109) (-418.204) (-412.368) * [-413.347] (-412.545) (-414.565) (-414.877) -- 0:00:46
146000 -- (-413.379) (-418.393) (-419.341) [-412.038] * [-412.617] (-412.440) (-413.403) (-412.971) -- 0:00:46
146500 -- [-413.673] (-415.224) (-413.180) (-416.822) * [-412.955] (-417.193) (-416.026) (-412.454) -- 0:00:52
147000 -- (-416.517) (-414.263) [-412.493] (-415.031) * [-413.231] (-412.748) (-413.418) (-416.465) -- 0:00:52
147500 -- (-415.574) (-417.950) (-414.870) [-412.998] * (-413.243) [-411.764] (-414.434) (-418.459) -- 0:00:52
148000 -- [-415.640] (-412.353) (-413.614) (-413.692) * [-413.698] (-417.909) (-413.150) (-414.179) -- 0:00:51
148500 -- (-414.416) (-412.933) (-414.628) [-413.320] * (-413.965) (-415.051) [-413.050] (-412.568) -- 0:00:51
149000 -- [-413.323] (-413.807) (-415.438) (-414.024) * (-412.499) [-412.903] (-414.854) (-419.516) -- 0:00:51
149500 -- (-413.027) [-413.701] (-417.111) (-415.260) * [-414.131] (-412.463) (-417.872) (-412.812) -- 0:00:51
150000 -- (-415.839) [-413.379] (-416.392) (-415.518) * (-411.722) (-412.903) (-413.838) [-412.787] -- 0:00:51
Average standard deviation of split frequencies: 0.019596
150500 -- (-412.258) (-415.399) (-414.041) [-412.849] * (-413.515) (-414.405) [-412.401] (-415.357) -- 0:00:50
151000 -- (-414.826) (-418.315) [-416.559] (-415.497) * (-414.074) [-413.992] (-413.412) (-413.538) -- 0:00:50
151500 -- (-414.093) [-413.135] (-413.104) (-415.160) * (-422.891) (-417.560) [-412.254] (-411.929) -- 0:00:50
152000 -- [-415.389] (-414.266) (-412.671) (-413.362) * (-416.688) [-414.606] (-413.995) (-415.549) -- 0:00:50
152500 -- (-413.717) (-415.212) [-415.193] (-413.012) * [-413.439] (-412.058) (-412.295) (-413.921) -- 0:00:50
153000 -- (-412.617) (-416.824) [-415.655] (-413.955) * (-413.556) [-416.191] (-413.099) (-419.191) -- 0:00:49
153500 -- [-414.465] (-415.810) (-415.917) (-411.857) * (-414.904) (-412.899) (-418.761) [-414.996] -- 0:00:49
154000 -- [-412.609] (-417.790) (-418.697) (-415.009) * (-414.601) (-413.815) [-413.716] (-412.543) -- 0:00:49
154500 -- (-415.367) [-415.017] (-413.421) (-412.543) * (-416.783) [-414.568] (-414.889) (-415.480) -- 0:00:49
155000 -- (-412.590) (-413.045) [-413.705] (-414.011) * (-414.674) (-414.372) [-413.151] (-412.716) -- 0:00:49
Average standard deviation of split frequencies: 0.019721
155500 -- (-413.449) [-416.101] (-418.905) (-415.119) * (-412.402) [-413.244] (-415.267) (-413.074) -- 0:00:48
156000 -- (-413.397) (-415.109) [-416.725] (-413.300) * [-412.312] (-412.822) (-413.410) (-411.679) -- 0:00:48
156500 -- (-415.080) (-414.904) (-414.076) [-413.552] * (-413.832) (-413.111) (-413.499) [-412.428] -- 0:00:48
157000 -- (-413.798) [-413.915] (-412.267) (-415.120) * (-413.594) (-412.832) [-412.024] (-416.923) -- 0:00:48
157500 -- [-415.011] (-414.654) (-413.258) (-412.812) * [-418.300] (-413.060) (-413.482) (-416.654) -- 0:00:48
158000 -- (-414.784) (-414.305) [-412.451] (-413.411) * [-413.109] (-414.459) (-412.946) (-418.791) -- 0:00:47
158500 -- [-412.566] (-416.249) (-415.080) (-412.457) * (-413.010) (-415.273) [-414.720] (-415.560) -- 0:00:47
159000 -- (-413.826) (-413.889) (-413.362) [-412.182] * (-415.508) (-413.590) [-414.819] (-415.054) -- 0:00:47
159500 -- (-420.356) (-413.999) [-414.299] (-415.445) * [-413.062] (-413.653) (-417.135) (-413.369) -- 0:00:47
160000 -- (-412.768) [-417.275] (-414.298) (-415.989) * (-413.167) (-415.403) (-415.543) [-412.440] -- 0:00:47
Average standard deviation of split frequencies: 0.019397
160500 -- [-416.368] (-412.268) (-412.510) (-412.726) * (-412.628) (-416.612) (-412.746) [-415.823] -- 0:00:47
161000 -- [-414.249] (-412.526) (-415.178) (-413.491) * [-414.797] (-412.917) (-413.081) (-416.606) -- 0:00:46
161500 -- (-418.584) (-414.477) (-413.235) [-416.803] * [-413.551] (-415.596) (-413.896) (-412.668) -- 0:00:46
162000 -- [-412.846] (-412.532) (-414.229) (-419.482) * (-413.012) (-412.826) (-413.904) [-413.446] -- 0:00:46
162500 -- (-412.559) (-414.182) (-413.117) [-417.377] * (-412.399) [-413.263] (-413.729) (-415.464) -- 0:00:46
163000 -- (-413.437) (-415.896) [-413.239] (-414.236) * (-413.182) [-413.457] (-412.674) (-415.427) -- 0:00:46
163500 -- [-413.810] (-413.475) (-411.982) (-414.664) * (-415.415) (-412.733) (-414.850) [-414.092] -- 0:00:46
164000 -- [-412.453] (-412.992) (-412.674) (-414.592) * (-414.716) (-412.754) (-418.413) [-413.551] -- 0:00:50
164500 -- [-412.856] (-412.692) (-413.004) (-416.214) * (-413.103) (-412.673) (-414.503) [-412.653] -- 0:00:50
165000 -- [-416.429] (-412.971) (-415.143) (-417.167) * (-412.703) (-412.723) (-414.389) [-420.849] -- 0:00:50
Average standard deviation of split frequencies: 0.020194
165500 -- (-415.388) (-413.886) [-412.719] (-417.016) * (-414.330) [-411.840] (-416.947) (-413.778) -- 0:00:50
166000 -- (-415.697) (-413.008) (-414.528) [-416.113] * (-417.394) [-411.604] (-416.102) (-416.156) -- 0:00:50
166500 -- (-417.061) (-416.131) [-415.132] (-416.745) * (-416.013) (-411.790) [-416.037] (-412.483) -- 0:00:50
167000 -- (-414.795) (-411.901) (-414.140) [-412.282] * (-414.760) [-412.250] (-413.818) (-413.443) -- 0:00:49
167500 -- (-413.334) [-412.244] (-414.391) (-411.740) * [-417.341] (-412.893) (-413.831) (-417.171) -- 0:00:49
168000 -- [-412.735] (-412.212) (-414.507) (-413.581) * (-416.498) (-414.156) [-413.312] (-414.929) -- 0:00:49
168500 -- [-412.300] (-413.449) (-414.876) (-412.247) * [-414.503] (-413.580) (-413.801) (-415.288) -- 0:00:49
169000 -- [-413.687] (-411.802) (-414.682) (-412.442) * (-412.058) (-413.737) (-414.548) [-414.419] -- 0:00:49
169500 -- (-415.608) [-413.111] (-413.562) (-414.267) * (-414.769) (-411.624) (-417.307) [-413.351] -- 0:00:48
170000 -- [-416.747] (-415.239) (-416.725) (-416.517) * (-414.597) (-412.374) (-417.405) [-412.676] -- 0:00:48
Average standard deviation of split frequencies: 0.019028
170500 -- (-412.291) [-416.305] (-412.164) (-417.530) * [-412.656] (-412.276) (-412.959) (-414.817) -- 0:00:48
171000 -- (-415.862) (-414.810) [-413.687] (-413.664) * (-413.902) (-413.235) (-413.992) [-414.519] -- 0:00:48
171500 -- (-418.121) (-417.097) (-413.466) [-414.550] * (-413.281) (-414.335) (-414.280) [-417.572] -- 0:00:48
172000 -- (-414.587) [-414.364] (-417.188) (-415.454) * (-413.394) [-412.861] (-412.807) (-414.081) -- 0:00:48
172500 -- (-413.034) (-413.246) [-414.936] (-419.140) * [-412.634] (-415.436) (-411.908) (-418.084) -- 0:00:47
173000 -- [-413.276] (-413.638) (-413.025) (-416.422) * (-414.102) (-412.243) [-413.871] (-414.999) -- 0:00:47
173500 -- (-413.278) (-415.395) [-415.277] (-416.595) * (-415.978) (-412.310) [-416.562] (-413.297) -- 0:00:47
174000 -- (-412.823) (-413.573) [-418.482] (-411.985) * (-415.715) (-412.817) (-416.244) [-415.028] -- 0:00:47
174500 -- [-412.845] (-412.841) (-414.641) (-412.933) * (-414.686) [-413.838] (-413.199) (-414.849) -- 0:00:47
175000 -- (-413.224) [-412.771] (-416.030) (-416.794) * (-413.797) [-412.351] (-413.100) (-413.784) -- 0:00:47
Average standard deviation of split frequencies: 0.018005
175500 -- (-414.837) [-413.541] (-413.160) (-416.201) * (-414.060) [-412.759] (-413.917) (-415.873) -- 0:00:46
176000 -- (-419.497) (-412.900) (-414.663) [-414.321] * (-413.609) (-412.770) (-416.048) [-413.206] -- 0:00:46
176500 -- (-415.948) [-414.112] (-413.941) (-412.150) * (-413.324) (-412.372) [-413.231] (-413.998) -- 0:00:46
177000 -- (-421.221) (-411.900) [-413.400] (-415.877) * (-412.740) (-413.696) [-411.847] (-412.837) -- 0:00:46
177500 -- (-420.289) [-412.857] (-412.634) (-412.411) * (-413.637) (-415.287) (-415.592) [-413.105] -- 0:00:46
178000 -- [-415.313] (-415.725) (-412.892) (-414.176) * (-417.372) (-413.026) (-414.381) [-415.580] -- 0:00:46
178500 -- [-414.639] (-415.875) (-416.251) (-414.267) * (-414.399) (-412.060) (-414.085) [-413.752] -- 0:00:46
179000 -- (-417.258) [-413.105] (-418.925) (-412.175) * (-413.441) (-412.284) [-414.333] (-412.956) -- 0:00:45
179500 -- (-414.657) (-416.455) [-412.103] (-412.874) * (-418.588) (-412.942) (-416.740) [-413.039] -- 0:00:45
180000 -- [-415.650] (-415.268) (-412.897) (-413.486) * (-413.958) (-412.468) (-414.371) [-412.240] -- 0:00:45
Average standard deviation of split frequencies: 0.016754
180500 -- (-414.258) [-412.310] (-416.909) (-414.127) * (-413.350) (-413.860) (-412.108) [-413.273] -- 0:00:45
181000 -- [-416.002] (-415.941) (-414.775) (-416.530) * (-414.108) (-415.424) [-413.948] (-413.338) -- 0:00:49
181500 -- (-419.392) (-413.335) (-413.900) [-417.453] * (-414.301) (-413.829) (-414.953) [-412.303] -- 0:00:49
182000 -- [-414.142] (-413.130) (-413.304) (-418.729) * (-416.600) [-415.607] (-413.377) (-414.465) -- 0:00:49
182500 -- (-414.076) (-414.152) [-414.699] (-415.196) * (-417.588) (-415.605) [-416.937] (-417.653) -- 0:00:49
183000 -- [-418.486] (-412.701) (-412.554) (-417.775) * [-412.955] (-412.225) (-418.730) (-414.562) -- 0:00:49
183500 -- (-413.679) (-413.113) [-413.151] (-415.377) * (-412.226) [-411.717] (-417.397) (-412.235) -- 0:00:48
184000 -- (-413.483) [-416.354] (-415.140) (-416.057) * (-414.240) [-412.664] (-417.873) (-416.224) -- 0:00:48
184500 -- (-412.670) (-414.321) [-415.697] (-413.477) * (-413.166) (-413.078) (-412.795) [-413.203] -- 0:00:48
185000 -- (-414.673) [-418.362] (-418.414) (-412.121) * (-414.346) [-417.995] (-413.692) (-418.490) -- 0:00:48
Average standard deviation of split frequencies: 0.018008
185500 -- (-414.190) [-414.225] (-415.959) (-413.224) * (-413.983) (-412.488) [-413.351] (-414.207) -- 0:00:48
186000 -- [-414.688] (-417.232) (-412.986) (-414.979) * (-412.600) (-416.894) (-413.420) [-415.324] -- 0:00:48
186500 -- (-418.309) [-412.672] (-412.043) (-414.470) * (-415.646) (-414.296) (-413.587) [-415.110] -- 0:00:47
187000 -- (-417.615) (-417.382) [-412.063] (-415.218) * (-414.611) (-414.090) [-413.000] (-415.804) -- 0:00:47
187500 -- [-417.118] (-414.367) (-414.726) (-413.003) * [-415.104] (-416.163) (-415.305) (-412.453) -- 0:00:47
188000 -- (-415.250) (-414.861) [-412.118] (-413.763) * [-412.801] (-414.372) (-414.510) (-418.472) -- 0:00:47
188500 -- (-413.737) (-413.349) [-413.881] (-417.445) * (-412.873) [-412.820] (-412.895) (-413.346) -- 0:00:47
189000 -- (-412.062) (-413.882) (-416.054) [-413.421] * (-413.996) [-414.166] (-416.652) (-413.436) -- 0:00:47
189500 -- (-415.073) [-412.141] (-412.850) (-413.796) * [-414.571] (-413.047) (-416.087) (-421.001) -- 0:00:47
190000 -- (-413.859) (-412.639) (-417.848) [-412.815] * (-414.352) (-412.785) [-414.932] (-419.892) -- 0:00:46
Average standard deviation of split frequencies: 0.018131
190500 -- (-412.635) (-413.658) [-418.207] (-413.971) * [-413.149] (-414.376) (-416.968) (-418.049) -- 0:00:46
191000 -- (-413.488) (-413.526) [-412.715] (-414.144) * (-417.240) (-419.965) (-413.678) [-419.810] -- 0:00:46
191500 -- (-412.433) (-413.092) (-419.740) [-413.702] * (-418.401) (-412.920) (-412.891) [-413.711] -- 0:00:46
192000 -- (-412.701) [-413.297] (-416.595) (-412.226) * (-414.822) (-418.733) (-413.716) [-413.289] -- 0:00:46
192500 -- (-413.827) [-412.869] (-412.879) (-414.849) * [-413.528] (-413.172) (-416.921) (-416.008) -- 0:00:46
193000 -- [-412.437] (-413.562) (-412.562) (-416.493) * [-414.842] (-422.281) (-414.341) (-420.318) -- 0:00:45
193500 -- (-413.999) [-414.555] (-412.219) (-418.466) * (-413.130) (-416.058) (-417.086) [-413.993] -- 0:00:45
194000 -- (-418.636) (-413.758) [-415.854] (-413.051) * [-413.173] (-416.130) (-411.658) (-413.792) -- 0:00:45
194500 -- (-417.076) [-412.647] (-414.001) (-416.085) * (-412.499) [-413.766] (-412.346) (-412.647) -- 0:00:45
195000 -- (-414.694) [-412.019] (-412.992) (-421.078) * (-414.138) (-417.115) (-413.421) [-415.142] -- 0:00:45
Average standard deviation of split frequencies: 0.017216
195500 -- (-413.089) (-414.433) (-414.898) [-414.322] * [-412.647] (-416.990) (-413.894) (-416.332) -- 0:00:45
196000 -- [-412.390] (-412.179) (-414.849) (-417.101) * (-412.181) (-413.647) (-414.651) [-413.831] -- 0:00:45
196500 -- (-413.736) (-414.777) (-413.088) [-416.411] * (-413.382) (-413.527) (-415.774) [-415.228] -- 0:00:44
197000 -- [-412.778] (-416.068) (-412.267) (-417.478) * [-413.651] (-413.240) (-415.058) (-413.851) -- 0:00:44
197500 -- [-415.312] (-416.479) (-412.096) (-419.470) * [-412.664] (-416.559) (-413.680) (-413.747) -- 0:00:44
198000 -- (-417.733) [-418.462] (-415.293) (-415.157) * [-413.230] (-412.188) (-414.553) (-413.950) -- 0:00:48
198500 -- (-415.986) (-416.919) [-419.228] (-414.719) * (-412.131) (-412.265) (-414.302) [-412.600] -- 0:00:48
199000 -- (-413.314) [-413.377] (-415.821) (-412.486) * (-412.850) (-411.767) (-412.364) [-412.282] -- 0:00:48
199500 -- (-414.282) (-415.504) [-416.953] (-413.255) * (-412.633) (-412.174) [-414.150] (-413.249) -- 0:00:48
200000 -- [-417.037] (-415.506) (-413.640) (-413.937) * (-412.995) [-412.061] (-412.686) (-414.045) -- 0:00:48
Average standard deviation of split frequencies: 0.018924
200500 -- [-413.740] (-412.459) (-415.590) (-416.901) * (-412.392) (-413.555) (-412.185) [-413.725] -- 0:00:47
201000 -- (-412.705) [-412.542] (-417.401) (-413.955) * (-416.597) [-413.170] (-421.491) (-416.987) -- 0:00:47
201500 -- (-412.855) [-414.334] (-414.141) (-413.123) * [-417.658] (-413.350) (-415.022) (-415.545) -- 0:00:47
202000 -- (-414.081) [-414.558] (-413.050) (-413.732) * (-413.025) (-412.458) [-412.207] (-415.198) -- 0:00:47
202500 -- (-415.003) (-414.715) (-414.499) [-413.567] * (-412.622) [-412.760] (-414.663) (-415.449) -- 0:00:47
203000 -- (-412.352) [-413.057] (-414.636) (-418.630) * (-414.331) [-414.465] (-418.003) (-417.065) -- 0:00:47
203500 -- (-415.412) [-412.262] (-417.272) (-413.279) * (-413.226) [-412.627] (-412.454) (-414.225) -- 0:00:46
204000 -- (-414.085) [-412.326] (-416.458) (-412.292) * [-415.826] (-414.220) (-413.793) (-416.052) -- 0:00:46
204500 -- (-413.861) [-414.859] (-414.333) (-413.219) * [-414.104] (-413.054) (-413.233) (-411.921) -- 0:00:46
205000 -- (-417.352) (-416.790) [-413.206] (-412.055) * [-414.022] (-412.037) (-417.256) (-417.236) -- 0:00:46
Average standard deviation of split frequencies: 0.018765
205500 -- (-413.158) (-413.570) (-414.052) [-414.214] * [-412.036] (-412.638) (-417.792) (-416.572) -- 0:00:46
206000 -- (-416.021) (-413.152) (-413.851) [-413.679] * (-414.965) (-415.329) (-411.871) [-412.753] -- 0:00:46
206500 -- (-416.081) (-414.100) [-416.325] (-412.924) * (-415.676) [-414.560] (-416.454) (-412.164) -- 0:00:46
207000 -- [-413.806] (-412.426) (-416.296) (-412.730) * (-414.678) [-412.261] (-413.248) (-416.115) -- 0:00:45
207500 -- [-415.570] (-414.729) (-413.917) (-413.395) * [-413.719] (-413.162) (-414.995) (-413.265) -- 0:00:45
208000 -- (-416.253) [-417.203] (-416.453) (-414.562) * (-413.867) [-413.233] (-413.361) (-416.098) -- 0:00:45
208500 -- (-413.431) (-415.685) [-412.902] (-416.269) * [-411.720] (-412.745) (-413.925) (-412.731) -- 0:00:45
209000 -- (-413.290) (-415.222) (-412.967) [-421.345] * (-412.984) (-415.582) (-414.836) [-413.902] -- 0:00:45
209500 -- (-414.017) [-418.014] (-412.503) (-412.748) * [-411.751] (-414.119) (-414.370) (-417.328) -- 0:00:45
210000 -- (-415.382) [-418.303] (-413.432) (-414.295) * (-413.050) (-412.940) [-416.269] (-413.992) -- 0:00:45
Average standard deviation of split frequencies: 0.020139
210500 -- (-417.800) (-412.152) (-417.100) [-415.275] * [-414.488] (-417.374) (-418.314) (-414.378) -- 0:00:45
211000 -- (-414.336) [-414.446] (-414.175) (-415.917) * (-414.210) [-412.813] (-414.886) (-412.522) -- 0:00:44
211500 -- (-415.136) (-412.620) (-413.973) [-413.009] * (-415.079) (-415.552) [-417.335] (-412.309) -- 0:00:44
212000 -- (-415.465) [-413.275] (-414.572) (-412.402) * (-422.735) (-415.262) (-412.755) [-412.512] -- 0:00:44
212500 -- (-417.765) (-413.730) (-415.057) [-413.883] * (-419.717) [-413.952] (-413.901) (-414.255) -- 0:00:44
213000 -- (-416.270) (-414.376) [-412.605] (-414.164) * (-415.827) (-413.239) (-412.986) [-415.300] -- 0:00:44
213500 -- (-417.856) (-415.380) (-414.138) [-413.980] * [-415.464] (-412.077) (-414.242) (-413.794) -- 0:00:44
214000 -- (-415.604) (-413.901) (-414.320) [-413.628] * [-413.088] (-413.035) (-414.839) (-412.774) -- 0:00:44
214500 -- [-413.731] (-413.328) (-414.430) (-413.049) * [-413.464] (-415.620) (-419.014) (-412.555) -- 0:00:43
215000 -- (-416.130) [-412.575] (-412.626) (-413.148) * (-414.263) (-413.431) (-422.598) [-414.618] -- 0:00:47
Average standard deviation of split frequencies: 0.020248
215500 -- (-414.455) (-412.454) (-412.244) [-413.817] * (-416.505) (-412.494) (-421.386) [-414.642] -- 0:00:47
216000 -- (-414.772) (-417.981) [-411.919] (-412.154) * [-411.784] (-414.165) (-412.874) (-419.634) -- 0:00:47
216500 -- (-414.864) (-419.612) [-415.045] (-412.697) * (-412.321) (-414.761) [-412.844] (-413.130) -- 0:00:47
217000 -- [-414.354] (-412.638) (-416.042) (-415.660) * (-414.490) (-412.920) (-413.808) [-416.620] -- 0:00:46
217500 -- (-415.875) [-413.045] (-413.361) (-412.173) * (-413.039) (-416.031) (-414.030) [-413.289] -- 0:00:46
218000 -- [-416.034] (-412.577) (-413.349) (-411.678) * (-413.682) (-414.379) [-414.255] (-413.338) -- 0:00:46
218500 -- (-416.782) (-413.867) (-413.069) [-412.724] * (-416.410) (-420.319) [-415.893] (-415.123) -- 0:00:46
219000 -- (-418.507) (-413.832) (-412.181) [-412.207] * [-414.622] (-416.055) (-414.222) (-412.929) -- 0:00:46
219500 -- (-413.614) (-412.714) (-413.007) [-415.463] * (-415.239) (-414.214) (-414.124) [-415.606] -- 0:00:46
220000 -- (-413.897) (-412.749) (-418.894) [-412.844] * (-413.086) (-413.323) (-414.958) [-412.148] -- 0:00:46
Average standard deviation of split frequencies: 0.019603
220500 -- (-415.037) (-412.737) (-416.510) [-414.770] * (-417.300) (-415.147) (-412.518) [-412.354] -- 0:00:45
221000 -- (-413.151) (-413.658) (-413.860) [-412.904] * [-414.309] (-414.814) (-415.106) (-411.773) -- 0:00:45
221500 -- (-412.004) (-412.396) (-413.523) [-414.768] * (-415.072) (-413.172) (-412.951) [-414.504] -- 0:00:45
222000 -- (-412.801) (-413.932) [-413.059] (-412.433) * (-414.589) [-412.430] (-413.666) (-416.042) -- 0:00:45
222500 -- (-412.734) (-413.480) [-417.454] (-411.826) * (-414.138) [-413.329] (-413.708) (-413.111) -- 0:00:45
223000 -- (-413.622) (-416.994) (-412.974) [-413.600] * (-412.424) (-413.316) (-412.384) [-413.722] -- 0:00:45
223500 -- (-414.622) [-416.144] (-418.215) (-414.301) * (-413.445) (-417.985) [-413.147] (-415.373) -- 0:00:45
224000 -- [-412.848] (-417.892) (-414.171) (-413.850) * [-413.029] (-416.299) (-412.591) (-415.275) -- 0:00:45
224500 -- (-416.242) (-415.846) [-413.418] (-417.106) * [-415.657] (-413.543) (-413.623) (-414.051) -- 0:00:44
225000 -- [-411.640] (-416.990) (-416.482) (-418.203) * [-413.319] (-413.317) (-414.901) (-413.997) -- 0:00:44
Average standard deviation of split frequencies: 0.019352
225500 -- [-411.815] (-414.285) (-415.207) (-413.452) * (-412.964) (-413.237) (-413.490) [-415.483] -- 0:00:44
226000 -- (-413.951) [-416.075] (-412.236) (-417.858) * (-414.799) (-414.616) [-412.347] (-416.954) -- 0:00:44
226500 -- (-412.269) (-414.480) (-415.240) [-413.919] * (-411.990) [-413.299] (-412.489) (-420.782) -- 0:00:44
227000 -- (-415.408) [-412.271] (-412.718) (-415.200) * [-415.268] (-412.420) (-415.078) (-417.734) -- 0:00:44
227500 -- [-413.213] (-414.682) (-412.458) (-417.427) * (-413.204) (-413.724) [-411.840] (-414.257) -- 0:00:44
228000 -- (-415.974) [-412.986] (-414.380) (-414.209) * (-413.230) (-414.857) (-413.740) [-413.221] -- 0:00:44
228500 -- (-417.209) (-413.652) (-413.870) [-413.318] * (-415.879) (-414.528) [-415.287] (-417.353) -- 0:00:43
229000 -- [-416.166] (-412.173) (-412.433) (-418.805) * (-418.250) (-413.297) (-412.248) [-417.224] -- 0:00:43
229500 -- [-412.494] (-411.943) (-412.742) (-413.137) * (-415.277) (-413.527) (-411.893) [-413.036] -- 0:00:43
230000 -- [-414.728] (-413.712) (-412.485) (-413.406) * (-412.267) (-416.003) [-412.097] (-414.720) -- 0:00:43
Average standard deviation of split frequencies: 0.019188
230500 -- [-414.012] (-413.317) (-415.334) (-414.505) * [-414.173] (-417.045) (-412.819) (-412.675) -- 0:00:43
231000 -- (-412.016) [-414.751] (-415.329) (-412.306) * [-413.121] (-413.771) (-412.866) (-413.954) -- 0:00:43
231500 -- (-413.458) (-415.368) [-413.741] (-416.153) * (-413.424) (-412.006) [-416.362] (-419.128) -- 0:00:43
232000 -- [-418.271] (-415.804) (-412.752) (-413.417) * (-413.106) (-413.179) [-412.038] (-425.171) -- 0:00:43
232500 -- [-412.799] (-414.084) (-412.460) (-413.903) * (-418.276) (-418.630) (-413.484) [-415.336] -- 0:00:46
233000 -- (-413.915) (-413.091) [-413.784] (-418.133) * [-414.768] (-412.770) (-416.928) (-414.639) -- 0:00:46
233500 -- (-411.870) [-413.063] (-413.132) (-419.671) * (-415.362) (-419.470) (-416.244) [-412.620] -- 0:00:45
234000 -- (-413.913) (-417.217) [-414.574] (-415.137) * (-413.797) (-415.417) (-416.251) [-414.834] -- 0:00:45
234500 -- (-415.372) (-414.697) (-415.113) [-413.352] * (-413.065) (-415.162) [-421.192] (-414.441) -- 0:00:45
235000 -- (-416.882) (-412.440) (-414.277) [-414.589] * [-412.808] (-412.361) (-414.414) (-413.273) -- 0:00:45
Average standard deviation of split frequencies: 0.018199
235500 -- (-413.507) [-416.864] (-416.214) (-415.437) * (-413.161) (-413.256) (-413.264) [-413.343] -- 0:00:45
236000 -- (-415.436) (-414.814) [-416.663] (-419.452) * [-414.298] (-414.288) (-411.898) (-413.865) -- 0:00:45
236500 -- (-415.442) (-413.661) [-413.566] (-416.113) * (-414.294) [-413.367] (-415.667) (-414.774) -- 0:00:45
237000 -- (-418.476) [-412.942] (-415.364) (-416.583) * (-416.485) [-411.822] (-418.008) (-413.787) -- 0:00:45
237500 -- [-415.408] (-414.617) (-413.716) (-415.850) * (-417.748) (-414.648) [-414.889] (-416.720) -- 0:00:44
238000 -- (-413.798) (-415.744) [-416.389] (-416.226) * (-418.673) [-414.226] (-415.571) (-413.431) -- 0:00:44
238500 -- (-411.871) [-413.968] (-414.144) (-416.634) * (-415.139) (-418.102) [-413.266] (-412.348) -- 0:00:44
239000 -- (-415.916) [-413.138] (-418.773) (-415.677) * [-413.966] (-417.014) (-413.153) (-412.099) -- 0:00:44
239500 -- (-414.617) (-414.813) (-415.781) [-415.894] * (-412.730) [-412.091] (-412.408) (-414.406) -- 0:00:44
240000 -- (-413.828) (-415.270) (-415.926) [-414.030] * (-413.607) (-412.898) (-415.524) [-413.967] -- 0:00:44
Average standard deviation of split frequencies: 0.017010
240500 -- (-415.778) [-414.064] (-416.194) (-412.598) * (-412.688) (-414.107) (-414.607) [-414.498] -- 0:00:44
241000 -- (-415.173) (-413.831) [-414.425] (-414.239) * (-412.464) (-413.580) (-414.979) [-413.307] -- 0:00:44
241500 -- (-412.754) (-413.005) (-412.570) [-415.631] * (-416.523) (-416.315) (-413.916) [-412.863] -- 0:00:43
242000 -- (-412.290) (-413.367) (-413.923) [-413.460] * [-414.740] (-413.559) (-415.222) (-414.981) -- 0:00:43
242500 -- [-414.728] (-417.941) (-414.284) (-415.853) * [-413.302] (-413.714) (-412.082) (-417.231) -- 0:00:43
243000 -- (-415.394) [-413.927] (-414.232) (-417.153) * (-414.155) [-414.979] (-412.072) (-415.375) -- 0:00:43
243500 -- (-414.013) [-415.019] (-415.016) (-414.336) * [-413.632] (-413.580) (-411.684) (-413.259) -- 0:00:43
244000 -- [-411.982] (-418.067) (-412.955) (-412.260) * [-414.353] (-412.287) (-412.009) (-413.041) -- 0:00:43
244500 -- (-412.520) (-415.575) (-413.518) [-412.447] * (-413.455) (-415.272) (-413.102) [-417.821] -- 0:00:43
245000 -- (-415.145) (-413.484) (-413.935) [-416.770] * [-412.265] (-414.503) (-414.596) (-415.117) -- 0:00:43
Average standard deviation of split frequencies: 0.016944
245500 -- (-416.817) (-414.106) [-413.679] (-413.223) * (-411.725) (-413.428) (-415.640) [-415.314] -- 0:00:43
246000 -- (-414.642) [-415.260] (-417.225) (-414.263) * (-415.987) [-411.889] (-413.994) (-414.054) -- 0:00:42
246500 -- (-413.922) (-412.562) [-412.303] (-412.652) * (-417.458) [-412.076] (-412.574) (-415.001) -- 0:00:42
247000 -- (-412.727) (-413.983) [-412.316] (-412.164) * (-412.718) (-413.223) [-413.179] (-414.897) -- 0:00:42
247500 -- (-413.329) (-413.070) (-418.079) [-412.970] * (-414.812) [-413.692] (-412.478) (-412.971) -- 0:00:42
248000 -- (-413.586) [-412.684] (-413.185) (-412.974) * (-412.173) (-415.051) (-415.097) [-413.453] -- 0:00:42
248500 -- (-413.408) (-413.044) [-412.748] (-417.013) * [-412.980] (-413.503) (-412.543) (-413.584) -- 0:00:42
249000 -- (-412.827) [-413.999] (-411.605) (-412.561) * (-414.686) [-414.796] (-412.015) (-414.393) -- 0:00:42
249500 -- (-414.374) [-415.365] (-412.713) (-419.267) * [-413.294] (-412.448) (-413.081) (-413.563) -- 0:00:42
250000 -- [-412.401] (-416.137) (-413.915) (-412.572) * [-415.153] (-412.124) (-413.616) (-414.952) -- 0:00:45
Average standard deviation of split frequencies: 0.016821
250500 -- [-416.774] (-414.245) (-412.494) (-423.021) * [-415.621] (-414.365) (-417.619) (-415.503) -- 0:00:44
251000 -- [-411.968] (-413.381) (-414.369) (-412.502) * (-414.459) (-415.788) [-417.058] (-417.942) -- 0:00:44
251500 -- (-411.643) (-414.101) (-412.148) [-413.323] * (-414.417) (-416.555) [-416.934] (-417.958) -- 0:00:44
252000 -- (-411.757) (-412.384) (-414.949) [-413.144] * (-413.698) (-417.678) [-413.404] (-412.790) -- 0:00:44
252500 -- (-412.899) (-414.441) (-414.495) [-414.447] * [-413.565] (-415.823) (-414.854) (-412.363) -- 0:00:44
253000 -- [-412.832] (-413.900) (-417.288) (-411.985) * (-413.430) (-415.382) [-412.907] (-413.021) -- 0:00:44
253500 -- (-412.597) [-415.146] (-416.922) (-412.525) * (-412.696) (-414.870) [-412.760] (-411.857) -- 0:00:44
254000 -- [-415.037] (-412.882) (-414.566) (-413.546) * [-412.619] (-415.318) (-413.660) (-412.656) -- 0:00:44
254500 -- [-414.256] (-416.028) (-411.917) (-411.934) * (-412.386) [-412.306] (-412.133) (-412.384) -- 0:00:43
255000 -- (-416.331) (-413.117) [-413.381] (-411.733) * [-413.043] (-413.721) (-412.875) (-418.723) -- 0:00:43
Average standard deviation of split frequencies: 0.016464
255500 -- (-412.920) (-414.268) (-414.580) [-412.546] * (-412.440) (-413.524) (-414.943) [-413.766] -- 0:00:43
256000 -- (-414.982) (-415.742) (-412.842) [-414.003] * (-412.411) (-412.605) [-413.300] (-413.220) -- 0:00:43
256500 -- (-417.692) [-414.191] (-413.434) (-414.702) * (-412.399) (-413.134) [-415.035] (-412.748) -- 0:00:43
257000 -- (-413.036) [-413.350] (-415.764) (-413.882) * (-414.656) (-416.713) (-414.947) [-416.242] -- 0:00:43
257500 -- (-413.955) (-413.529) [-414.347] (-414.935) * [-413.582] (-411.804) (-413.426) (-416.106) -- 0:00:43
258000 -- (-414.475) (-414.359) [-412.026] (-415.418) * [-412.571] (-412.250) (-414.900) (-416.912) -- 0:00:43
258500 -- [-412.915] (-413.286) (-412.948) (-415.389) * (-417.615) (-416.957) (-413.629) [-416.270] -- 0:00:43
259000 -- (-412.525) (-412.403) [-413.000] (-413.060) * [-413.798] (-414.809) (-413.946) (-413.488) -- 0:00:42
259500 -- (-413.838) [-412.078] (-413.189) (-413.007) * (-411.921) (-416.836) (-414.020) [-418.494] -- 0:00:42
260000 -- [-411.918] (-412.228) (-413.872) (-414.339) * (-411.976) (-415.490) [-414.067] (-413.797) -- 0:00:42
Average standard deviation of split frequencies: 0.015319
260500 -- (-414.594) (-413.864) (-413.988) [-413.339] * (-413.374) [-414.007] (-414.739) (-417.027) -- 0:00:42
261000 -- (-416.010) [-412.956] (-413.980) (-416.159) * (-414.756) [-413.547] (-413.982) (-415.414) -- 0:00:42
261500 -- (-416.247) [-412.938] (-412.086) (-416.731) * (-413.200) [-414.984] (-415.171) (-415.129) -- 0:00:42
262000 -- (-413.824) (-413.923) (-414.366) [-417.047] * (-413.693) [-412.506] (-413.770) (-417.797) -- 0:00:42
262500 -- [-414.443] (-414.633) (-412.750) (-413.822) * (-415.652) (-412.898) (-412.932) [-413.100] -- 0:00:42
263000 -- (-413.976) (-416.193) [-412.367] (-413.251) * (-412.532) (-414.431) [-413.569] (-413.962) -- 0:00:42
263500 -- (-414.252) [-414.106] (-412.413) (-415.582) * [-413.830] (-415.459) (-413.367) (-414.319) -- 0:00:41
264000 -- (-412.278) (-414.302) [-413.201] (-415.751) * [-412.892] (-414.030) (-417.226) (-412.400) -- 0:00:41
264500 -- (-412.256) (-415.932) (-415.933) [-412.221] * (-412.650) (-413.746) (-413.380) [-412.958] -- 0:00:41
265000 -- [-414.358] (-412.976) (-412.512) (-413.522) * [-412.902] (-415.686) (-416.961) (-413.234) -- 0:00:41
Average standard deviation of split frequencies: 0.014079
265500 -- (-413.315) [-414.142] (-417.370) (-411.981) * (-413.149) (-411.700) (-412.598) [-414.944] -- 0:00:41
266000 -- (-416.014) [-412.410] (-414.127) (-413.059) * (-413.447) (-414.468) [-412.819] (-412.240) -- 0:00:41
266500 -- (-412.393) [-413.460] (-417.985) (-412.716) * (-412.714) (-413.282) [-412.670] (-414.444) -- 0:00:41
267000 -- (-413.885) (-415.059) (-413.542) [-412.446] * (-412.297) (-413.614) [-413.866] (-414.277) -- 0:00:43
267500 -- (-417.327) (-413.883) [-412.512] (-411.995) * (-417.050) [-411.920] (-421.262) (-413.373) -- 0:00:43
268000 -- (-415.197) (-415.593) (-415.128) [-415.156] * (-414.912) [-413.315] (-415.223) (-413.180) -- 0:00:43
268500 -- (-414.114) [-413.714] (-411.739) (-417.265) * (-413.189) (-414.566) (-412.452) [-414.354] -- 0:00:43
269000 -- [-415.316] (-414.615) (-412.125) (-422.090) * (-413.556) (-412.667) [-414.626] (-413.960) -- 0:00:43
269500 -- (-413.333) (-415.727) [-415.118] (-416.890) * (-413.627) (-413.314) (-412.188) [-413.251] -- 0:00:43
270000 -- (-415.174) (-415.911) [-412.326] (-413.654) * [-413.602] (-416.155) (-414.837) (-412.518) -- 0:00:43
Average standard deviation of split frequencies: 0.014343
270500 -- (-414.648) (-413.856) [-412.305] (-417.150) * [-413.850] (-414.829) (-415.118) (-413.371) -- 0:00:43
271000 -- (-418.084) [-411.838] (-414.991) (-414.793) * (-412.412) [-418.580] (-416.552) (-413.325) -- 0:00:43
271500 -- (-414.089) [-415.531] (-414.626) (-415.152) * (-415.777) (-414.254) [-419.757] (-412.871) -- 0:00:42
272000 -- [-413.548] (-412.313) (-416.193) (-413.722) * (-415.146) [-414.176] (-414.868) (-413.869) -- 0:00:42
272500 -- (-413.133) (-412.526) (-413.278) [-414.318] * [-415.776] (-413.652) (-418.775) (-414.247) -- 0:00:42
273000 -- (-411.760) [-412.293] (-414.487) (-414.400) * (-418.132) [-411.849] (-414.658) (-412.031) -- 0:00:42
273500 -- (-414.011) (-415.918) (-414.185) [-413.590] * (-413.307) (-412.916) (-414.556) [-414.521] -- 0:00:42
274000 -- (-412.748) (-413.897) (-412.797) [-412.528] * [-416.057] (-415.515) (-415.120) (-417.390) -- 0:00:42
274500 -- (-412.630) (-412.557) (-413.245) [-414.743] * (-417.678) (-416.669) [-413.745] (-413.168) -- 0:00:42
275000 -- [-413.416] (-413.269) (-414.236) (-419.201) * [-419.536] (-415.509) (-414.102) (-415.101) -- 0:00:42
Average standard deviation of split frequencies: 0.014568
275500 -- (-416.588) [-412.657] (-415.722) (-414.488) * (-419.596) (-415.209) (-413.382) [-415.525] -- 0:00:42
276000 -- (-414.504) [-412.207] (-412.268) (-414.495) * (-415.137) [-414.936] (-412.760) (-415.766) -- 0:00:41
276500 -- (-417.586) (-415.204) (-413.328) [-411.809] * (-413.245) (-414.457) (-415.382) [-412.059] -- 0:00:41
277000 -- (-416.375) (-413.037) [-416.130] (-414.971) * [-413.933] (-414.321) (-414.501) (-415.353) -- 0:00:41
277500 -- [-412.049] (-415.541) (-412.526) (-414.235) * (-411.841) (-416.690) (-413.490) [-413.460] -- 0:00:41
278000 -- [-412.184] (-413.613) (-413.923) (-417.273) * (-412.435) (-415.094) [-412.742] (-415.681) -- 0:00:41
278500 -- [-413.632] (-414.639) (-412.903) (-412.821) * (-412.779) [-413.938] (-412.371) (-412.379) -- 0:00:41
279000 -- (-414.083) (-413.032) (-415.101) [-412.954] * (-413.170) [-412.741] (-413.920) (-415.241) -- 0:00:41
279500 -- (-413.613) (-414.080) (-416.367) [-416.205] * (-412.978) (-415.067) [-412.911] (-413.779) -- 0:00:41
280000 -- [-415.107] (-414.012) (-417.102) (-414.467) * (-412.446) [-413.101] (-416.167) (-413.049) -- 0:00:41
Average standard deviation of split frequencies: 0.014919
280500 -- (-412.948) (-414.571) (-412.500) [-420.747] * (-414.959) [-416.027] (-414.233) (-413.521) -- 0:00:41
281000 -- (-413.343) (-419.656) (-411.957) [-415.186] * (-413.803) (-412.020) [-416.018] (-416.115) -- 0:00:40
281500 -- (-417.905) (-415.791) (-413.279) [-414.466] * (-414.803) (-414.832) [-411.847] (-412.004) -- 0:00:40
282000 -- (-414.063) [-413.801] (-413.518) (-411.909) * (-414.460) (-413.451) (-416.518) [-412.905] -- 0:00:40
282500 -- (-413.593) [-411.835] (-414.199) (-417.627) * (-413.629) (-415.358) [-415.433] (-414.832) -- 0:00:40
283000 -- (-414.089) (-416.520) [-414.346] (-420.495) * (-412.253) (-414.119) (-415.306) [-415.464] -- 0:00:40
283500 -- [-416.412] (-412.679) (-420.663) (-413.680) * (-414.612) (-414.136) (-411.635) [-412.444] -- 0:00:40
284000 -- (-414.563) (-412.371) [-412.700] (-413.615) * (-413.499) [-417.232] (-418.693) (-412.865) -- 0:00:42
284500 -- (-413.620) (-412.691) [-412.933] (-413.535) * (-413.625) (-416.487) [-418.009] (-413.103) -- 0:00:42
285000 -- (-413.776) [-413.435] (-413.359) (-415.476) * (-413.648) [-412.241] (-415.084) (-413.903) -- 0:00:42
Average standard deviation of split frequencies: 0.013962
285500 -- [-412.527] (-412.832) (-413.328) (-413.994) * (-414.417) (-414.166) (-418.832) [-413.145] -- 0:00:42
286000 -- (-416.452) (-416.897) [-414.433] (-415.807) * (-415.617) [-415.962] (-418.275) (-414.899) -- 0:00:42
286500 -- (-414.541) [-414.588] (-414.297) (-414.003) * (-415.504) (-414.828) (-416.299) [-414.308] -- 0:00:42
287000 -- (-412.295) (-415.678) (-413.955) [-412.732] * (-412.663) [-413.897] (-414.473) (-413.712) -- 0:00:42
287500 -- (-413.916) (-413.566) [-416.695] (-412.485) * [-414.240] (-416.507) (-412.925) (-415.681) -- 0:00:42
288000 -- (-415.502) (-416.758) (-413.299) [-413.429] * (-417.497) [-414.177] (-413.662) (-414.853) -- 0:00:42
288500 -- (-413.324) (-415.754) (-412.967) [-412.955] * (-412.932) (-413.805) (-413.809) [-412.114] -- 0:00:41
289000 -- [-414.511] (-414.857) (-413.374) (-412.294) * [-414.014] (-414.094) (-413.454) (-412.826) -- 0:00:41
289500 -- (-412.307) (-414.938) [-414.042] (-419.669) * (-413.428) (-413.000) (-413.678) [-414.342] -- 0:00:41
290000 -- (-414.730) [-415.841] (-413.200) (-417.291) * [-417.080] (-414.082) (-413.381) (-416.043) -- 0:00:41
Average standard deviation of split frequencies: 0.013695
290500 -- (-416.010) (-416.246) (-412.917) [-416.776] * (-412.220) (-413.166) (-417.509) [-413.081] -- 0:00:41
291000 -- (-413.427) [-415.838] (-416.557) (-415.099) * [-412.578] (-415.877) (-415.793) (-415.512) -- 0:00:41
291500 -- (-415.347) (-414.599) (-418.927) [-414.434] * (-412.863) (-412.836) [-414.643] (-414.339) -- 0:00:41
292000 -- [-416.072] (-419.965) (-412.486) (-415.075) * (-415.629) (-413.012) [-411.895] (-414.976) -- 0:00:41
292500 -- [-414.129] (-416.056) (-412.201) (-415.480) * (-414.162) (-413.437) (-412.807) [-414.853] -- 0:00:41
293000 -- (-415.953) (-414.793) (-413.275) [-414.029] * [-414.725] (-415.283) (-413.430) (-414.133) -- 0:00:41
293500 -- (-413.683) (-415.140) (-412.470) [-412.706] * (-412.534) [-415.061] (-413.328) (-413.327) -- 0:00:40
294000 -- [-414.134] (-413.458) (-414.782) (-412.346) * (-413.126) (-415.838) [-413.555] (-413.482) -- 0:00:40
294500 -- (-414.423) [-414.441] (-413.941) (-412.102) * [-411.827] (-416.428) (-413.665) (-415.103) -- 0:00:40
295000 -- [-414.489] (-414.343) (-416.462) (-415.465) * (-412.042) [-413.689] (-413.881) (-413.503) -- 0:00:40
Average standard deviation of split frequencies: 0.012553
295500 -- [-413.014] (-412.891) (-417.562) (-415.860) * (-412.349) [-414.935] (-415.311) (-413.790) -- 0:00:40
296000 -- [-412.661] (-412.226) (-414.529) (-419.895) * (-412.362) (-412.959) [-415.405] (-416.476) -- 0:00:40
296500 -- (-419.745) [-411.925] (-412.655) (-414.059) * [-415.941] (-415.310) (-414.005) (-412.233) -- 0:00:40
297000 -- [-416.125] (-416.831) (-412.317) (-413.073) * [-413.001] (-413.232) (-416.702) (-413.340) -- 0:00:40
297500 -- (-416.973) [-413.956] (-412.240) (-414.312) * (-411.867) (-412.952) [-412.088] (-414.752) -- 0:00:40
298000 -- (-417.907) (-416.339) [-414.541] (-412.573) * (-418.626) [-414.506] (-412.258) (-414.430) -- 0:00:40
298500 -- [-416.050] (-412.387) (-415.827) (-414.804) * [-413.264] (-416.881) (-416.249) (-413.291) -- 0:00:39
299000 -- (-414.148) [-414.117] (-416.319) (-417.493) * (-414.337) (-413.818) [-414.133] (-413.449) -- 0:00:39
299500 -- (-413.962) (-414.874) [-413.285] (-412.711) * (-412.899) (-412.214) [-413.891] (-414.078) -- 0:00:39
300000 -- (-414.210) (-415.929) [-414.081] (-412.935) * (-412.712) (-414.090) (-413.526) [-414.075] -- 0:00:39
Average standard deviation of split frequencies: 0.012358
300500 -- (-416.089) (-413.834) (-415.879) [-415.643] * [-413.775] (-413.585) (-411.567) (-414.670) -- 0:00:39
301000 -- [-415.834] (-413.669) (-415.097) (-414.425) * [-413.951] (-413.837) (-412.509) (-414.295) -- 0:00:41
301500 -- (-416.862) (-417.155) [-414.357] (-415.071) * [-412.651] (-415.370) (-418.039) (-412.011) -- 0:00:41
302000 -- (-415.229) (-416.592) [-413.019] (-416.374) * [-414.219] (-415.119) (-413.254) (-415.757) -- 0:00:41
302500 -- (-417.021) [-416.741] (-412.506) (-415.021) * (-413.248) (-414.676) [-416.775] (-414.932) -- 0:00:41
303000 -- (-414.614) [-414.923] (-414.337) (-415.819) * (-413.071) (-412.760) [-417.411] (-412.760) -- 0:00:41
303500 -- (-413.708) [-413.881] (-412.951) (-415.529) * (-412.658) (-413.584) [-413.938] (-412.109) -- 0:00:41
304000 -- (-416.367) (-415.774) [-415.155] (-413.201) * (-413.979) (-412.959) (-414.046) [-412.807] -- 0:00:41
304500 -- (-415.017) (-413.569) (-414.064) [-414.149] * (-413.813) (-413.499) (-412.401) [-414.716] -- 0:00:41
305000 -- (-417.204) [-412.686] (-413.160) (-414.825) * (-415.586) (-413.883) (-413.461) [-413.752] -- 0:00:41
Average standard deviation of split frequencies: 0.012153
305500 -- (-414.966) (-413.653) [-413.850] (-414.045) * (-415.055) [-413.514] (-413.130) (-413.667) -- 0:00:40
306000 -- [-414.418] (-413.492) (-414.648) (-417.602) * (-413.592) (-413.360) (-414.165) [-413.751] -- 0:00:40
306500 -- (-424.086) (-415.228) [-414.848] (-413.849) * (-415.658) [-412.696] (-413.176) (-416.041) -- 0:00:40
307000 -- (-415.829) (-413.396) [-412.170] (-417.207) * (-413.589) (-415.257) [-412.358] (-413.963) -- 0:00:40
307500 -- (-416.538) [-412.250] (-414.358) (-412.879) * (-413.946) (-420.165) (-412.863) [-412.064] -- 0:00:40
308000 -- (-416.229) (-414.216) [-416.857] (-413.019) * (-419.198) (-414.045) [-415.134] (-416.393) -- 0:00:40
308500 -- [-413.554] (-419.051) (-413.565) (-414.981) * (-417.307) (-417.135) [-415.508] (-413.755) -- 0:00:40
309000 -- (-413.906) [-413.201] (-414.215) (-414.302) * (-415.378) [-413.115] (-412.984) (-415.304) -- 0:00:40
309500 -- [-412.990] (-414.013) (-415.853) (-413.740) * [-416.548] (-414.761) (-419.650) (-413.467) -- 0:00:40
310000 -- (-413.893) (-415.332) [-418.774] (-414.988) * (-413.325) (-411.671) [-413.736] (-412.770) -- 0:00:40
Average standard deviation of split frequencies: 0.011157
310500 -- (-413.734) [-415.459] (-417.714) (-413.347) * (-412.442) (-412.982) (-415.152) [-412.611] -- 0:00:39
311000 -- (-415.136) (-415.359) [-414.632] (-414.737) * (-415.783) (-412.250) (-412.943) [-412.946] -- 0:00:39
311500 -- (-416.177) (-416.030) (-414.215) [-415.232] * [-414.608] (-411.785) (-418.224) (-413.879) -- 0:00:39
312000 -- (-413.643) (-417.001) [-413.063] (-411.874) * (-412.087) [-415.174] (-413.324) (-413.870) -- 0:00:39
312500 -- (-412.004) [-415.181] (-417.531) (-415.677) * (-412.355) (-413.186) [-413.481] (-413.866) -- 0:00:39
313000 -- (-415.514) (-415.174) (-413.424) [-413.515] * (-412.912) (-411.851) (-413.728) [-415.931] -- 0:00:39
313500 -- (-413.961) (-414.530) [-413.158] (-413.030) * (-415.977) (-414.135) (-412.977) [-418.002] -- 0:00:39
314000 -- (-413.649) (-414.748) (-414.563) [-412.999] * (-416.716) (-413.926) (-415.658) [-414.384] -- 0:00:39
314500 -- (-412.509) (-415.234) (-414.526) [-414.126] * (-416.866) (-415.700) [-413.334] (-416.562) -- 0:00:39
315000 -- (-414.215) [-413.703] (-412.485) (-414.004) * [-416.453] (-415.140) (-412.903) (-414.247) -- 0:00:39
Average standard deviation of split frequencies: 0.010881
315500 -- (-416.246) [-416.829] (-412.290) (-412.754) * (-412.956) (-413.075) [-413.868] (-413.258) -- 0:00:39
316000 -- (-416.050) [-414.237] (-413.061) (-414.466) * (-412.610) (-414.734) [-415.751] (-413.325) -- 0:00:38
316500 -- [-414.982] (-415.454) (-413.874) (-414.383) * [-413.506] (-413.306) (-414.698) (-416.613) -- 0:00:38
317000 -- [-414.636] (-412.498) (-412.462) (-412.688) * [-417.443] (-413.244) (-413.734) (-415.066) -- 0:00:38
317500 -- (-413.618) (-416.578) (-412.014) [-413.134] * (-412.999) (-413.360) [-412.869] (-412.514) -- 0:00:38
318000 -- [-414.152] (-414.496) (-413.836) (-414.305) * (-413.477) (-415.184) (-412.764) [-413.115] -- 0:00:40
318500 -- (-415.902) (-413.278) [-412.509] (-416.278) * (-413.821) [-412.806] (-414.179) (-413.414) -- 0:00:40
319000 -- [-414.302] (-413.003) (-412.999) (-414.050) * (-416.202) (-415.588) [-415.256] (-412.805) -- 0:00:40
319500 -- (-415.036) (-415.796) [-412.282] (-417.001) * (-415.969) (-411.868) [-414.133] (-416.181) -- 0:00:40
320000 -- (-413.273) (-416.451) (-415.034) [-414.627] * (-415.591) (-415.524) (-413.471) [-415.361] -- 0:00:40
Average standard deviation of split frequencies: 0.011577
320500 -- (-415.658) (-414.493) (-412.631) [-412.422] * (-414.306) (-415.507) (-415.087) [-416.916] -- 0:00:40
321000 -- [-415.159] (-417.173) (-415.832) (-413.602) * [-412.171] (-413.817) (-414.486) (-412.988) -- 0:00:40
321500 -- (-412.931) [-414.355] (-414.887) (-414.070) * (-413.847) (-421.401) [-412.536] (-419.264) -- 0:00:40
322000 -- [-412.680] (-414.099) (-414.278) (-414.114) * (-412.196) (-414.829) [-412.563] (-413.779) -- 0:00:40
322500 -- (-413.699) (-413.988) (-412.777) [-413.122] * (-414.402) (-414.497) (-412.329) [-415.744] -- 0:00:39
323000 -- [-418.073] (-413.542) (-413.249) (-422.270) * [-413.672] (-413.968) (-414.735) (-416.198) -- 0:00:39
323500 -- (-417.089) [-415.494] (-413.345) (-419.106) * (-412.619) (-412.718) (-413.743) [-411.915] -- 0:00:39
324000 -- (-415.223) [-413.016] (-415.240) (-418.373) * (-413.242) (-412.367) [-413.182] (-412.255) -- 0:00:39
324500 -- (-414.387) (-415.161) (-411.853) [-412.020] * [-413.618] (-415.407) (-412.077) (-412.595) -- 0:00:39
325000 -- (-414.589) (-417.395) (-414.831) [-414.902] * (-416.058) [-412.954] (-416.820) (-414.663) -- 0:00:39
Average standard deviation of split frequencies: 0.011729
325500 -- (-419.727) (-412.724) (-416.161) [-413.123] * (-415.866) [-411.898] (-418.002) (-413.449) -- 0:00:39
326000 -- [-411.882] (-414.332) (-413.290) (-413.065) * (-413.722) [-415.280] (-422.435) (-415.606) -- 0:00:39
326500 -- (-413.879) [-412.250] (-412.642) (-415.515) * (-420.480) [-415.471] (-415.914) (-416.255) -- 0:00:39
327000 -- (-414.215) [-416.511] (-419.851) (-413.977) * (-414.275) [-413.671] (-414.852) (-414.371) -- 0:00:39
327500 -- (-415.021) (-412.869) (-416.995) [-413.798] * (-416.992) (-417.045) (-412.120) [-411.825] -- 0:00:39
328000 -- [-415.451] (-415.997) (-418.721) (-418.855) * (-417.739) [-415.651] (-412.904) (-418.619) -- 0:00:38
328500 -- (-413.112) (-414.767) (-411.736) [-413.033] * (-419.792) [-412.981] (-412.359) (-412.901) -- 0:00:38
329000 -- (-413.990) (-414.780) [-414.127] (-412.443) * (-413.396) (-417.696) (-413.444) [-413.922] -- 0:00:38
329500 -- [-413.175] (-414.649) (-413.892) (-412.835) * (-417.843) (-412.802) (-415.078) [-412.835] -- 0:00:38
330000 -- (-413.735) (-413.844) (-417.185) [-413.015] * (-414.158) [-412.883] (-414.753) (-413.030) -- 0:00:38
Average standard deviation of split frequencies: 0.009712
330500 -- (-414.919) (-414.099) [-414.905] (-416.157) * (-413.654) (-415.129) [-413.457] (-415.127) -- 0:00:38
331000 -- [-413.653] (-413.464) (-414.842) (-413.657) * (-420.236) (-416.641) [-413.867] (-415.285) -- 0:00:38
331500 -- (-416.516) (-418.720) [-414.009] (-414.415) * (-412.794) (-413.927) [-418.180] (-417.714) -- 0:00:38
332000 -- [-413.713] (-414.629) (-414.440) (-417.538) * (-414.008) (-412.529) [-413.194] (-415.267) -- 0:00:38
332500 -- (-413.281) [-413.184] (-415.090) (-415.329) * (-414.006) (-414.530) (-414.819) [-412.548] -- 0:00:38
333000 -- (-413.823) [-417.941] (-419.719) (-414.526) * (-416.672) (-413.993) (-412.940) [-412.626] -- 0:00:38
333500 -- [-415.130] (-414.474) (-415.165) (-413.042) * (-417.616) [-415.698] (-413.208) (-413.278) -- 0:00:37
334000 -- (-415.127) [-412.361] (-417.289) (-414.887) * (-413.070) (-413.558) (-414.545) [-412.663] -- 0:00:37
334500 -- (-414.319) (-415.591) (-415.277) [-414.375] * (-414.310) (-413.251) (-413.429) [-415.637] -- 0:00:37
335000 -- [-413.428] (-414.398) (-414.574) (-414.529) * (-413.913) [-414.819] (-413.533) (-416.101) -- 0:00:39
Average standard deviation of split frequencies: 0.009382
335500 -- (-412.440) (-413.373) (-412.906) [-412.917] * (-413.706) (-415.436) [-413.725] (-416.014) -- 0:00:39
336000 -- (-413.442) (-414.651) [-415.150] (-415.307) * [-415.193] (-418.273) (-414.122) (-420.160) -- 0:00:39
336500 -- (-413.897) (-414.535) [-415.122] (-417.933) * (-415.200) (-413.707) [-413.651] (-416.119) -- 0:00:39
337000 -- [-413.143] (-413.951) (-412.848) (-414.954) * (-415.290) (-412.577) (-412.342) [-413.473] -- 0:00:39
337500 -- (-413.656) (-412.920) [-411.908] (-414.155) * (-414.241) [-412.767] (-413.174) (-413.469) -- 0:00:39
338000 -- (-415.694) [-414.614] (-413.636) (-412.406) * (-413.830) (-417.604) (-412.073) [-417.608] -- 0:00:39
338500 -- (-413.660) (-413.602) [-415.090] (-414.985) * (-413.437) [-412.319] (-414.414) (-413.410) -- 0:00:39
339000 -- (-414.481) (-413.434) (-416.139) [-418.609] * (-413.006) (-412.814) [-413.019] (-416.498) -- 0:00:38
339500 -- [-413.008] (-420.504) (-416.215) (-414.480) * (-412.771) (-412.855) (-414.758) [-414.765] -- 0:00:38
340000 -- (-416.961) [-412.713] (-418.059) (-414.099) * (-414.493) (-412.701) [-414.667] (-412.467) -- 0:00:38
Average standard deviation of split frequencies: 0.008389
340500 -- (-414.378) (-416.534) (-414.861) [-416.130] * (-414.575) (-412.647) (-412.856) [-417.607] -- 0:00:38
341000 -- (-417.934) (-413.559) (-412.543) [-412.496] * (-411.769) [-412.199] (-413.657) (-415.350) -- 0:00:38
341500 -- [-414.991] (-415.104) (-416.726) (-413.676) * (-413.226) [-412.754] (-412.777) (-414.907) -- 0:00:38
342000 -- (-412.960) [-414.826] (-414.975) (-414.784) * (-411.910) (-415.058) (-411.710) [-412.504] -- 0:00:38
342500 -- (-413.072) (-412.822) [-413.130] (-417.445) * (-412.846) [-413.721] (-413.427) (-415.125) -- 0:00:38
343000 -- (-415.970) (-413.630) [-413.460] (-416.203) * (-412.933) [-413.376] (-414.483) (-413.056) -- 0:00:38
343500 -- (-416.346) (-414.258) [-413.591] (-416.089) * (-413.177) (-412.372) [-414.286] (-412.233) -- 0:00:38
344000 -- (-414.876) (-412.968) (-415.047) [-418.823] * (-415.889) (-414.731) (-414.460) [-412.431] -- 0:00:38
344500 -- (-414.804) (-417.129) [-419.520] (-413.056) * [-414.406] (-416.870) (-412.791) (-417.447) -- 0:00:38
345000 -- (-415.308) [-415.489] (-413.390) (-414.273) * (-412.526) (-412.222) (-413.279) [-413.752] -- 0:00:37
Average standard deviation of split frequencies: 0.008260
345500 -- (-415.663) (-417.605) (-413.277) [-415.866] * [-415.186] (-415.351) (-414.457) (-412.337) -- 0:00:37
346000 -- (-414.321) (-412.518) (-414.844) [-414.745] * (-411.897) [-414.647] (-414.840) (-413.388) -- 0:00:37
346500 -- (-417.781) [-414.446] (-414.140) (-414.813) * (-414.324) (-416.114) [-419.618] (-412.996) -- 0:00:37
347000 -- (-414.122) [-413.325] (-413.682) (-413.617) * (-414.272) (-413.877) (-416.603) [-415.732] -- 0:00:37
347500 -- (-416.307) [-413.540] (-414.740) (-413.798) * (-418.617) (-417.365) (-412.109) [-415.415] -- 0:00:37
348000 -- (-412.520) [-412.834] (-417.177) (-412.564) * (-414.255) (-416.963) (-412.477) [-412.292] -- 0:00:37
348500 -- [-412.622] (-411.810) (-413.903) (-412.240) * (-412.574) (-416.621) (-416.312) [-412.482] -- 0:00:37
349000 -- (-422.115) (-414.355) [-415.359] (-414.564) * (-414.269) (-418.358) [-413.556] (-413.956) -- 0:00:37
349500 -- (-417.279) [-413.177] (-413.124) (-416.848) * (-413.047) [-413.917] (-422.014) (-415.764) -- 0:00:37
350000 -- (-412.900) (-416.096) [-414.112] (-413.858) * (-412.438) (-412.283) (-418.160) [-412.219] -- 0:00:37
Average standard deviation of split frequencies: 0.009410
350500 -- (-412.145) (-414.236) (-413.632) [-414.794] * (-411.619) (-414.731) (-414.591) [-415.263] -- 0:00:37
351000 -- (-414.437) (-413.845) [-411.953] (-413.283) * (-412.272) (-412.965) (-416.744) [-412.526] -- 0:00:36
351500 -- (-414.530) [-417.975] (-418.129) (-414.444) * [-412.002] (-418.424) (-415.273) (-412.557) -- 0:00:36
352000 -- (-413.833) [-413.513] (-418.051) (-415.528) * (-412.967) [-415.186] (-417.922) (-413.616) -- 0:00:38
352500 -- [-417.104] (-414.468) (-413.052) (-416.837) * [-414.242] (-414.819) (-416.696) (-413.097) -- 0:00:38
353000 -- (-413.577) [-414.534] (-413.821) (-413.223) * (-417.131) (-419.179) [-415.016] (-413.237) -- 0:00:38
353500 -- (-412.995) (-415.259) (-413.483) [-413.009] * [-414.138] (-412.420) (-412.283) (-414.487) -- 0:00:38
354000 -- (-412.551) (-414.420) (-413.799) [-415.878] * (-415.218) [-415.300] (-415.854) (-417.269) -- 0:00:38
354500 -- [-411.759] (-416.440) (-413.950) (-415.498) * [-412.444] (-416.644) (-412.288) (-411.817) -- 0:00:38
355000 -- (-412.480) [-413.977] (-413.155) (-412.752) * (-413.053) (-417.608) [-413.019] (-414.683) -- 0:00:38
Average standard deviation of split frequencies: 0.010671
355500 -- (-413.231) (-415.505) (-412.110) [-417.201] * (-414.648) (-413.161) [-412.287] (-416.506) -- 0:00:38
356000 -- (-412.049) (-412.023) (-413.780) [-413.582] * (-416.909) (-414.761) (-414.861) [-414.904] -- 0:00:37
356500 -- (-412.522) (-413.211) (-412.383) [-413.810] * [-414.779] (-414.152) (-413.511) (-413.519) -- 0:00:37
357000 -- (-414.760) [-413.290] (-412.764) (-414.735) * (-414.413) (-418.532) (-413.540) [-415.339] -- 0:00:37
357500 -- (-414.484) (-417.843) (-414.848) [-414.523] * (-413.461) [-414.299] (-413.333) (-415.969) -- 0:00:37
358000 -- [-411.931] (-413.131) (-413.139) (-414.117) * (-418.396) (-413.476) [-413.518] (-413.604) -- 0:00:37
358500 -- [-412.242] (-413.753) (-416.209) (-413.082) * (-413.917) [-416.739] (-416.316) (-414.267) -- 0:00:37
359000 -- (-412.931) [-413.096] (-414.359) (-412.606) * (-412.759) [-413.712] (-415.057) (-417.124) -- 0:00:37
359500 -- (-412.960) (-415.810) [-413.091] (-412.849) * [-412.954] (-412.468) (-414.135) (-412.311) -- 0:00:37
360000 -- (-419.091) (-415.907) [-414.034] (-413.082) * (-414.517) (-412.437) (-417.313) [-412.491] -- 0:00:37
Average standard deviation of split frequencies: 0.011110
360500 -- (-415.276) (-413.608) [-419.124] (-416.832) * (-413.768) [-413.592] (-412.986) (-416.682) -- 0:00:37
361000 -- (-413.595) (-415.877) (-413.835) [-415.107] * (-415.125) (-413.463) [-413.960] (-419.223) -- 0:00:37
361500 -- (-414.224) [-418.458] (-412.457) (-414.724) * (-412.497) (-413.865) (-418.086) [-413.093] -- 0:00:37
362000 -- (-413.414) (-415.286) [-414.178] (-415.173) * (-413.794) [-413.131] (-414.311) (-412.282) -- 0:00:37
362500 -- [-412.389] (-412.488) (-417.930) (-414.231) * (-412.144) [-416.317] (-412.420) (-414.574) -- 0:00:36
363000 -- (-414.775) (-414.740) (-414.444) [-412.604] * (-412.229) (-414.708) [-413.616] (-414.221) -- 0:00:36
363500 -- [-416.060] (-412.675) (-413.249) (-414.227) * [-415.175] (-413.435) (-413.437) (-412.833) -- 0:00:36
364000 -- (-415.693) (-415.815) (-412.354) [-414.143] * (-416.800) (-417.292) (-413.837) [-415.547] -- 0:00:36
364500 -- (-416.462) (-414.137) [-412.024] (-415.050) * (-412.329) (-417.463) [-412.515] (-413.980) -- 0:00:36
365000 -- (-419.118) (-416.778) (-411.703) [-413.924] * (-413.709) (-416.047) (-417.112) [-414.815] -- 0:00:36
Average standard deviation of split frequencies: 0.011449
365500 -- [-413.271] (-415.390) (-416.203) (-414.281) * (-414.039) [-416.308] (-413.468) (-414.659) -- 0:00:36
366000 -- (-411.986) (-419.719) [-411.933] (-412.960) * (-415.754) (-415.061) [-415.144] (-417.052) -- 0:00:36
366500 -- (-412.538) (-415.821) (-416.243) [-413.329] * (-413.252) [-413.258] (-415.449) (-415.004) -- 0:00:36
367000 -- (-413.979) (-416.141) (-413.197) [-412.980] * (-412.427) [-412.432] (-416.639) (-412.724) -- 0:00:36
367500 -- (-418.034) [-414.291] (-412.666) (-413.362) * (-416.016) (-412.158) (-413.099) [-413.303] -- 0:00:36
368000 -- (-418.441) (-412.229) [-415.575] (-412.885) * (-413.898) [-414.157] (-416.107) (-417.057) -- 0:00:36
368500 -- (-415.163) [-412.546] (-414.810) (-413.218) * (-415.877) (-412.857) [-416.908] (-418.488) -- 0:00:35
369000 -- (-413.047) [-415.028] (-414.900) (-414.618) * [-412.265] (-416.573) (-416.333) (-413.244) -- 0:00:35
369500 -- (-414.443) [-415.118] (-415.662) (-418.409) * (-411.617) [-416.337] (-413.890) (-415.650) -- 0:00:37
370000 -- (-418.570) (-413.039) [-413.051] (-415.814) * (-414.421) (-420.203) [-416.051] (-416.815) -- 0:00:37
Average standard deviation of split frequencies: 0.011296
370500 -- (-412.690) [-412.435] (-413.807) (-415.687) * (-412.265) (-417.742) (-412.088) [-415.462] -- 0:00:37
371000 -- (-418.117) [-412.358] (-416.212) (-412.206) * (-413.291) (-412.552) [-411.742] (-414.816) -- 0:00:37
371500 -- (-416.644) (-414.555) [-415.155] (-411.635) * [-411.718] (-412.469) (-416.120) (-416.475) -- 0:00:37
372000 -- (-417.800) [-412.532] (-413.366) (-412.266) * (-412.233) (-415.293) (-414.383) [-413.413] -- 0:00:37
372500 -- (-412.818) (-414.318) (-413.123) [-414.806] * [-412.525] (-412.387) (-417.157) (-411.796) -- 0:00:37
373000 -- (-415.449) (-413.426) (-413.972) [-412.975] * (-413.922) (-413.740) [-415.798] (-415.317) -- 0:00:36
373500 -- (-412.089) (-414.659) [-412.131] (-415.505) * [-412.805] (-414.126) (-414.516) (-412.149) -- 0:00:36
374000 -- [-413.315] (-414.576) (-413.559) (-412.821) * (-414.980) [-414.865] (-414.095) (-412.697) -- 0:00:36
374500 -- (-414.011) (-416.484) (-413.903) [-412.287] * (-413.116) (-413.029) (-412.595) [-414.564] -- 0:00:36
375000 -- (-412.169) (-415.898) [-412.846] (-414.373) * (-413.175) [-413.344] (-412.720) (-412.768) -- 0:00:36
Average standard deviation of split frequencies: 0.011357
375500 -- (-412.641) [-414.402] (-412.225) (-413.374) * [-415.246] (-413.149) (-415.822) (-412.309) -- 0:00:36
376000 -- (-412.546) (-413.471) (-413.389) [-414.085] * (-413.754) (-413.807) (-412.556) [-411.743] -- 0:00:36
376500 -- (-412.162) [-412.636] (-412.773) (-416.048) * (-417.171) (-413.191) (-414.527) [-412.246] -- 0:00:36
377000 -- (-412.755) (-412.300) (-413.583) [-415.430] * [-415.884] (-416.063) (-412.211) (-411.760) -- 0:00:36
377500 -- (-415.834) [-412.373] (-412.632) (-413.143) * [-412.111] (-415.380) (-415.231) (-414.878) -- 0:00:36
378000 -- (-414.298) (-416.910) [-413.123] (-412.607) * [-412.428] (-414.074) (-414.928) (-412.351) -- 0:00:36
378500 -- [-416.135] (-416.257) (-414.412) (-415.857) * (-412.165) [-419.547] (-414.132) (-414.149) -- 0:00:36
379000 -- [-413.311] (-413.330) (-415.614) (-413.944) * (-416.260) (-413.472) [-414.143] (-414.073) -- 0:00:36
379500 -- (-414.662) (-412.685) (-413.438) [-413.036] * (-412.147) [-412.740] (-414.382) (-414.178) -- 0:00:35
380000 -- (-413.832) [-412.281] (-415.993) (-414.915) * [-414.161] (-413.240) (-414.051) (-415.642) -- 0:00:35
Average standard deviation of split frequencies: 0.010526
380500 -- (-414.801) (-412.421) [-413.051] (-413.679) * (-414.289) [-414.266] (-414.687) (-415.987) -- 0:00:35
381000 -- [-415.574] (-417.447) (-412.687) (-413.154) * (-413.859) (-420.105) [-414.411] (-415.737) -- 0:00:35
381500 -- [-413.991] (-414.199) (-415.734) (-413.282) * (-413.505) (-413.273) (-413.007) [-414.788] -- 0:00:35
382000 -- [-418.095] (-412.123) (-413.441) (-413.814) * (-414.718) (-415.933) (-416.818) [-415.257] -- 0:00:35
382500 -- (-413.658) (-416.441) (-416.624) [-414.793] * (-414.998) (-412.525) [-415.246] (-412.669) -- 0:00:35
383000 -- (-414.400) (-412.291) (-413.697) [-414.201] * (-413.597) (-416.201) [-413.907] (-413.338) -- 0:00:35
383500 -- (-417.183) (-414.378) [-413.921] (-418.583) * (-415.459) (-415.119) [-415.320] (-413.418) -- 0:00:35
384000 -- [-416.477] (-416.393) (-417.277) (-414.393) * (-419.232) (-415.993) (-414.991) [-413.051] -- 0:00:35
384500 -- [-412.446] (-417.741) (-412.307) (-414.010) * [-417.981] (-413.681) (-413.068) (-413.112) -- 0:00:35
385000 -- (-414.564) (-417.144) [-412.945] (-416.463) * (-412.876) (-413.836) (-418.155) [-413.020] -- 0:00:35
Average standard deviation of split frequencies: 0.010457
385500 -- (-412.913) [-413.681] (-411.774) (-412.269) * [-413.223] (-412.028) (-414.056) (-413.273) -- 0:00:35
386000 -- (-415.048) [-415.234] (-414.344) (-414.771) * [-414.422] (-415.367) (-413.998) (-412.817) -- 0:00:34
386500 -- (-412.764) (-417.815) (-416.548) [-413.116] * (-416.975) [-413.763] (-414.185) (-413.336) -- 0:00:36
387000 -- (-417.897) (-412.291) [-413.421] (-415.051) * (-412.133) [-413.873] (-413.865) (-424.662) -- 0:00:36
387500 -- [-417.481] (-412.826) (-414.125) (-413.597) * (-413.083) (-412.623) (-414.265) [-418.781] -- 0:00:36
388000 -- (-413.456) (-412.889) (-417.416) [-415.492] * [-412.868] (-414.243) (-412.616) (-415.774) -- 0:00:36
388500 -- (-413.617) [-414.783] (-415.328) (-415.633) * (-412.868) [-411.983] (-418.555) (-412.946) -- 0:00:36
389000 -- [-414.292] (-413.563) (-419.019) (-415.405) * (-415.966) (-415.876) (-413.150) [-416.207] -- 0:00:36
389500 -- [-412.688] (-413.050) (-413.422) (-413.872) * (-415.825) [-416.366] (-412.086) (-414.409) -- 0:00:36
390000 -- (-414.332) (-415.015) (-414.643) [-412.162] * (-413.507) (-412.476) (-412.602) [-411.752] -- 0:00:35
Average standard deviation of split frequencies: 0.010332
390500 -- (-414.631) (-412.248) [-412.881] (-415.189) * (-412.704) [-411.663] (-412.612) (-411.841) -- 0:00:35
391000 -- (-413.396) [-414.235] (-415.452) (-416.983) * (-414.769) (-414.018) (-412.461) [-411.722] -- 0:00:35
391500 -- (-414.025) (-415.630) [-415.191] (-412.477) * (-413.828) [-416.466] (-411.790) (-413.618) -- 0:00:35
392000 -- [-412.502] (-415.737) (-414.983) (-415.064) * [-415.288] (-413.492) (-411.943) (-412.153) -- 0:00:35
392500 -- [-413.081] (-413.064) (-414.380) (-414.751) * (-414.973) (-416.262) [-413.420] (-413.781) -- 0:00:35
393000 -- [-417.893] (-414.768) (-414.496) (-416.976) * [-413.356] (-412.617) (-412.514) (-414.135) -- 0:00:35
393500 -- [-413.908] (-413.394) (-413.010) (-420.545) * (-414.021) [-412.559] (-413.720) (-412.578) -- 0:00:35
394000 -- (-419.842) [-413.311] (-417.447) (-414.342) * (-413.586) (-412.011) (-414.335) [-415.940] -- 0:00:35
394500 -- (-417.146) [-414.708] (-413.821) (-417.477) * (-413.329) (-414.694) (-412.975) [-414.416] -- 0:00:35
395000 -- (-412.166) (-412.625) (-421.134) [-415.041] * (-413.589) [-412.396] (-413.351) (-415.695) -- 0:00:35
Average standard deviation of split frequencies: 0.009970
395500 -- [-413.987] (-414.572) (-414.366) (-416.498) * (-413.001) (-412.420) (-412.934) [-414.276] -- 0:00:35
396000 -- [-412.860] (-413.948) (-411.759) (-414.055) * (-413.501) (-414.952) (-412.929) [-416.185] -- 0:00:35
396500 -- (-412.353) (-412.327) (-412.488) [-412.389] * (-413.479) (-414.701) (-413.442) [-414.637] -- 0:00:35
397000 -- (-412.530) (-415.694) (-414.632) [-412.791] * (-412.272) [-417.141] (-413.103) (-413.057) -- 0:00:34
397500 -- (-414.464) (-412.817) [-414.702] (-412.494) * [-412.558] (-417.227) (-415.407) (-415.960) -- 0:00:34
398000 -- (-418.473) (-413.397) (-412.465) [-413.126] * (-412.499) (-415.167) (-413.821) [-414.232] -- 0:00:34
398500 -- (-416.079) (-414.567) [-414.869] (-413.780) * (-411.858) [-414.314] (-411.829) (-415.299) -- 0:00:34
399000 -- (-415.498) (-413.122) (-415.800) [-415.138] * [-413.047] (-412.935) (-414.672) (-415.395) -- 0:00:34
399500 -- (-415.067) (-417.320) [-416.524] (-416.073) * (-414.424) (-413.952) (-412.650) [-414.349] -- 0:00:34
400000 -- (-414.411) [-413.991] (-412.598) (-412.825) * (-414.146) [-412.510] (-413.084) (-416.628) -- 0:00:34
Average standard deviation of split frequencies: 0.010001
400500 -- (-413.414) (-413.949) (-413.509) [-412.679] * [-415.368] (-412.579) (-415.270) (-413.447) -- 0:00:34
401000 -- (-414.272) [-415.382] (-412.706) (-412.392) * [-414.249] (-413.806) (-413.278) (-413.985) -- 0:00:34
401500 -- (-415.527) [-413.081] (-415.560) (-413.334) * (-414.822) [-415.430] (-417.342) (-413.836) -- 0:00:34
402000 -- (-416.814) [-412.490] (-413.882) (-415.507) * [-413.960] (-414.698) (-413.000) (-413.005) -- 0:00:34
402500 -- [-414.808] (-412.536) (-414.186) (-416.060) * (-414.064) (-416.976) [-417.098] (-414.039) -- 0:00:34
403000 -- [-415.040] (-412.624) (-416.299) (-412.755) * (-414.647) (-414.922) [-413.565] (-412.897) -- 0:00:34
403500 -- (-413.581) (-415.518) (-415.007) [-413.464] * (-415.991) (-413.822) [-413.607] (-412.882) -- 0:00:35
404000 -- (-415.194) [-414.017] (-412.006) (-419.289) * (-413.002) (-414.160) [-412.858] (-415.250) -- 0:00:35
404500 -- (-414.205) [-416.391] (-414.868) (-416.326) * [-413.148] (-416.187) (-414.216) (-415.329) -- 0:00:35
405000 -- (-412.831) [-414.852] (-415.174) (-414.888) * [-413.820] (-413.120) (-412.943) (-414.025) -- 0:00:35
Average standard deviation of split frequencies: 0.009579
405500 -- (-414.048) [-415.649] (-414.002) (-418.130) * (-416.421) (-411.626) [-413.381] (-412.573) -- 0:00:35
406000 -- (-413.634) [-412.987] (-412.306) (-411.753) * [-412.782] (-414.537) (-416.858) (-411.918) -- 0:00:35
406500 -- (-414.523) (-412.681) (-413.181) [-414.195] * (-413.085) (-414.181) (-416.859) [-413.141] -- 0:00:35
407000 -- (-414.973) [-413.299] (-413.084) (-414.024) * (-413.825) [-413.820] (-417.245) (-414.069) -- 0:00:34
407500 -- (-413.436) [-412.579] (-412.216) (-413.640) * (-413.875) (-415.465) [-412.242] (-412.788) -- 0:00:34
408000 -- (-412.118) [-412.010] (-413.617) (-413.479) * (-412.284) [-414.634] (-412.542) (-412.768) -- 0:00:34
408500 -- (-412.859) (-412.243) [-412.567] (-417.114) * (-413.519) (-412.011) (-412.294) [-414.992] -- 0:00:34
409000 -- [-415.333] (-414.847) (-412.902) (-412.004) * (-418.910) (-416.976) [-411.753] (-413.081) -- 0:00:34
409500 -- (-414.942) (-416.217) (-412.801) [-412.963] * (-413.241) (-412.842) [-413.934] (-412.678) -- 0:00:34
410000 -- (-412.698) (-413.376) (-413.815) [-412.753] * (-413.484) [-414.395] (-412.918) (-415.065) -- 0:00:34
Average standard deviation of split frequencies: 0.009111
410500 -- (-413.705) (-412.589) (-413.397) [-416.383] * (-414.461) (-422.807) [-414.074] (-417.291) -- 0:00:34
411000 -- (-413.220) (-413.214) [-415.090] (-414.103) * (-416.671) (-416.100) [-413.127] (-415.824) -- 0:00:34
411500 -- (-413.594) [-414.436] (-414.269) (-419.580) * (-416.473) (-413.568) (-412.000) [-415.016] -- 0:00:34
412000 -- (-415.032) [-413.697] (-414.371) (-415.255) * (-416.008) [-412.651] (-417.103) (-418.440) -- 0:00:34
412500 -- [-414.408] (-414.376) (-415.463) (-416.417) * [-414.793] (-412.935) (-413.940) (-418.111) -- 0:00:34
413000 -- (-412.280) [-413.020] (-416.558) (-411.555) * [-413.347] (-416.111) (-415.901) (-413.952) -- 0:00:34
413500 -- [-412.810] (-412.202) (-415.118) (-416.034) * [-412.059] (-416.068) (-419.965) (-415.385) -- 0:00:34
414000 -- [-412.176] (-415.251) (-412.442) (-413.912) * [-412.993] (-415.461) (-413.641) (-413.828) -- 0:00:33
414500 -- [-412.296] (-412.739) (-414.866) (-415.258) * (-413.010) (-415.352) [-413.895] (-417.271) -- 0:00:33
415000 -- (-412.969) (-413.673) (-416.985) [-412.719] * [-415.910] (-415.122) (-413.622) (-420.179) -- 0:00:33
Average standard deviation of split frequencies: 0.009420
415500 -- [-412.007] (-414.613) (-412.945) (-412.311) * (-413.734) (-418.557) (-412.297) [-413.521] -- 0:00:33
416000 -- (-413.366) (-421.984) (-415.791) [-411.973] * [-412.626] (-416.571) (-416.404) (-416.028) -- 0:00:33
416500 -- [-413.395] (-415.962) (-411.890) (-413.719) * (-415.573) (-414.207) (-412.012) [-413.844] -- 0:00:33
417000 -- (-415.480) [-415.502] (-413.425) (-412.610) * [-412.249] (-415.539) (-414.975) (-416.975) -- 0:00:33
417500 -- (-419.543) (-413.674) [-413.184] (-416.590) * [-413.190] (-413.808) (-412.061) (-413.428) -- 0:00:33
418000 -- (-416.126) (-413.444) (-415.216) [-413.830] * (-412.259) (-413.884) [-412.686] (-412.142) -- 0:00:33
418500 -- (-413.658) (-415.681) [-416.566] (-412.312) * (-414.755) (-416.165) [-411.743] (-413.624) -- 0:00:33
419000 -- (-416.483) (-421.781) [-413.412] (-412.364) * (-413.927) (-413.119) [-415.647] (-415.021) -- 0:00:33
419500 -- (-413.377) (-413.840) [-415.061] (-413.369) * (-413.653) [-413.650] (-414.909) (-418.677) -- 0:00:33
420000 -- [-414.222] (-413.825) (-412.499) (-413.940) * (-411.941) [-411.625] (-416.194) (-415.185) -- 0:00:33
Average standard deviation of split frequencies: 0.009315
420500 -- (-413.012) (-415.308) [-417.329] (-412.013) * (-414.628) [-412.608] (-416.430) (-417.110) -- 0:00:34
421000 -- (-415.324) (-416.326) (-414.253) [-415.109] * (-414.386) (-413.707) (-417.519) [-413.558] -- 0:00:34
421500 -- (-413.594) (-414.137) [-413.143] (-415.647) * (-414.038) [-412.116] (-415.800) (-413.501) -- 0:00:34
422000 -- (-412.797) (-414.019) [-412.915] (-414.857) * (-412.135) (-412.603) (-413.108) [-412.990] -- 0:00:34
422500 -- (-411.772) [-412.831] (-418.544) (-414.856) * [-411.671] (-412.540) (-412.766) (-415.970) -- 0:00:34
423000 -- (-418.001) [-415.463] (-415.046) (-412.025) * [-412.718] (-413.986) (-412.934) (-414.785) -- 0:00:34
423500 -- (-417.709) (-411.758) (-415.383) [-412.521] * [-413.458] (-413.648) (-412.653) (-412.434) -- 0:00:34
424000 -- (-417.656) [-412.758] (-413.828) (-413.440) * (-414.343) (-416.239) (-414.815) [-412.155] -- 0:00:33
424500 -- [-420.321] (-415.581) (-411.906) (-414.838) * (-414.814) [-417.289] (-415.503) (-412.801) -- 0:00:33
425000 -- (-413.285) (-413.249) (-412.455) [-412.467] * [-414.479] (-415.951) (-416.437) (-415.209) -- 0:00:33
Average standard deviation of split frequencies: 0.011001
425500 -- (-414.178) (-412.882) [-413.927] (-412.115) * (-414.144) (-416.108) (-424.587) [-414.573] -- 0:00:33
426000 -- (-414.872) [-413.009] (-412.931) (-412.213) * [-411.967] (-413.923) (-413.211) (-411.968) -- 0:00:33
426500 -- (-411.792) (-412.609) (-413.518) [-414.749] * (-411.861) (-413.579) [-413.007] (-416.871) -- 0:00:33
427000 -- (-412.670) [-415.927] (-412.216) (-416.247) * [-411.771] (-414.307) (-417.086) (-414.775) -- 0:00:33
427500 -- (-418.378) [-412.905] (-415.626) (-414.683) * (-413.069) [-414.720] (-414.374) (-415.939) -- 0:00:33
428000 -- (-413.373) [-415.072] (-413.754) (-413.583) * (-412.304) (-412.377) [-413.845] (-414.980) -- 0:00:33
428500 -- [-413.969] (-414.214) (-415.476) (-412.308) * (-415.849) (-413.549) (-413.725) [-413.620] -- 0:00:33
429000 -- [-413.090] (-414.522) (-417.223) (-417.171) * (-414.263) [-416.154] (-412.788) (-412.117) -- 0:00:33
429500 -- (-413.213) [-413.915] (-416.559) (-412.194) * [-415.546] (-415.031) (-418.735) (-412.997) -- 0:00:33
430000 -- (-412.175) [-414.532] (-419.485) (-415.810) * (-415.677) (-415.183) [-414.529] (-412.554) -- 0:00:33
Average standard deviation of split frequencies: 0.011332
430500 -- (-415.091) (-414.640) [-418.760] (-412.671) * (-412.918) [-413.032] (-415.185) (-415.181) -- 0:00:33
431000 -- (-414.261) [-413.438] (-419.799) (-414.013) * (-412.776) (-412.932) [-413.781] (-415.125) -- 0:00:33
431500 -- [-412.037] (-414.879) (-418.474) (-414.087) * (-413.223) (-413.734) [-413.371] (-412.084) -- 0:00:32
432000 -- [-413.312] (-416.486) (-420.804) (-415.926) * (-412.390) [-414.915] (-412.354) (-415.657) -- 0:00:32
432500 -- (-413.649) (-416.600) (-415.456) [-416.993] * (-411.971) (-415.330) [-414.898] (-417.138) -- 0:00:32
433000 -- [-412.980] (-412.925) (-413.612) (-413.881) * [-415.254] (-415.050) (-415.972) (-422.231) -- 0:00:32
433500 -- (-413.823) (-415.449) [-413.295] (-413.492) * (-417.169) (-414.830) [-412.384] (-419.310) -- 0:00:32
434000 -- (-414.626) (-411.916) (-412.226) [-414.516] * (-415.454) [-413.823] (-412.663) (-411.973) -- 0:00:32
434500 -- (-413.793) (-412.536) [-413.355] (-417.063) * [-412.043] (-415.926) (-416.317) (-413.041) -- 0:00:32
435000 -- [-414.186] (-413.563) (-416.222) (-420.634) * (-415.923) (-416.383) (-416.392) [-413.647] -- 0:00:32
Average standard deviation of split frequencies: 0.011257
435500 -- (-419.871) [-414.631] (-414.853) (-415.953) * (-414.826) [-416.566] (-413.610) (-413.479) -- 0:00:32
436000 -- (-413.353) [-412.498] (-414.072) (-412.467) * [-413.636] (-415.114) (-412.648) (-416.928) -- 0:00:32
436500 -- (-412.920) (-413.111) (-414.274) [-412.493] * (-415.013) (-418.868) [-412.360] (-413.501) -- 0:00:32
437000 -- (-413.189) (-413.732) [-413.743] (-415.260) * (-414.806) (-412.855) [-413.382] (-413.888) -- 0:00:32
437500 -- (-412.319) (-414.833) (-414.895) [-413.803] * (-411.682) (-413.046) [-412.483] (-412.276) -- 0:00:32
438000 -- (-412.445) [-415.304] (-411.948) (-414.877) * (-413.130) [-412.269] (-413.740) (-414.234) -- 0:00:33
438500 -- (-414.091) (-416.504) [-416.567] (-416.028) * (-414.788) (-413.743) (-414.266) [-415.454] -- 0:00:33
439000 -- [-412.986] (-414.954) (-413.525) (-415.422) * [-414.392] (-412.312) (-413.586) (-412.447) -- 0:00:33
439500 -- (-414.253) [-412.673] (-414.611) (-413.044) * (-412.307) (-413.078) [-415.494] (-416.014) -- 0:00:33
440000 -- (-417.643) (-413.026) [-415.354] (-412.873) * (-411.966) (-414.542) (-412.407) [-413.067] -- 0:00:33
Average standard deviation of split frequencies: 0.011012
440500 -- [-415.582] (-412.277) (-414.220) (-413.150) * [-412.086] (-412.838) (-412.324) (-413.468) -- 0:00:33
441000 -- (-413.778) [-413.046] (-417.339) (-413.368) * (-414.371) (-414.347) [-412.414] (-415.738) -- 0:00:32
441500 -- (-412.659) (-413.035) (-418.818) [-412.884] * (-413.836) (-413.203) [-413.856] (-413.356) -- 0:00:32
442000 -- (-416.178) (-413.744) (-417.989) [-414.847] * (-414.570) [-412.516] (-412.320) (-417.745) -- 0:00:32
442500 -- (-413.261) (-414.977) (-416.579) [-414.493] * [-412.798] (-412.879) (-412.112) (-418.111) -- 0:00:32
443000 -- (-413.229) [-413.993] (-415.133) (-417.044) * [-416.145] (-412.949) (-414.835) (-412.655) -- 0:00:32
443500 -- [-415.805] (-415.747) (-412.909) (-412.530) * [-412.824] (-414.443) (-414.864) (-416.548) -- 0:00:32
444000 -- (-413.920) (-414.358) [-412.036] (-412.449) * [-412.896] (-414.618) (-414.762) (-413.264) -- 0:00:32
444500 -- (-412.344) [-417.145] (-412.416) (-414.644) * (-413.987) (-414.414) (-413.795) [-412.562] -- 0:00:32
445000 -- (-412.476) (-412.452) [-412.697] (-413.250) * (-411.565) (-412.720) [-417.952] (-412.485) -- 0:00:32
Average standard deviation of split frequencies: 0.011392
445500 -- (-416.088) (-412.790) (-413.508) [-413.446] * [-412.981] (-412.189) (-422.224) (-413.911) -- 0:00:32
446000 -- [-414.101] (-413.233) (-415.349) (-413.547) * (-414.131) [-412.762] (-414.431) (-412.534) -- 0:00:32
446500 -- [-413.515] (-414.796) (-412.000) (-417.778) * (-414.818) (-413.882) (-413.587) [-412.891] -- 0:00:32
447000 -- (-413.843) (-415.257) [-414.070] (-412.372) * (-414.328) [-415.178] (-415.463) (-414.029) -- 0:00:32
447500 -- (-413.567) [-413.637] (-413.877) (-416.378) * (-414.850) [-413.638] (-414.148) (-412.314) -- 0:00:32
448000 -- (-412.555) (-417.751) [-413.267] (-417.750) * (-415.843) [-412.552] (-413.172) (-414.876) -- 0:00:32
448500 -- [-412.620] (-413.556) (-414.491) (-419.279) * (-416.973) [-412.341] (-412.570) (-412.867) -- 0:00:31
449000 -- [-417.662] (-414.793) (-414.107) (-414.503) * (-417.594) (-413.459) [-414.107] (-412.781) -- 0:00:31
449500 -- (-418.107) (-414.420) (-415.076) [-413.899] * [-415.674] (-417.104) (-416.932) (-416.773) -- 0:00:31
450000 -- [-412.632] (-413.447) (-414.711) (-416.310) * (-414.403) [-412.332] (-414.656) (-413.228) -- 0:00:31
Average standard deviation of split frequencies: 0.011622
450500 -- (-414.790) [-414.258] (-412.157) (-415.485) * (-414.005) (-413.011) (-413.701) [-413.889] -- 0:00:31
451000 -- [-414.156] (-417.451) (-412.508) (-415.443) * (-412.462) [-415.261] (-415.356) (-413.142) -- 0:00:31
451500 -- (-414.407) [-412.834] (-413.372) (-415.082) * (-413.713) (-413.685) (-413.420) [-412.577] -- 0:00:31
452000 -- (-414.574) (-413.816) [-412.869] (-415.680) * (-413.013) (-415.811) (-414.063) [-414.875] -- 0:00:31
452500 -- (-417.269) (-413.559) (-416.283) [-414.508] * (-412.344) [-412.808] (-413.097) (-412.682) -- 0:00:31
453000 -- (-412.774) (-414.227) [-414.689] (-415.700) * [-411.865] (-412.932) (-412.498) (-416.607) -- 0:00:31
453500 -- (-417.514) (-413.217) [-414.510] (-416.122) * (-412.132) (-415.941) [-412.422] (-417.225) -- 0:00:31
454000 -- [-417.486] (-415.498) (-412.035) (-416.665) * (-414.382) (-413.948) (-413.724) [-413.989] -- 0:00:31
454500 -- (-413.981) [-418.462] (-412.706) (-414.544) * (-415.849) (-413.685) [-416.329] (-412.565) -- 0:00:31
455000 -- (-413.993) (-412.910) [-416.601] (-417.404) * (-413.620) (-416.333) [-414.568] (-415.268) -- 0:00:32
Average standard deviation of split frequencies: 0.011774
455500 -- (-413.728) (-411.898) [-413.673] (-412.377) * [-413.947] (-413.612) (-413.444) (-417.581) -- 0:00:32
456000 -- (-413.514) [-413.193] (-415.403) (-415.179) * (-413.626) (-415.563) [-414.219] (-413.691) -- 0:00:32
456500 -- (-412.109) (-413.996) (-413.025) [-413.250] * (-412.573) [-412.204] (-414.559) (-415.085) -- 0:00:32
457000 -- (-415.185) (-415.267) (-413.119) [-414.333] * (-414.477) (-412.769) (-414.125) [-415.830] -- 0:00:32
457500 -- [-415.555] (-418.255) (-411.984) (-414.429) * [-412.608] (-413.181) (-413.773) (-414.230) -- 0:00:32
458000 -- (-413.230) (-415.117) [-412.591] (-415.296) * [-411.823] (-420.670) (-412.189) (-412.825) -- 0:00:31
458500 -- (-412.182) [-416.903] (-416.057) (-412.163) * (-412.552) (-413.723) (-413.499) [-412.410] -- 0:00:31
459000 -- (-414.236) (-416.123) (-416.248) [-412.641] * [-416.003] (-413.465) (-417.133) (-412.614) -- 0:00:31
459500 -- (-415.286) [-412.741] (-414.085) (-413.477) * (-415.421) [-413.671] (-414.717) (-414.573) -- 0:00:31
460000 -- [-419.798] (-418.053) (-413.247) (-412.585) * (-412.887) (-415.773) (-413.171) [-414.758] -- 0:00:31
Average standard deviation of split frequencies: 0.012052
460500 -- (-414.915) (-414.067) [-414.637] (-413.636) * (-415.114) [-414.140] (-414.643) (-412.876) -- 0:00:31
461000 -- (-413.826) (-413.112) [-416.656] (-417.393) * (-419.050) [-413.005] (-414.038) (-412.021) -- 0:00:31
461500 -- (-413.020) (-413.055) [-414.035] (-411.930) * (-417.571) (-413.240) (-412.887) [-415.058] -- 0:00:31
462000 -- (-413.038) [-412.483] (-413.171) (-412.699) * (-412.227) [-412.055] (-415.691) (-412.790) -- 0:00:31
462500 -- [-413.277] (-416.707) (-412.531) (-414.261) * (-413.552) (-415.428) (-413.277) [-413.316] -- 0:00:31
463000 -- (-411.855) (-411.925) [-412.148] (-412.129) * [-417.153] (-415.620) (-412.994) (-412.882) -- 0:00:31
463500 -- (-418.768) (-412.786) (-412.230) [-414.005] * (-412.029) [-413.162] (-415.188) (-416.923) -- 0:00:31
464000 -- [-414.197] (-414.832) (-415.256) (-415.363) * (-415.365) [-414.404] (-414.584) (-414.641) -- 0:00:31
464500 -- (-412.761) (-413.853) (-413.841) [-414.330] * (-413.272) [-414.562] (-418.459) (-413.461) -- 0:00:31
465000 -- [-412.432] (-414.370) (-413.527) (-413.228) * (-413.141) [-413.293] (-415.168) (-414.956) -- 0:00:31
Average standard deviation of split frequencies: 0.011858
465500 -- [-412.113] (-417.304) (-413.619) (-413.625) * (-413.108) [-414.093] (-413.443) (-417.618) -- 0:00:31
466000 -- [-413.625] (-414.279) (-415.076) (-413.259) * (-413.275) [-413.475] (-414.553) (-415.429) -- 0:00:30
466500 -- [-412.230] (-415.658) (-413.882) (-416.199) * (-413.659) (-412.614) [-412.758] (-416.919) -- 0:00:30
467000 -- (-411.818) (-413.878) (-415.637) [-415.586] * (-415.180) [-412.532] (-417.183) (-416.001) -- 0:00:30
467500 -- [-414.324] (-418.540) (-412.617) (-413.883) * (-416.769) (-415.582) (-419.633) [-414.801] -- 0:00:30
468000 -- (-411.831) (-418.056) [-412.666] (-413.269) * [-414.686] (-416.652) (-416.432) (-416.987) -- 0:00:30
468500 -- (-413.263) (-412.389) (-413.742) [-412.264] * (-414.652) [-416.856] (-414.022) (-416.754) -- 0:00:30
469000 -- (-412.085) (-414.726) [-412.262] (-414.311) * (-413.760) [-413.419] (-412.510) (-416.773) -- 0:00:30
469500 -- (-413.179) (-417.617) [-411.766] (-412.941) * (-417.063) [-412.312] (-413.873) (-415.860) -- 0:00:30
470000 -- (-412.320) [-413.017] (-413.870) (-415.260) * [-415.864] (-414.494) (-415.097) (-413.577) -- 0:00:30
Average standard deviation of split frequencies: 0.011665
470500 -- [-414.415] (-413.074) (-419.807) (-414.552) * [-414.093] (-419.184) (-418.253) (-411.731) -- 0:00:30
471000 -- (-412.709) (-412.764) (-414.828) [-413.732] * (-418.493) (-414.601) (-413.096) [-413.037] -- 0:00:30
471500 -- [-413.475] (-412.739) (-414.425) (-412.623) * [-416.243] (-414.779) (-412.870) (-412.802) -- 0:00:30
472000 -- (-412.853) [-414.891] (-418.611) (-413.784) * (-414.166) (-413.293) (-413.904) [-412.709] -- 0:00:31
472500 -- [-415.000] (-413.260) (-414.784) (-412.383) * (-413.747) (-412.937) [-416.834] (-413.221) -- 0:00:31
473000 -- (-413.589) (-413.621) (-414.396) [-416.082] * (-412.525) (-415.830) (-414.158) [-413.946] -- 0:00:31
473500 -- (-414.334) (-412.665) (-411.975) [-411.816] * (-417.269) [-411.756] (-412.590) (-411.891) -- 0:00:31
474000 -- [-415.090] (-416.336) (-413.295) (-413.645) * (-412.619) [-412.958] (-412.773) (-414.170) -- 0:00:31
474500 -- (-417.576) (-417.974) [-412.879] (-416.401) * (-412.535) (-413.295) (-416.155) [-416.886] -- 0:00:31
475000 -- (-412.290) (-412.455) [-412.587] (-413.763) * (-416.841) (-415.184) [-414.024] (-414.473) -- 0:00:30
Average standard deviation of split frequencies: 0.011476
475500 -- (-414.481) [-413.159] (-414.193) (-416.528) * (-412.703) [-415.575] (-415.308) (-414.819) -- 0:00:30
476000 -- [-412.411] (-413.977) (-415.159) (-416.353) * [-412.609] (-412.810) (-415.354) (-413.119) -- 0:00:30
476500 -- (-414.419) (-418.490) (-412.494) [-414.265] * (-412.843) [-415.273] (-413.815) (-415.113) -- 0:00:30
477000 -- (-414.748) (-413.946) (-412.694) [-414.245] * (-412.747) [-412.515] (-412.055) (-413.848) -- 0:00:30
477500 -- (-413.530) (-414.143) (-412.877) [-414.772] * (-412.692) (-418.542) [-413.055] (-418.469) -- 0:00:30
478000 -- (-414.429) (-414.297) (-411.995) [-412.674] * (-413.830) [-414.325] (-412.610) (-413.761) -- 0:00:30
478500 -- (-415.448) (-413.408) [-413.621] (-415.501) * (-414.465) (-414.558) (-413.628) [-412.044] -- 0:00:30
479000 -- [-414.529] (-412.602) (-414.449) (-414.322) * [-412.013] (-413.938) (-414.505) (-411.855) -- 0:00:30
479500 -- (-415.670) (-413.609) (-413.847) [-416.760] * (-411.926) (-413.621) [-413.230] (-412.596) -- 0:00:30
480000 -- (-412.467) (-414.847) (-418.704) [-414.181] * (-412.319) [-414.837] (-414.015) (-412.123) -- 0:00:30
Average standard deviation of split frequencies: 0.011646
480500 -- (-412.940) (-414.710) [-417.563] (-413.547) * [-415.488] (-416.355) (-414.769) (-411.657) -- 0:00:30
481000 -- (-412.641) (-413.366) (-416.505) [-416.031] * (-413.534) [-418.359] (-413.892) (-412.631) -- 0:00:30
481500 -- (-412.476) (-415.854) [-413.540] (-413.401) * (-414.510) (-413.220) (-419.124) [-415.664] -- 0:00:30
482000 -- (-412.224) (-415.456) [-416.404] (-413.966) * [-412.941] (-417.802) (-415.737) (-413.147) -- 0:00:30
482500 -- (-412.838) (-416.279) (-416.127) [-415.520] * (-412.131) (-413.368) (-413.866) [-415.271] -- 0:00:30
483000 -- (-413.177) [-412.126] (-415.228) (-412.538) * [-414.264] (-413.035) (-417.519) (-413.015) -- 0:00:29
483500 -- (-418.309) [-413.062] (-413.637) (-412.402) * (-415.658) [-413.526] (-413.995) (-415.524) -- 0:00:29
484000 -- (-412.077) (-416.752) (-414.403) [-414.921] * (-412.478) (-415.155) (-415.139) [-413.555] -- 0:00:29
484500 -- (-412.843) (-414.025) [-413.336] (-413.775) * [-413.426] (-413.219) (-413.358) (-414.208) -- 0:00:29
485000 -- (-413.528) (-412.774) (-414.404) [-414.585] * (-413.801) (-414.743) (-416.673) [-415.754] -- 0:00:29
Average standard deviation of split frequencies: 0.011811
485500 -- (-414.333) [-414.025] (-414.461) (-412.014) * (-412.614) [-411.545] (-416.866) (-413.605) -- 0:00:29
486000 -- [-414.344] (-417.443) (-413.812) (-411.959) * (-416.694) (-413.589) [-412.558] (-413.463) -- 0:00:29
486500 -- [-413.486] (-414.521) (-415.149) (-415.659) * [-414.525] (-416.270) (-412.295) (-413.757) -- 0:00:29
487000 -- (-417.423) (-416.601) (-412.873) [-413.506] * (-414.808) (-415.692) (-413.905) [-415.094] -- 0:00:29
487500 -- (-416.242) [-413.038] (-412.573) (-413.116) * (-416.084) [-412.655] (-414.652) (-420.276) -- 0:00:29
488000 -- (-414.247) (-412.566) [-411.886] (-412.125) * (-412.984) (-415.770) (-414.192) [-415.952] -- 0:00:29
488500 -- [-413.352] (-415.220) (-414.427) (-412.844) * (-418.212) [-413.459] (-415.178) (-414.487) -- 0:00:29
489000 -- (-415.444) (-413.902) [-413.828] (-412.327) * (-417.282) [-412.470] (-413.815) (-414.210) -- 0:00:29
489500 -- (-415.077) (-414.674) [-417.352] (-414.834) * [-416.357] (-413.530) (-413.727) (-413.587) -- 0:00:30
490000 -- (-411.839) (-413.894) (-418.130) [-413.289] * (-415.378) [-413.641] (-412.535) (-414.715) -- 0:00:30
Average standard deviation of split frequencies: 0.011472
490500 -- (-412.168) [-412.522] (-416.280) (-412.383) * (-414.990) [-412.601] (-413.976) (-412.520) -- 0:00:30
491000 -- [-412.677] (-414.813) (-412.687) (-417.451) * (-412.576) (-416.375) [-412.710] (-414.625) -- 0:00:30
491500 -- (-414.947) (-414.024) (-412.611) [-412.826] * (-414.020) (-416.190) (-414.968) [-414.723] -- 0:00:30
492000 -- [-414.321] (-413.022) (-415.898) (-413.161) * (-413.966) (-413.035) [-413.227] (-413.756) -- 0:00:29
492500 -- [-415.662] (-417.049) (-412.709) (-414.454) * (-413.587) [-414.121] (-413.662) (-412.459) -- 0:00:29
493000 -- [-413.413] (-416.448) (-414.121) (-413.550) * [-413.534] (-415.875) (-412.881) (-411.679) -- 0:00:29
493500 -- [-414.546] (-414.327) (-412.268) (-415.309) * (-414.176) (-416.304) [-413.793] (-414.886) -- 0:00:29
494000 -- (-414.687) (-413.477) [-414.326] (-414.569) * (-415.208) (-414.364) [-413.366] (-412.584) -- 0:00:29
494500 -- [-412.963] (-413.563) (-412.897) (-415.357) * (-412.673) [-413.097] (-413.760) (-411.872) -- 0:00:29
495000 -- (-412.764) (-412.867) (-412.927) [-412.112] * (-413.325) [-414.692] (-413.826) (-413.753) -- 0:00:29
Average standard deviation of split frequencies: 0.011852
495500 -- (-413.777) (-413.840) (-414.554) [-412.938] * (-412.630) [-413.843] (-414.418) (-414.864) -- 0:00:29
496000 -- (-413.496) [-415.961] (-418.451) (-411.992) * [-413.363] (-417.182) (-419.003) (-414.440) -- 0:00:29
496500 -- (-417.849) [-414.981] (-415.945) (-412.994) * (-412.207) (-412.590) [-413.409] (-413.572) -- 0:00:29
497000 -- (-414.291) (-415.985) [-413.688] (-412.194) * [-413.807] (-413.284) (-412.394) (-412.149) -- 0:00:29
497500 -- (-413.640) (-414.783) [-413.598] (-412.972) * (-418.531) (-413.288) [-416.721] (-411.998) -- 0:00:29
498000 -- (-415.286) (-416.151) (-413.163) [-414.727] * (-413.258) [-413.280] (-413.426) (-412.336) -- 0:00:29
498500 -- (-415.375) [-415.432] (-412.149) (-416.358) * (-413.327) [-412.208] (-414.603) (-415.857) -- 0:00:29
499000 -- [-412.150] (-413.535) (-412.167) (-413.197) * (-413.997) (-414.879) [-412.896] (-414.822) -- 0:00:29
499500 -- (-413.784) [-413.181] (-414.785) (-414.370) * [-413.191] (-413.958) (-414.511) (-413.366) -- 0:00:29
500000 -- (-413.341) (-415.970) [-413.515] (-416.965) * (-417.794) (-412.688) (-412.262) [-412.062] -- 0:00:29
Average standard deviation of split frequencies: 0.011908
500500 -- (-415.954) (-414.179) (-412.670) [-413.839] * [-413.378] (-416.584) (-413.435) (-414.707) -- 0:00:28
501000 -- (-412.345) [-412.406] (-414.632) (-415.721) * (-414.131) (-417.312) [-413.572] (-414.008) -- 0:00:28
501500 -- [-414.006] (-414.871) (-416.768) (-416.637) * (-416.304) (-413.821) (-416.455) [-416.376] -- 0:00:28
502000 -- [-415.716] (-413.084) (-414.540) (-419.472) * [-417.190] (-411.817) (-414.362) (-417.393) -- 0:00:28
502500 -- (-414.524) [-416.767] (-413.607) (-414.433) * (-413.518) (-412.384) [-416.219] (-413.956) -- 0:00:28
503000 -- [-412.937] (-412.265) (-413.257) (-416.742) * (-412.054) (-413.317) (-414.814) [-413.860] -- 0:00:28
503500 -- (-412.130) [-415.110] (-418.539) (-413.492) * (-413.096) (-417.558) (-412.008) [-413.080] -- 0:00:28
504000 -- [-414.216] (-414.283) (-413.401) (-412.434) * (-414.453) [-413.397] (-412.806) (-416.102) -- 0:00:28
504500 -- (-412.256) [-412.405] (-414.189) (-413.285) * (-415.638) (-417.199) [-414.446] (-413.396) -- 0:00:28
505000 -- (-413.077) (-413.388) (-415.218) [-417.991] * (-413.533) (-413.996) [-416.176] (-412.717) -- 0:00:28
Average standard deviation of split frequencies: 0.011399
505500 -- (-413.006) (-413.289) (-413.507) [-412.814] * (-412.284) (-415.125) [-414.921] (-414.937) -- 0:00:28
506000 -- (-415.423) [-411.633] (-412.205) (-415.295) * (-412.386) (-414.695) (-413.612) [-416.022] -- 0:00:29
506500 -- (-415.979) (-413.509) (-414.308) [-414.001] * (-412.998) [-412.959] (-416.848) (-413.128) -- 0:00:29
507000 -- (-417.556) (-415.698) [-413.412] (-414.441) * (-414.656) [-414.539] (-414.970) (-413.640) -- 0:00:29
507500 -- (-414.072) (-414.920) (-413.118) [-412.518] * (-414.461) (-412.994) [-414.686] (-413.145) -- 0:00:29
508000 -- (-414.759) (-414.256) (-414.076) [-412.914] * [-413.449] (-413.495) (-417.986) (-413.776) -- 0:00:29
508500 -- [-413.899] (-413.392) (-413.180) (-413.032) * (-419.588) [-411.680] (-414.787) (-412.539) -- 0:00:28
509000 -- (-416.244) (-414.686) (-412.952) [-414.033] * (-413.041) (-411.898) [-412.597] (-412.555) -- 0:00:28
509500 -- [-413.281] (-417.239) (-413.972) (-413.830) * (-413.647) (-413.596) [-414.418] (-414.342) -- 0:00:28
510000 -- (-415.379) (-423.701) [-412.364] (-418.578) * (-413.302) [-413.524] (-413.942) (-414.571) -- 0:00:28
Average standard deviation of split frequencies: 0.011457
510500 -- (-412.697) (-418.282) (-416.638) [-412.337] * (-415.304) [-414.207] (-413.994) (-413.310) -- 0:00:28
511000 -- [-412.610] (-415.685) (-414.355) (-412.883) * (-413.582) (-413.439) [-415.177] (-415.892) -- 0:00:28
511500 -- [-412.544] (-416.698) (-415.782) (-413.008) * [-412.246] (-414.892) (-414.120) (-414.706) -- 0:00:28
512000 -- [-414.399] (-413.684) (-414.588) (-415.492) * (-412.760) (-418.981) [-412.852] (-412.976) -- 0:00:28
512500 -- (-418.799) (-413.594) [-414.421] (-416.063) * (-413.864) (-412.402) [-413.081] (-412.055) -- 0:00:28
513000 -- (-416.921) [-413.104] (-421.651) (-414.926) * (-414.590) (-412.611) [-413.065] (-415.194) -- 0:00:28
513500 -- [-412.194] (-414.045) (-419.494) (-413.266) * (-413.662) (-414.225) [-412.736] (-416.591) -- 0:00:28
514000 -- [-416.342] (-414.990) (-416.704) (-413.834) * [-416.901] (-413.047) (-415.793) (-414.300) -- 0:00:28
514500 -- [-415.626] (-415.007) (-419.899) (-414.096) * (-412.412) (-413.221) (-413.359) [-414.562] -- 0:00:28
515000 -- (-413.690) (-415.597) (-413.473) [-415.099] * [-411.789] (-413.690) (-417.265) (-414.737) -- 0:00:28
Average standard deviation of split frequencies: 0.012447
515500 -- (-418.244) (-415.131) [-413.160] (-415.774) * (-414.748) [-413.234] (-414.973) (-412.931) -- 0:00:28
516000 -- (-413.377) (-415.767) [-413.604] (-412.451) * (-414.341) (-416.014) [-411.838] (-413.436) -- 0:00:28
516500 -- (-414.667) [-413.228] (-413.931) (-414.080) * (-415.699) [-413.592] (-415.173) (-415.896) -- 0:00:28
517000 -- (-415.229) (-413.827) (-413.496) [-415.884] * (-416.798) (-415.227) [-414.145] (-413.880) -- 0:00:28
517500 -- (-412.728) [-412.698] (-412.676) (-414.902) * (-413.968) [-415.689] (-412.742) (-414.400) -- 0:00:27
518000 -- (-413.887) (-413.966) [-412.373] (-414.696) * [-413.268] (-414.453) (-413.301) (-414.381) -- 0:00:27
518500 -- (-412.517) [-412.357] (-414.090) (-416.568) * [-414.054] (-412.110) (-414.327) (-420.937) -- 0:00:27
519000 -- [-412.465] (-414.806) (-414.388) (-412.831) * [-415.800] (-412.719) (-413.140) (-423.904) -- 0:00:27
519500 -- (-413.525) [-413.645] (-411.995) (-413.921) * [-415.741] (-415.452) (-415.267) (-413.397) -- 0:00:27
520000 -- (-414.220) (-414.142) [-416.235] (-412.850) * (-415.502) [-414.040] (-413.292) (-415.135) -- 0:00:27
Average standard deviation of split frequencies: 0.013524
520500 -- (-413.553) (-413.928) (-413.949) [-411.829] * [-414.881] (-414.987) (-414.075) (-412.797) -- 0:00:27
521000 -- (-418.171) (-414.474) (-413.265) [-414.006] * (-416.046) (-414.619) (-413.263) [-419.274] -- 0:00:27
521500 -- (-415.887) (-414.566) (-413.731) [-412.998] * (-414.118) (-413.871) [-417.092] (-412.760) -- 0:00:27
522000 -- [-414.866] (-413.361) (-415.138) (-412.986) * (-417.041) (-414.256) (-415.853) [-413.692] -- 0:00:27
522500 -- [-416.662] (-414.957) (-413.551) (-412.950) * [-417.053] (-416.399) (-413.231) (-413.115) -- 0:00:27
523000 -- [-412.496] (-412.947) (-412.732) (-413.519) * [-413.780] (-418.139) (-414.437) (-413.224) -- 0:00:27
523500 -- (-412.329) [-416.797] (-416.072) (-415.282) * (-414.520) [-416.065] (-414.927) (-415.861) -- 0:00:28
524000 -- (-412.541) (-415.529) [-412.647] (-419.910) * (-417.783) [-412.759] (-413.604) (-417.781) -- 0:00:28
524500 -- (-413.026) [-416.895] (-411.685) (-413.140) * (-414.964) (-418.483) (-417.459) [-414.428] -- 0:00:28
525000 -- (-412.714) (-413.889) [-413.409] (-415.426) * (-414.185) (-413.166) [-413.839] (-413.129) -- 0:00:28
Average standard deviation of split frequencies: 0.013095
525500 -- [-412.478] (-413.325) (-411.885) (-418.487) * (-414.552) (-411.671) (-415.530) [-414.069] -- 0:00:27
526000 -- (-412.931) (-415.424) [-411.761] (-422.629) * (-415.023) (-412.789) [-418.016] (-411.954) -- 0:00:27
526500 -- (-412.135) [-413.978] (-414.085) (-421.626) * [-413.523] (-414.167) (-413.642) (-413.201) -- 0:00:27
527000 -- [-413.943] (-415.783) (-415.113) (-413.833) * (-417.397) (-414.779) (-416.210) [-413.040] -- 0:00:27
527500 -- (-414.659) (-415.021) [-413.612] (-412.198) * (-415.997) (-415.188) [-413.401] (-413.552) -- 0:00:27
528000 -- (-415.626) (-415.640) (-413.795) [-412.330] * (-412.659) (-414.528) [-415.371] (-417.543) -- 0:00:27
528500 -- [-411.991] (-414.949) (-411.685) (-412.294) * [-412.156] (-412.700) (-413.890) (-413.407) -- 0:00:27
529000 -- [-412.024] (-413.658) (-412.098) (-412.886) * (-413.524) [-412.871] (-419.219) (-415.530) -- 0:00:27
529500 -- (-415.872) (-413.306) [-412.791] (-413.068) * [-414.145] (-414.048) (-418.668) (-414.182) -- 0:00:27
530000 -- [-413.383] (-415.460) (-413.459) (-412.740) * [-411.981] (-414.759) (-415.169) (-412.290) -- 0:00:27
Average standard deviation of split frequencies: 0.014161
530500 -- [-414.801] (-414.892) (-416.703) (-414.469) * [-413.400] (-413.697) (-414.516) (-417.617) -- 0:00:27
531000 -- (-413.143) (-416.735) (-416.861) [-413.604] * (-412.948) (-412.793) [-413.098] (-411.734) -- 0:00:27
531500 -- (-416.743) (-412.841) (-413.483) [-412.805] * (-414.233) (-418.555) (-414.639) [-413.484] -- 0:00:27
532000 -- (-412.387) (-413.402) (-412.777) [-412.702] * [-412.802] (-414.271) (-414.551) (-418.044) -- 0:00:27
532500 -- (-416.225) (-413.749) [-413.448] (-412.913) * (-413.178) [-415.009] (-412.101) (-413.297) -- 0:00:27
533000 -- [-413.923] (-415.243) (-413.863) (-413.980) * (-414.582) (-414.376) (-413.622) [-416.555] -- 0:00:27
533500 -- (-413.070) [-413.019] (-416.635) (-417.374) * (-413.228) [-412.998] (-416.319) (-414.697) -- 0:00:27
534000 -- (-416.918) [-413.211] (-416.298) (-413.123) * [-414.422] (-415.999) (-412.916) (-418.765) -- 0:00:27
534500 -- [-413.473] (-415.289) (-414.641) (-414.109) * [-413.011] (-414.965) (-413.863) (-415.720) -- 0:00:26
535000 -- [-413.832] (-412.861) (-413.423) (-414.087) * (-417.877) [-415.852] (-412.146) (-414.645) -- 0:00:26
Average standard deviation of split frequencies: 0.013813
535500 -- [-415.819] (-413.085) (-417.310) (-413.605) * [-411.792] (-413.801) (-416.518) (-413.840) -- 0:00:26
536000 -- (-415.787) [-415.437] (-415.128) (-411.903) * (-412.091) (-413.342) [-413.866] (-413.166) -- 0:00:26
536500 -- (-413.017) [-412.858] (-413.359) (-414.056) * (-412.358) (-414.542) (-412.106) [-414.682] -- 0:00:26
537000 -- [-413.051] (-414.895) (-414.165) (-413.670) * [-412.089] (-414.371) (-413.729) (-415.334) -- 0:00:26
537500 -- (-416.770) (-414.500) (-413.931) [-413.163] * (-413.084) [-412.746] (-413.730) (-422.317) -- 0:00:26
538000 -- (-415.785) [-416.438] (-413.330) (-412.179) * [-414.049] (-413.756) (-416.431) (-417.845) -- 0:00:26
538500 -- [-414.094] (-416.458) (-417.138) (-414.793) * (-414.601) (-416.521) (-418.425) [-415.459] -- 0:00:26
539000 -- (-412.813) (-412.400) (-417.891) [-414.931] * (-412.384) [-412.910] (-413.981) (-416.844) -- 0:00:26
539500 -- (-412.936) (-413.533) [-414.465] (-413.091) * [-412.637] (-413.722) (-417.617) (-416.049) -- 0:00:26
540000 -- [-412.556] (-415.388) (-412.761) (-415.618) * [-411.947] (-414.085) (-416.182) (-412.191) -- 0:00:26
Average standard deviation of split frequencies: 0.013899
540500 -- (-416.979) (-413.036) (-412.894) [-414.801] * (-413.516) [-417.466] (-412.805) (-418.610) -- 0:00:27
541000 -- (-416.264) [-413.950] (-412.155) (-412.525) * (-415.332) (-412.448) (-414.129) [-415.256] -- 0:00:27
541500 -- (-416.856) [-413.707] (-413.453) (-413.696) * (-414.517) (-414.282) [-414.275] (-415.769) -- 0:00:27
542000 -- (-412.746) (-414.102) [-414.165] (-417.890) * (-412.561) [-418.213] (-412.032) (-413.681) -- 0:00:27
542500 -- (-414.610) [-413.616] (-415.190) (-412.737) * (-414.714) (-414.396) [-414.940] (-413.138) -- 0:00:26
543000 -- [-412.145] (-418.116) (-413.004) (-413.212) * (-414.657) (-413.040) (-415.514) [-417.283] -- 0:00:26
543500 -- (-418.697) (-417.073) [-414.113] (-412.663) * (-413.837) [-412.789] (-419.596) (-412.527) -- 0:00:26
544000 -- (-423.017) [-417.292] (-414.930) (-412.593) * (-415.794) [-412.371] (-414.319) (-413.765) -- 0:00:26
544500 -- (-415.851) [-412.361] (-413.956) (-413.646) * (-416.035) (-413.981) [-413.208] (-413.216) -- 0:00:26
545000 -- (-412.996) [-415.349] (-415.574) (-411.879) * (-415.357) [-414.526] (-415.683) (-412.932) -- 0:00:26
Average standard deviation of split frequencies: 0.013509
545500 -- (-413.634) [-412.551] (-415.328) (-411.864) * [-412.360] (-417.982) (-413.549) (-414.028) -- 0:00:26
546000 -- (-414.312) [-412.792] (-415.375) (-415.198) * (-412.022) [-413.188] (-414.914) (-412.609) -- 0:00:26
546500 -- (-413.887) (-414.328) [-412.631] (-415.831) * [-413.952] (-416.344) (-415.276) (-414.067) -- 0:00:26
547000 -- (-412.964) (-415.684) [-413.062] (-415.853) * (-413.503) (-418.360) [-413.629] (-416.455) -- 0:00:26
547500 -- (-417.970) (-412.545) (-413.393) [-413.370] * (-412.496) (-414.614) [-418.016] (-415.469) -- 0:00:26
548000 -- (-413.699) (-415.074) (-413.695) [-414.137] * (-413.163) (-413.361) [-412.717] (-415.285) -- 0:00:26
548500 -- (-413.538) (-412.129) [-414.841] (-414.187) * (-414.829) [-412.884] (-412.692) (-414.082) -- 0:00:26
549000 -- (-413.334) [-415.343] (-413.560) (-414.141) * (-415.135) (-412.148) [-414.192] (-414.191) -- 0:00:26
549500 -- (-416.854) (-415.424) (-415.665) [-412.438] * (-413.592) [-414.224] (-414.949) (-416.858) -- 0:00:26
550000 -- [-412.610] (-411.706) (-420.346) (-414.425) * (-417.029) [-412.413] (-413.819) (-417.306) -- 0:00:26
Average standard deviation of split frequencies: 0.013001
550500 -- (-415.649) (-413.481) (-412.829) [-415.328] * (-414.352) [-414.954] (-412.886) (-415.326) -- 0:00:26
551000 -- (-413.245) [-413.053] (-413.769) (-413.749) * [-414.500] (-415.302) (-416.316) (-414.697) -- 0:00:26
551500 -- (-412.851) [-414.826] (-414.739) (-415.015) * (-413.335) [-413.595] (-415.841) (-414.497) -- 0:00:26
552000 -- (-413.072) (-412.994) [-416.258] (-414.104) * (-413.861) (-413.191) [-414.712] (-413.568) -- 0:00:25
552500 -- [-414.821] (-413.888) (-413.202) (-415.032) * (-418.790) (-415.051) (-414.046) [-414.059] -- 0:00:25
553000 -- [-414.829] (-412.083) (-416.047) (-419.025) * (-415.092) (-413.177) (-413.877) [-412.474] -- 0:00:25
553500 -- [-415.827] (-413.654) (-415.693) (-413.321) * (-416.985) (-414.496) [-420.195] (-414.740) -- 0:00:25
554000 -- (-416.838) [-415.810] (-416.957) (-412.725) * [-415.653] (-414.513) (-413.988) (-414.611) -- 0:00:25
554500 -- (-417.073) (-417.012) (-413.522) [-413.175] * (-413.494) (-417.111) [-414.532] (-413.269) -- 0:00:25
555000 -- (-420.118) (-415.710) [-412.232] (-416.288) * (-417.883) (-416.638) [-413.335] (-415.733) -- 0:00:25
Average standard deviation of split frequencies: 0.013619
555500 -- [-413.866] (-412.236) (-413.156) (-412.661) * (-413.296) (-412.498) (-417.540) [-412.492] -- 0:00:25
556000 -- (-417.801) (-413.212) (-412.975) [-415.194] * (-414.507) (-415.424) (-417.982) [-413.351] -- 0:00:25
556500 -- (-414.394) [-415.563] (-412.447) (-414.406) * (-414.657) (-417.284) [-412.790] (-413.525) -- 0:00:25
557000 -- (-411.953) [-416.207] (-414.840) (-415.525) * [-413.217] (-416.412) (-414.622) (-415.536) -- 0:00:25
557500 -- (-416.044) (-413.835) (-413.861) [-416.206] * (-414.728) (-412.292) [-413.986] (-416.782) -- 0:00:25
558000 -- (-412.667) (-416.303) (-413.402) [-412.831] * (-414.790) (-411.882) [-415.376] (-413.932) -- 0:00:26
558500 -- [-412.725] (-413.417) (-413.588) (-414.094) * (-413.331) [-417.611] (-414.547) (-414.896) -- 0:00:26
559000 -- (-412.567) (-411.993) (-414.032) [-413.427] * (-414.332) (-414.389) (-414.431) [-413.500] -- 0:00:26
559500 -- (-413.149) (-417.057) [-414.977] (-413.763) * (-413.363) [-412.272] (-412.654) (-413.067) -- 0:00:25
560000 -- (-415.445) (-414.266) (-413.317) [-411.956] * (-412.685) [-412.293] (-416.996) (-415.054) -- 0:00:25
Average standard deviation of split frequencies: 0.013700
560500 -- (-414.962) [-412.013] (-412.506) (-411.854) * (-413.200) (-412.784) [-411.716] (-413.205) -- 0:00:25
561000 -- (-413.343) (-412.706) (-412.833) [-413.439] * (-416.394) [-415.106] (-415.808) (-415.949) -- 0:00:25
561500 -- [-411.913] (-417.487) (-414.234) (-415.972) * (-413.573) (-414.186) (-412.700) [-413.485] -- 0:00:25
562000 -- (-412.606) (-414.999) [-418.122] (-414.677) * (-413.935) (-418.534) (-414.527) [-414.688] -- 0:00:25
562500 -- [-414.106] (-414.063) (-415.110) (-413.430) * [-414.079] (-417.443) (-417.252) (-413.165) -- 0:00:25
563000 -- (-416.692) (-416.050) (-417.408) [-417.015] * (-414.957) [-413.911] (-412.651) (-412.391) -- 0:00:25
563500 -- (-412.920) (-414.083) [-415.380] (-414.384) * [-412.812] (-416.612) (-416.744) (-412.155) -- 0:00:25
564000 -- [-414.606] (-412.097) (-413.931) (-415.443) * (-415.666) (-413.569) [-416.878] (-414.375) -- 0:00:25
564500 -- (-413.721) [-415.030] (-414.936) (-413.058) * [-413.241] (-416.029) (-412.626) (-412.848) -- 0:00:25
565000 -- (-416.353) [-416.744] (-413.753) (-414.697) * (-414.251) [-414.577] (-416.530) (-412.838) -- 0:00:25
Average standard deviation of split frequencies: 0.014159
565500 -- (-418.606) (-416.220) [-414.235] (-412.727) * (-415.357) [-417.045] (-414.674) (-417.622) -- 0:00:25
566000 -- (-419.053) (-414.430) [-414.800] (-412.522) * (-413.709) (-414.502) (-414.432) [-413.323] -- 0:00:25
566500 -- (-414.435) (-414.119) [-413.890] (-414.161) * (-415.034) (-413.956) (-413.311) [-413.256] -- 0:00:25
567000 -- (-415.294) (-415.224) [-414.993] (-414.921) * (-415.183) [-413.462] (-415.354) (-412.891) -- 0:00:25
567500 -- (-412.590) [-412.886] (-416.376) (-417.447) * (-413.436) (-419.331) (-412.014) [-412.046] -- 0:00:25
568000 -- (-414.785) [-412.597] (-415.931) (-413.872) * [-418.523] (-422.016) (-412.190) (-412.279) -- 0:00:25
568500 -- (-412.390) (-413.290) [-415.333] (-414.722) * [-416.804] (-427.316) (-411.717) (-412.838) -- 0:00:25
569000 -- [-411.793] (-411.822) (-414.065) (-412.337) * [-414.145] (-418.532) (-413.200) (-414.709) -- 0:00:24
569500 -- (-412.352) (-416.277) (-413.761) [-411.890] * (-415.524) (-413.853) (-415.987) [-414.612] -- 0:00:24
570000 -- [-412.794] (-416.674) (-415.919) (-413.800) * (-413.766) [-414.674] (-413.930) (-414.093) -- 0:00:24
Average standard deviation of split frequencies: 0.013888
570500 -- (-412.214) (-412.405) (-412.681) [-416.457] * (-413.379) [-413.777] (-418.644) (-413.931) -- 0:00:24
571000 -- (-417.840) [-412.425] (-413.194) (-413.549) * [-413.345] (-412.934) (-417.414) (-418.512) -- 0:00:24
571500 -- (-414.625) (-412.997) [-416.701] (-414.559) * (-414.177) (-414.645) (-414.725) [-416.843] -- 0:00:24
572000 -- (-414.591) (-412.633) [-415.032] (-414.162) * (-414.260) (-412.902) (-413.323) [-415.711] -- 0:00:24
572500 -- [-414.004] (-414.032) (-412.448) (-414.511) * [-412.416] (-414.480) (-412.807) (-415.135) -- 0:00:24
573000 -- (-412.638) (-412.833) [-415.356] (-412.889) * (-417.228) (-415.114) (-412.974) [-413.793] -- 0:00:24
573500 -- (-413.547) (-414.010) (-412.388) [-413.228] * (-417.587) [-412.199] (-421.001) (-412.628) -- 0:00:24
574000 -- (-414.060) (-412.932) (-412.753) [-413.310] * (-415.341) [-412.580] (-415.767) (-416.023) -- 0:00:24
574500 -- (-412.470) (-416.186) (-413.299) [-412.443] * (-414.003) [-413.340] (-413.784) (-414.797) -- 0:00:24
575000 -- (-412.778) (-413.731) (-417.367) [-414.730] * (-416.342) (-413.935) [-413.609] (-417.394) -- 0:00:25
Average standard deviation of split frequencies: 0.013453
575500 -- (-412.762) (-413.042) (-414.302) [-415.882] * (-416.393) (-413.650) [-415.965] (-417.854) -- 0:00:25
576000 -- (-413.219) [-412.385] (-413.357) (-413.308) * (-414.883) [-413.430] (-413.522) (-412.687) -- 0:00:25
576500 -- (-412.514) (-413.241) (-415.092) [-411.908] * (-413.414) [-416.499] (-414.982) (-414.828) -- 0:00:24
577000 -- [-413.959] (-419.416) (-413.891) (-411.868) * (-413.986) (-413.771) (-412.897) [-412.780] -- 0:00:24
577500 -- (-414.101) [-412.696] (-412.428) (-414.000) * (-413.990) (-417.775) (-412.470) [-414.464] -- 0:00:24
578000 -- [-413.318] (-414.733) (-416.388) (-413.333) * (-418.118) (-413.327) (-415.188) [-413.011] -- 0:00:24
578500 -- [-415.691] (-418.285) (-413.298) (-412.569) * [-415.206] (-412.904) (-411.897) (-418.052) -- 0:00:24
579000 -- (-413.768) (-415.581) [-414.484] (-412.734) * (-415.520) [-413.717] (-411.837) (-423.092) -- 0:00:24
579500 -- [-415.742] (-413.043) (-414.923) (-415.266) * [-413.524] (-414.956) (-417.552) (-413.364) -- 0:00:24
580000 -- [-415.554] (-412.123) (-413.795) (-415.038) * (-413.195) [-415.151] (-413.074) (-414.789) -- 0:00:24
Average standard deviation of split frequencies: 0.013192
580500 -- (-412.887) [-411.790] (-414.619) (-414.963) * (-419.488) [-412.339] (-412.328) (-416.591) -- 0:00:24
581000 -- (-414.105) (-411.760) [-417.266] (-414.824) * [-415.930] (-412.476) (-412.761) (-412.879) -- 0:00:24
581500 -- (-412.023) (-413.258) [-414.278] (-416.521) * (-412.568) (-415.396) (-415.153) [-416.731] -- 0:00:24
582000 -- [-413.408] (-414.606) (-417.279) (-412.386) * [-413.227] (-414.420) (-416.067) (-416.502) -- 0:00:24
582500 -- (-412.977) (-414.946) (-416.110) [-417.484] * (-412.144) [-413.356] (-413.335) (-416.362) -- 0:00:24
583000 -- (-415.364) (-412.607) [-417.032] (-413.809) * (-413.451) (-413.655) [-419.451] (-420.455) -- 0:00:24
583500 -- [-417.177] (-413.042) (-414.728) (-413.196) * (-413.236) (-413.866) [-415.489] (-415.807) -- 0:00:24
584000 -- (-412.646) [-417.184] (-413.074) (-413.167) * [-414.667] (-414.334) (-417.927) (-415.666) -- 0:00:24
584500 -- (-412.506) (-416.685) (-412.590) [-414.973] * (-415.165) (-412.324) (-415.222) [-413.013] -- 0:00:24
585000 -- [-412.964] (-412.357) (-411.876) (-416.580) * (-413.069) (-413.745) [-414.706] (-412.778) -- 0:00:24
Average standard deviation of split frequencies: 0.012921
585500 -- (-417.377) [-412.503] (-413.987) (-417.156) * (-414.572) [-414.875] (-414.287) (-413.958) -- 0:00:24
586000 -- [-414.955] (-414.627) (-415.411) (-415.084) * [-413.032] (-412.772) (-413.205) (-417.217) -- 0:00:24
586500 -- (-412.748) (-413.701) (-415.856) [-417.823] * (-418.126) (-415.325) [-415.144] (-413.153) -- 0:00:23
587000 -- (-414.113) [-415.463] (-417.610) (-413.811) * (-415.161) [-413.369] (-416.209) (-416.165) -- 0:00:23
587500 -- (-416.809) (-413.546) (-414.668) [-412.362] * (-420.173) (-416.109) (-415.486) [-412.998] -- 0:00:23
588000 -- (-414.424) [-412.899] (-416.651) (-412.757) * [-419.433] (-416.279) (-412.882) (-412.625) -- 0:00:23
588500 -- [-412.947] (-412.790) (-415.793) (-412.034) * [-413.558] (-417.407) (-412.704) (-413.302) -- 0:00:23
589000 -- [-415.704] (-412.894) (-414.708) (-413.453) * (-413.239) [-413.603] (-413.312) (-415.633) -- 0:00:23
589500 -- (-419.207) [-413.944] (-416.796) (-414.233) * (-412.473) (-414.877) (-411.734) [-413.063] -- 0:00:23
590000 -- (-412.983) (-411.903) [-413.800] (-415.876) * (-412.376) (-416.910) [-412.342] (-414.203) -- 0:00:23
Average standard deviation of split frequencies: 0.012570
590500 -- (-413.995) (-412.602) [-413.465] (-414.422) * (-413.925) (-412.824) [-414.359] (-415.396) -- 0:00:23
591000 -- [-411.759] (-413.475) (-413.102) (-413.785) * (-413.807) [-414.964] (-412.524) (-414.747) -- 0:00:23
591500 -- (-413.363) (-414.451) [-415.602] (-413.735) * (-413.179) [-413.123] (-414.546) (-415.647) -- 0:00:23
592000 -- [-413.713] (-412.883) (-414.082) (-412.605) * (-413.054) (-414.699) (-413.202) [-413.148] -- 0:00:24
592500 -- (-412.928) [-413.081] (-416.141) (-412.675) * (-415.526) [-414.409] (-415.210) (-414.695) -- 0:00:24
593000 -- (-412.788) (-413.483) [-412.605] (-414.179) * (-414.913) (-413.374) [-413.353] (-419.736) -- 0:00:24
593500 -- (-416.375) (-413.083) [-413.878] (-413.808) * (-417.234) (-412.647) [-415.250] (-418.946) -- 0:00:23
594000 -- (-416.286) (-413.490) (-411.773) [-415.545] * (-412.990) (-413.797) (-414.939) [-413.736] -- 0:00:23
594500 -- (-414.062) (-414.614) [-413.441] (-412.801) * [-412.540] (-413.406) (-416.092) (-413.742) -- 0:00:23
595000 -- [-413.574] (-415.651) (-415.634) (-412.285) * [-412.986] (-416.289) (-411.942) (-413.360) -- 0:00:23
Average standard deviation of split frequencies: 0.012260
595500 -- (-414.687) [-415.686] (-414.190) (-412.312) * (-420.753) [-412.130] (-415.281) (-412.603) -- 0:00:23
596000 -- [-412.733] (-413.625) (-413.494) (-414.704) * [-415.001] (-416.849) (-413.994) (-413.427) -- 0:00:23
596500 -- (-412.710) [-412.791] (-415.246) (-413.736) * (-417.722) (-416.067) (-413.805) [-412.717] -- 0:00:23
597000 -- [-412.469] (-416.726) (-416.196) (-415.741) * (-418.145) (-416.086) [-414.104] (-412.560) -- 0:00:23
597500 -- (-417.147) [-413.416] (-415.253) (-412.749) * (-416.395) (-414.295) (-415.077) [-412.627] -- 0:00:23
598000 -- [-416.214] (-412.419) (-415.508) (-415.352) * (-415.430) (-414.802) (-413.720) [-412.870] -- 0:00:23
598500 -- (-416.570) [-412.408] (-415.126) (-413.640) * (-415.338) [-414.782] (-415.648) (-413.518) -- 0:00:23
599000 -- (-416.123) (-412.008) (-419.449) [-411.899] * (-413.251) [-415.772] (-415.178) (-418.120) -- 0:00:23
599500 -- (-412.605) (-415.130) (-417.081) [-412.770] * (-414.079) (-412.990) [-412.587] (-416.340) -- 0:00:23
600000 -- (-413.613) (-415.946) [-413.474] (-413.734) * (-412.824) (-415.596) [-413.634] (-415.889) -- 0:00:23
Average standard deviation of split frequencies: 0.012606
600500 -- (-413.672) [-412.667] (-414.339) (-414.436) * (-416.115) (-418.992) [-416.257] (-414.384) -- 0:00:23
601000 -- [-413.623] (-417.797) (-416.312) (-413.604) * [-412.537] (-413.140) (-415.529) (-414.605) -- 0:00:23
601500 -- [-415.934] (-413.735) (-419.005) (-412.112) * (-412.612) (-414.062) (-412.812) [-415.048] -- 0:00:23
602000 -- (-414.233) (-412.908) [-414.959] (-413.717) * (-413.692) (-414.320) (-411.942) [-412.531] -- 0:00:23
602500 -- [-414.777] (-412.879) (-414.191) (-411.729) * (-415.075) (-411.819) (-413.673) [-413.526] -- 0:00:23
603000 -- (-414.618) (-412.354) [-412.833] (-416.384) * [-412.805] (-411.916) (-413.238) (-414.342) -- 0:00:23
603500 -- [-412.385] (-412.158) (-414.105) (-412.519) * (-412.691) (-416.265) [-412.046] (-413.654) -- 0:00:22
604000 -- [-413.292] (-416.123) (-413.269) (-413.137) * (-413.170) [-414.482] (-413.969) (-416.374) -- 0:00:22
604500 -- (-414.039) (-414.190) [-413.904] (-412.487) * [-413.812] (-412.555) (-414.238) (-413.852) -- 0:00:22
605000 -- [-412.502] (-415.574) (-414.290) (-417.043) * (-412.531) [-412.230] (-415.032) (-416.243) -- 0:00:22
Average standard deviation of split frequencies: 0.012252
605500 -- [-414.441] (-413.192) (-415.239) (-414.129) * (-416.721) (-415.284) [-412.841] (-416.686) -- 0:00:22
606000 -- (-417.246) [-412.196] (-414.212) (-414.313) * (-415.839) [-415.550] (-414.111) (-414.934) -- 0:00:22
606500 -- [-411.897] (-416.724) (-416.450) (-412.098) * (-415.766) (-411.964) (-412.212) [-414.002] -- 0:00:22
607000 -- (-413.040) (-415.005) [-415.003] (-412.377) * (-413.920) [-413.038] (-413.259) (-414.163) -- 0:00:22
607500 -- (-415.190) (-413.475) [-413.513] (-416.169) * (-414.476) (-414.602) (-418.376) [-418.145] -- 0:00:22
608000 -- (-412.731) [-412.877] (-417.028) (-414.881) * [-414.363] (-414.367) (-415.281) (-414.756) -- 0:00:22
608500 -- (-416.953) (-418.613) [-417.641] (-414.284) * (-414.982) [-416.951] (-416.901) (-412.237) -- 0:00:22
609000 -- (-416.630) [-413.988] (-414.579) (-414.833) * (-417.226) (-412.162) [-420.171] (-413.066) -- 0:00:22
609500 -- (-412.108) (-416.708) [-413.380] (-413.713) * [-415.788] (-412.331) (-415.162) (-412.961) -- 0:00:23
610000 -- (-412.207) (-418.923) [-414.152] (-418.351) * (-414.766) (-415.377) (-415.454) [-411.807] -- 0:00:23
Average standard deviation of split frequencies: 0.011628
610500 -- [-412.844] (-416.194) (-413.242) (-417.517) * (-418.152) (-415.330) [-413.231] (-413.549) -- 0:00:22
611000 -- (-412.784) (-416.441) [-412.948] (-417.238) * (-413.016) [-413.571] (-414.419) (-415.965) -- 0:00:22
611500 -- (-414.435) [-412.365] (-412.973) (-417.018) * (-418.131) (-414.170) [-413.095] (-416.816) -- 0:00:22
612000 -- (-415.427) (-414.781) (-413.878) [-412.722] * [-411.607] (-412.094) (-413.082) (-417.112) -- 0:00:22
612500 -- [-415.574] (-413.648) (-414.172) (-417.395) * (-415.434) (-418.187) (-415.244) [-412.904] -- 0:00:22
613000 -- [-412.189] (-416.328) (-417.520) (-416.441) * [-415.294] (-416.892) (-415.704) (-411.942) -- 0:00:22
613500 -- (-416.308) (-415.944) [-418.322] (-415.818) * (-414.027) [-412.086] (-413.244) (-414.554) -- 0:00:22
614000 -- (-416.695) (-412.705) (-417.373) [-412.814] * [-414.555] (-412.458) (-415.524) (-413.519) -- 0:00:22
614500 -- (-415.114) [-415.798] (-418.782) (-413.530) * (-413.024) [-412.509] (-414.326) (-412.666) -- 0:00:22
615000 -- [-413.237] (-414.916) (-415.600) (-412.968) * [-412.300] (-415.917) (-416.335) (-414.975) -- 0:00:22
Average standard deviation of split frequencies: 0.011383
615500 -- (-415.498) (-415.556) [-415.460] (-413.467) * (-414.092) (-412.377) [-413.921] (-415.724) -- 0:00:22
616000 -- (-413.685) (-414.790) (-412.988) [-412.041] * (-414.343) (-413.899) (-414.976) [-413.706] -- 0:00:22
616500 -- (-413.649) (-415.408) [-414.726] (-415.257) * (-413.987) (-414.493) (-415.715) [-417.494] -- 0:00:22
617000 -- (-412.383) (-416.431) (-413.770) [-417.373] * (-414.619) (-416.045) (-416.570) [-416.082] -- 0:00:22
617500 -- (-412.383) [-414.171] (-411.965) (-415.310) * (-413.247) (-415.627) [-412.310] (-414.175) -- 0:00:22
618000 -- [-412.383] (-415.127) (-412.193) (-412.686) * [-412.162] (-412.475) (-413.141) (-414.153) -- 0:00:22
618500 -- (-414.163) [-412.314] (-412.300) (-415.270) * [-412.934] (-418.213) (-414.743) (-413.494) -- 0:00:22
619000 -- (-415.821) (-412.766) [-412.693] (-414.586) * (-416.405) [-415.310] (-414.246) (-414.370) -- 0:00:22
619500 -- (-416.319) (-413.327) (-414.741) [-414.685] * [-412.433] (-415.118) (-413.794) (-412.745) -- 0:00:22
620000 -- [-416.771] (-413.950) (-415.180) (-413.000) * (-416.706) (-413.091) [-414.915] (-417.035) -- 0:00:22
Average standard deviation of split frequencies: 0.011630
620500 -- (-412.549) [-413.640] (-414.221) (-413.583) * (-416.604) [-413.789] (-413.745) (-418.307) -- 0:00:22
621000 -- (-414.435) (-412.916) (-413.208) [-413.912] * (-414.639) (-415.775) (-412.549) [-412.926] -- 0:00:21
621500 -- (-413.339) (-412.212) (-413.116) [-412.246] * (-412.320) (-413.316) (-412.538) [-411.912] -- 0:00:21
622000 -- (-415.246) (-412.239) (-412.565) [-414.402] * (-414.104) (-413.182) [-412.638] (-414.076) -- 0:00:21
622500 -- [-415.583] (-411.632) (-412.205) (-414.438) * (-417.700) [-412.865] (-412.628) (-412.619) -- 0:00:21
623000 -- (-414.260) [-414.429] (-417.837) (-414.310) * (-415.140) (-413.517) (-412.351) [-415.651] -- 0:00:21
623500 -- [-414.532] (-413.562) (-412.927) (-413.772) * (-414.104) (-412.559) [-413.029] (-412.344) -- 0:00:21
624000 -- (-412.828) [-414.322] (-422.141) (-417.377) * (-413.901) (-414.361) (-413.172) [-413.203] -- 0:00:21
624500 -- (-412.054) [-413.989] (-413.995) (-416.938) * (-415.411) [-412.869] (-414.260) (-413.547) -- 0:00:21
625000 -- [-413.075] (-414.900) (-413.059) (-414.732) * (-412.229) (-414.724) (-414.073) [-415.213] -- 0:00:21
Average standard deviation of split frequencies: 0.011437
625500 -- (-413.804) (-416.848) [-411.669] (-416.474) * [-412.049] (-416.409) (-412.865) (-412.686) -- 0:00:21
626000 -- (-412.937) (-412.229) [-416.603] (-414.489) * [-412.561] (-415.026) (-414.256) (-412.155) -- 0:00:22
626500 -- (-414.658) [-417.265] (-412.632) (-417.863) * (-413.619) [-413.264] (-413.841) (-415.310) -- 0:00:22
627000 -- (-419.404) [-412.272] (-413.528) (-415.006) * (-413.394) (-412.171) (-415.852) [-416.191] -- 0:00:22
627500 -- (-412.704) (-412.945) [-413.138] (-414.079) * (-412.750) (-413.203) (-414.029) [-415.436] -- 0:00:21
628000 -- (-415.012) (-413.731) [-413.620] (-412.252) * (-414.625) [-412.574] (-413.976) (-415.228) -- 0:00:21
628500 -- (-411.683) (-412.757) [-415.368] (-417.425) * (-413.645) [-413.818] (-412.472) (-413.632) -- 0:00:21
629000 -- (-412.337) (-412.000) (-413.592) [-413.382] * [-414.705] (-413.878) (-412.562) (-414.126) -- 0:00:21
629500 -- (-413.885) (-415.213) (-415.208) [-413.232] * (-415.886) (-415.043) (-414.813) [-413.898] -- 0:00:21
630000 -- (-414.195) (-415.486) (-414.902) [-414.281] * (-413.250) (-413.245) (-417.295) [-412.749] -- 0:00:21
Average standard deviation of split frequencies: 0.011679
630500 -- (-418.498) [-416.000] (-414.548) (-413.712) * [-413.138] (-412.290) (-414.875) (-413.062) -- 0:00:21
631000 -- (-414.725) [-412.966] (-415.153) (-411.732) * [-413.574] (-412.476) (-414.036) (-412.916) -- 0:00:21
631500 -- [-413.803] (-413.903) (-413.506) (-414.290) * (-412.384) (-418.088) [-412.795] (-412.538) -- 0:00:21
632000 -- (-414.917) [-412.885] (-416.872) (-415.245) * [-416.372] (-412.884) (-411.975) (-413.325) -- 0:00:21
632500 -- [-415.979] (-412.248) (-413.921) (-414.801) * (-419.990) (-414.371) [-412.772] (-418.837) -- 0:00:21
633000 -- [-414.506] (-412.929) (-414.561) (-414.866) * (-413.170) (-412.836) [-415.513] (-412.533) -- 0:00:21
633500 -- [-414.502] (-413.786) (-414.727) (-415.055) * (-412.684) (-414.147) (-414.707) [-412.643] -- 0:00:21
634000 -- (-413.265) [-412.475] (-411.929) (-416.282) * (-415.236) (-413.971) (-413.576) [-416.724] -- 0:00:21
634500 -- (-415.129) [-412.977] (-412.079) (-415.661) * (-414.660) (-413.319) (-413.741) [-413.660] -- 0:00:21
635000 -- [-412.667] (-415.369) (-412.327) (-413.455) * (-412.996) (-413.688) (-416.520) [-413.638] -- 0:00:21
Average standard deviation of split frequencies: 0.011813
635500 -- [-415.124] (-417.258) (-414.011) (-413.679) * (-414.466) (-416.241) (-412.959) [-416.210] -- 0:00:21
636000 -- [-413.125] (-412.869) (-417.688) (-415.101) * (-413.907) (-415.941) [-415.882] (-415.483) -- 0:00:21
636500 -- (-412.751) [-412.858] (-417.755) (-413.117) * (-414.491) [-411.983] (-418.421) (-417.638) -- 0:00:21
637000 -- (-413.163) (-415.763) [-414.191] (-420.142) * [-414.107] (-413.147) (-411.842) (-413.781) -- 0:00:21
637500 -- (-412.789) (-416.852) [-414.375] (-419.121) * (-412.676) (-417.021) (-412.157) [-417.310] -- 0:00:21
638000 -- (-413.596) (-415.550) [-414.769] (-414.242) * [-412.022] (-416.064) (-415.580) (-414.433) -- 0:00:20
638500 -- (-412.850) (-415.626) [-417.104] (-413.560) * [-413.239] (-416.162) (-413.932) (-414.827) -- 0:00:20
639000 -- (-414.424) [-412.465] (-415.177) (-417.050) * (-413.631) (-416.208) [-412.533] (-418.440) -- 0:00:20
639500 -- (-418.003) (-415.311) [-413.974] (-412.409) * [-414.054] (-417.929) (-415.623) (-416.106) -- 0:00:20
640000 -- (-415.436) (-414.652) (-413.630) [-412.928] * (-413.602) [-414.024] (-415.991) (-413.320) -- 0:00:20
Average standard deviation of split frequencies: 0.011175
640500 -- (-415.476) [-412.823] (-413.567) (-413.071) * [-414.184] (-412.405) (-412.703) (-413.036) -- 0:00:20
641000 -- (-412.827) (-413.984) (-417.289) [-414.294] * (-412.926) (-413.517) (-412.140) [-413.350] -- 0:00:20
641500 -- [-415.822] (-414.743) (-413.715) (-413.049) * [-412.444] (-413.609) (-413.734) (-414.484) -- 0:00:20
642000 -- [-412.335] (-415.634) (-417.580) (-413.766) * (-416.507) [-413.055] (-413.759) (-412.352) -- 0:00:20
642500 -- [-412.212] (-413.801) (-412.463) (-415.704) * (-418.337) [-414.561] (-418.531) (-413.065) -- 0:00:20
643000 -- [-412.617] (-412.352) (-412.271) (-414.871) * (-413.130) (-416.128) [-413.431] (-414.487) -- 0:00:20
643500 -- [-412.104] (-412.380) (-413.720) (-412.685) * (-417.197) [-412.916] (-413.477) (-414.201) -- 0:00:21
644000 -- (-413.615) [-411.932] (-413.140) (-412.749) * [-415.518] (-414.526) (-412.342) (-412.167) -- 0:00:21
644500 -- (-412.477) (-418.235) [-414.657] (-413.943) * (-416.786) (-414.076) (-415.414) [-414.504] -- 0:00:20
645000 -- [-411.823] (-412.896) (-413.042) (-413.425) * (-413.179) (-412.481) [-412.416] (-416.682) -- 0:00:20
Average standard deviation of split frequencies: 0.011356
645500 -- [-413.109] (-412.595) (-419.286) (-414.866) * (-412.566) (-414.091) [-413.383] (-413.557) -- 0:00:20
646000 -- (-414.457) (-413.872) (-415.136) [-415.056] * [-412.960] (-414.778) (-413.377) (-415.118) -- 0:00:20
646500 -- (-416.025) [-412.525] (-414.141) (-412.872) * (-417.258) [-413.497] (-412.496) (-412.075) -- 0:00:20
647000 -- (-413.574) (-423.332) [-416.204] (-415.401) * (-412.042) (-413.404) [-415.262] (-413.860) -- 0:00:20
647500 -- (-414.510) (-418.564) (-415.963) [-412.659] * (-412.028) [-412.871] (-414.401) (-418.849) -- 0:00:20
648000 -- (-413.001) (-419.004) [-414.438] (-413.730) * (-412.709) [-413.788] (-415.509) (-414.409) -- 0:00:20
648500 -- (-412.488) (-412.968) (-412.465) [-412.962] * (-413.047) (-415.601) [-412.308] (-412.190) -- 0:00:20
649000 -- (-414.754) [-415.746] (-416.900) (-414.902) * [-413.421] (-421.280) (-419.561) (-413.160) -- 0:00:20
649500 -- [-414.218] (-411.522) (-418.268) (-415.008) * (-413.381) (-418.537) [-413.873] (-413.629) -- 0:00:20
650000 -- (-415.547) [-416.911] (-414.236) (-416.528) * [-412.868] (-414.109) (-413.248) (-412.581) -- 0:00:20
Average standard deviation of split frequencies: 0.011320
650500 -- (-413.577) [-415.757] (-414.088) (-414.772) * (-415.785) [-415.562] (-412.032) (-412.297) -- 0:00:20
651000 -- (-413.900) [-413.545] (-418.024) (-413.808) * [-412.692] (-414.809) (-413.997) (-412.767) -- 0:00:20
651500 -- (-415.874) (-413.341) [-414.165] (-413.234) * (-412.612) (-419.673) (-416.545) [-412.707] -- 0:00:20
652000 -- (-414.412) (-416.353) [-413.449] (-413.135) * (-415.863) (-414.881) (-413.441) [-412.747] -- 0:00:20
652500 -- (-412.565) [-415.125] (-412.784) (-412.093) * [-415.886] (-413.939) (-413.925) (-413.880) -- 0:00:20
653000 -- [-413.991] (-413.440) (-413.853) (-412.444) * (-414.139) (-412.488) [-416.983] (-414.194) -- 0:00:20
653500 -- (-416.136) (-413.860) [-414.892] (-414.230) * (-415.199) (-415.467) (-414.334) [-414.652] -- 0:00:20
654000 -- (-412.054) (-417.958) [-419.492] (-415.562) * (-418.107) [-412.619] (-415.046) (-413.644) -- 0:00:20
654500 -- (-413.737) (-415.295) [-415.166] (-412.912) * (-416.027) (-413.458) (-412.497) [-412.646] -- 0:00:20
655000 -- (-413.989) [-413.105] (-414.728) (-416.151) * [-416.863] (-413.918) (-412.726) (-412.650) -- 0:00:20
Average standard deviation of split frequencies: 0.011857
655500 -- (-413.903) [-415.325] (-412.991) (-415.124) * (-412.670) [-414.405] (-415.800) (-416.818) -- 0:00:19
656000 -- (-413.309) [-412.655] (-415.441) (-412.944) * [-415.840] (-412.601) (-413.781) (-413.825) -- 0:00:19
656500 -- (-415.237) (-412.460) (-411.690) [-413.745] * [-413.710] (-413.454) (-415.573) (-412.864) -- 0:00:19
657000 -- (-414.522) (-412.238) [-412.916] (-412.750) * [-413.333] (-413.363) (-413.833) (-412.355) -- 0:00:19
657500 -- (-414.083) [-412.229] (-414.480) (-414.474) * (-419.074) (-413.854) [-413.361] (-414.034) -- 0:00:19
658000 -- (-413.925) [-413.385] (-412.232) (-412.243) * (-415.299) (-413.868) (-412.721) [-414.835] -- 0:00:19
658500 -- (-414.286) (-415.690) (-413.945) [-412.435] * (-419.432) (-415.841) (-413.661) [-414.608] -- 0:00:19
659000 -- (-414.981) [-418.325] (-417.069) (-416.117) * (-411.969) (-415.220) [-413.118] (-412.989) -- 0:00:19
659500 -- [-412.567] (-413.531) (-416.090) (-413.832) * (-413.868) (-414.452) [-412.370] (-413.759) -- 0:00:19
660000 -- [-414.326] (-416.798) (-416.177) (-413.825) * (-413.778) (-413.743) (-413.477) [-411.778] -- 0:00:19
Average standard deviation of split frequencies: 0.011595
660500 -- (-417.336) (-413.869) (-412.792) [-413.252] * (-412.541) [-412.719] (-417.784) (-415.807) -- 0:00:20
661000 -- (-414.639) (-413.744) (-414.425) [-416.682] * (-413.215) [-414.456] (-414.754) (-413.294) -- 0:00:20
661500 -- (-414.865) (-414.273) [-413.278] (-416.116) * [-412.290] (-414.167) (-414.946) (-414.560) -- 0:00:19
662000 -- (-415.004) (-415.292) [-413.405] (-421.215) * (-413.963) (-415.569) (-414.717) [-413.621] -- 0:00:19
662500 -- (-414.726) (-416.540) [-414.502] (-414.842) * (-414.310) [-413.298] (-413.114) (-413.035) -- 0:00:19
663000 -- (-415.827) (-413.406) [-412.724] (-414.624) * (-415.705) [-413.890] (-412.596) (-413.433) -- 0:00:19
663500 -- (-414.522) [-412.967] (-416.095) (-412.122) * (-414.431) (-414.631) [-415.599] (-414.311) -- 0:00:19
664000 -- (-412.983) (-412.365) (-414.700) [-413.616] * (-414.405) (-417.199) [-412.896] (-414.152) -- 0:00:19
664500 -- (-412.743) (-415.554) (-416.676) [-412.044] * (-413.061) [-413.974] (-412.245) (-415.173) -- 0:00:19
665000 -- (-412.343) (-416.488) (-414.411) [-411.896] * (-415.300) (-413.150) [-415.041] (-415.614) -- 0:00:19
Average standard deviation of split frequencies: 0.011767
665500 -- (-413.711) [-411.886] (-416.748) (-413.440) * (-415.860) (-414.878) [-412.316] (-412.401) -- 0:00:19
666000 -- [-414.505] (-417.290) (-416.443) (-416.506) * (-413.360) [-414.247] (-415.084) (-412.553) -- 0:00:19
666500 -- (-413.060) [-413.888] (-412.884) (-419.202) * (-413.072) (-414.074) (-412.062) [-413.012] -- 0:00:19
667000 -- (-414.564) (-414.710) (-414.673) [-418.250] * (-417.137) (-413.781) (-413.446) [-412.406] -- 0:00:19
667500 -- (-414.399) (-413.333) [-415.206] (-416.088) * (-415.899) (-413.797) [-412.394] (-413.316) -- 0:00:19
668000 -- (-416.394) [-412.328] (-413.252) (-414.536) * (-414.866) (-415.346) [-414.867] (-415.356) -- 0:00:19
668500 -- (-414.965) [-413.503] (-414.519) (-413.458) * (-413.695) (-413.453) (-414.959) [-412.889] -- 0:00:19
669000 -- (-411.728) [-412.650] (-416.798) (-412.862) * (-416.243) [-416.765] (-412.395) (-413.254) -- 0:00:19
669500 -- (-413.536) (-412.664) [-416.428] (-415.487) * (-413.456) (-414.904) (-414.731) [-412.182] -- 0:00:19
670000 -- (-414.137) [-413.766] (-414.926) (-413.012) * (-412.842) (-415.946) (-414.461) [-412.175] -- 0:00:19
Average standard deviation of split frequencies: 0.011949
670500 -- (-415.958) (-415.775) (-413.739) [-413.090] * (-413.537) [-412.807] (-413.616) (-420.963) -- 0:00:19
671000 -- (-413.799) (-412.839) [-412.771] (-414.037) * (-416.469) (-414.178) [-413.402] (-417.401) -- 0:00:19
671500 -- [-413.207] (-413.584) (-412.309) (-412.164) * (-417.783) [-414.692] (-412.491) (-414.520) -- 0:00:19
672000 -- [-414.187] (-412.438) (-415.853) (-412.700) * (-414.846) (-415.088) (-412.178) [-414.543] -- 0:00:19
672500 -- (-412.453) [-415.439] (-415.009) (-414.601) * (-413.751) (-415.150) (-415.751) [-414.913] -- 0:00:18
673000 -- (-412.175) [-413.557] (-413.380) (-412.401) * (-413.416) (-418.278) (-413.482) [-412.220] -- 0:00:18
673500 -- (-414.774) (-414.464) (-416.707) [-413.562] * (-412.914) (-412.534) [-414.782] (-415.336) -- 0:00:18
674000 -- (-414.280) [-415.719] (-413.580) (-418.950) * (-414.844) (-414.030) (-418.486) [-414.719] -- 0:00:18
674500 -- (-414.306) [-413.225] (-415.483) (-414.003) * (-421.932) (-412.935) (-412.820) [-416.160] -- 0:00:18
675000 -- [-413.885] (-414.177) (-417.681) (-414.398) * (-415.101) (-413.181) [-412.874] (-414.646) -- 0:00:18
Average standard deviation of split frequencies: 0.011942
675500 -- (-413.347) (-414.120) [-415.850] (-414.750) * [-416.566] (-414.829) (-413.452) (-417.287) -- 0:00:18
676000 -- [-413.091] (-412.837) (-412.531) (-416.580) * (-413.176) (-416.552) [-416.644] (-421.553) -- 0:00:18
676500 -- (-414.349) (-414.674) (-412.015) [-415.181] * (-414.230) [-411.689] (-413.795) (-413.390) -- 0:00:18
677000 -- (-414.905) [-412.563] (-415.457) (-415.735) * (-413.769) [-412.302] (-413.399) (-413.557) -- 0:00:18
677500 -- (-414.205) [-413.389] (-413.682) (-415.294) * (-413.527) [-416.831] (-413.683) (-414.450) -- 0:00:18
678000 -- (-413.670) (-416.013) [-412.494] (-417.460) * (-413.947) (-414.156) (-415.155) [-412.755] -- 0:00:18
678500 -- (-413.527) (-414.009) (-413.497) [-413.645] * (-414.645) (-414.282) [-415.649] (-415.922) -- 0:00:18
679000 -- [-415.184] (-413.503) (-414.015) (-412.949) * (-412.460) [-413.228] (-414.272) (-416.304) -- 0:00:18
679500 -- (-415.508) (-413.173) [-413.623] (-412.910) * (-413.771) [-414.201] (-415.407) (-414.722) -- 0:00:18
680000 -- (-412.931) (-412.683) (-415.690) [-411.997] * (-414.003) [-415.484] (-414.614) (-415.432) -- 0:00:18
Average standard deviation of split frequencies: 0.011817
680500 -- [-413.431] (-413.709) (-413.215) (-412.899) * (-413.783) (-414.215) (-415.383) [-414.828] -- 0:00:18
681000 -- (-412.542) (-412.932) (-412.976) [-412.151] * (-414.862) (-414.901) (-419.274) [-412.652] -- 0:00:18
681500 -- [-413.377] (-413.532) (-416.925) (-417.940) * (-415.380) (-414.145) (-420.533) [-414.515] -- 0:00:18
682000 -- (-413.591) (-413.206) [-418.363] (-411.957) * (-418.313) (-413.372) (-419.368) [-414.496] -- 0:00:18
682500 -- (-415.983) [-415.358] (-414.487) (-419.575) * [-417.991] (-418.671) (-413.362) (-413.170) -- 0:00:18
683000 -- (-415.839) (-419.072) [-412.725] (-414.901) * (-416.132) [-413.687] (-412.586) (-419.524) -- 0:00:18
683500 -- [-413.373] (-413.519) (-413.123) (-415.478) * (-417.056) (-414.056) [-412.859] (-418.783) -- 0:00:18
684000 -- [-413.217] (-412.524) (-414.101) (-415.644) * [-414.369] (-413.037) (-413.755) (-414.663) -- 0:00:18
684500 -- [-414.099] (-413.084) (-413.114) (-414.085) * (-416.860) (-415.478) [-417.823] (-417.325) -- 0:00:18
685000 -- (-414.711) [-414.047] (-415.734) (-416.760) * [-414.583] (-418.647) (-412.022) (-419.177) -- 0:00:18
Average standard deviation of split frequencies: 0.011854
685500 -- [-413.890] (-416.420) (-417.403) (-415.999) * (-413.994) [-411.918] (-412.177) (-416.829) -- 0:00:18
686000 -- (-415.006) (-416.121) (-413.216) [-412.850] * (-415.068) (-411.857) [-412.807] (-417.490) -- 0:00:18
686500 -- (-413.636) (-412.219) (-416.569) [-413.214] * [-411.733] (-414.505) (-413.957) (-414.932) -- 0:00:18
687000 -- [-415.192] (-413.494) (-412.622) (-414.542) * (-412.213) [-413.292] (-413.220) (-415.777) -- 0:00:18
687500 -- [-416.209] (-413.650) (-413.561) (-415.502) * [-414.028] (-414.612) (-416.307) (-416.894) -- 0:00:18
688000 -- (-414.887) (-413.726) (-412.501) [-413.218] * (-414.139) (-412.583) (-415.586) [-413.075] -- 0:00:18
688500 -- (-416.367) [-413.497] (-416.194) (-413.523) * [-414.881] (-414.816) (-419.355) (-412.362) -- 0:00:18
689000 -- [-412.301] (-413.638) (-413.649) (-414.257) * (-411.924) (-414.500) (-413.393) [-414.009] -- 0:00:18
689500 -- (-413.951) (-416.062) [-419.843] (-413.944) * (-413.889) [-415.550] (-413.345) (-417.699) -- 0:00:18
690000 -- (-412.148) (-414.443) [-413.874] (-417.019) * (-415.695) (-412.521) [-412.265] (-414.893) -- 0:00:17
Average standard deviation of split frequencies: 0.011390
690500 -- (-412.805) (-414.626) [-417.156] (-413.851) * (-413.839) (-412.434) [-414.188] (-413.506) -- 0:00:17
691000 -- (-415.905) (-415.288) [-411.942] (-414.297) * (-412.630) (-413.600) (-416.331) [-413.884] -- 0:00:17
691500 -- (-413.550) (-412.547) (-413.429) [-414.321] * (-414.409) (-414.590) (-413.999) [-413.980] -- 0:00:17
692000 -- (-414.834) (-412.998) (-415.961) [-415.022] * (-414.386) (-412.464) (-414.047) [-416.053] -- 0:00:17
692500 -- [-413.289] (-415.229) (-414.394) (-412.757) * (-413.397) [-413.063] (-413.618) (-414.669) -- 0:00:17
693000 -- (-418.026) [-412.324] (-418.303) (-415.741) * (-418.236) (-414.611) [-412.534] (-412.514) -- 0:00:17
693500 -- [-412.054] (-413.145) (-415.226) (-412.822) * (-412.627) (-413.650) (-412.473) [-415.015] -- 0:00:17
694000 -- (-412.952) [-414.008] (-413.700) (-414.239) * (-413.309) (-412.845) (-412.329) [-414.469] -- 0:00:17
694500 -- (-414.250) (-415.018) [-414.536] (-418.043) * (-416.505) [-415.834] (-413.384) (-412.420) -- 0:00:17
695000 -- (-413.108) (-412.846) [-413.764] (-413.990) * (-416.605) (-414.459) [-413.955] (-412.862) -- 0:00:17
Average standard deviation of split frequencies: 0.011303
695500 -- (-412.103) [-413.443] (-416.679) (-412.570) * (-413.706) (-415.330) (-415.620) [-415.725] -- 0:00:17
696000 -- (-424.564) (-412.213) (-413.266) [-412.333] * [-412.624] (-413.332) (-417.211) (-412.133) -- 0:00:17
696500 -- (-416.592) (-413.923) [-413.502] (-412.739) * (-415.583) (-415.467) [-414.489] (-413.567) -- 0:00:17
697000 -- (-416.378) (-412.653) [-411.908] (-411.770) * [-417.605] (-415.017) (-413.239) (-412.968) -- 0:00:17
697500 -- (-414.181) [-413.636] (-412.072) (-413.824) * (-416.653) [-411.860] (-412.860) (-416.244) -- 0:00:17
698000 -- (-417.337) (-414.715) [-413.476] (-411.975) * (-416.480) (-414.026) [-412.048] (-421.747) -- 0:00:17
698500 -- (-414.072) [-414.033] (-414.408) (-413.115) * (-416.483) [-416.464] (-417.478) (-413.140) -- 0:00:17
699000 -- (-412.093) [-414.290] (-414.125) (-413.244) * (-416.768) (-415.968) (-414.277) [-414.043] -- 0:00:17
699500 -- (-416.677) (-413.447) [-412.528] (-412.159) * (-414.853) [-413.084] (-412.972) (-416.221) -- 0:00:17
700000 -- [-412.683] (-420.289) (-414.860) (-414.858) * (-413.303) [-413.602] (-415.050) (-416.150) -- 0:00:17
Average standard deviation of split frequencies: 0.010765
700500 -- [-412.775] (-412.460) (-414.863) (-414.761) * (-412.608) [-412.344] (-414.251) (-414.778) -- 0:00:17
701000 -- (-412.231) (-413.974) [-412.490] (-420.324) * (-414.254) [-412.300] (-417.138) (-413.712) -- 0:00:17
701500 -- (-412.319) (-413.775) [-412.964] (-414.982) * (-418.011) [-416.704] (-415.844) (-411.798) -- 0:00:17
702000 -- (-412.907) [-412.187] (-413.065) (-413.130) * [-414.711] (-415.343) (-417.313) (-416.706) -- 0:00:17
702500 -- (-413.693) [-414.003] (-417.242) (-412.470) * (-413.533) [-415.042] (-419.952) (-418.668) -- 0:00:17
703000 -- (-414.862) (-413.454) (-412.519) [-413.179] * (-416.697) [-414.905] (-415.603) (-412.753) -- 0:00:17
703500 -- [-415.405] (-412.835) (-414.103) (-412.749) * (-414.311) [-412.775] (-414.068) (-416.579) -- 0:00:17
704000 -- (-414.598) [-414.680] (-414.329) (-413.016) * (-411.906) (-416.602) (-420.240) [-417.282] -- 0:00:17
704500 -- (-412.469) [-413.229] (-414.304) (-413.170) * (-416.075) (-414.829) [-411.952] (-412.612) -- 0:00:17
705000 -- [-412.447] (-412.766) (-415.106) (-414.273) * (-413.316) [-413.254] (-412.898) (-416.006) -- 0:00:17
Average standard deviation of split frequencies: 0.011017
705500 -- [-414.041] (-414.345) (-416.055) (-413.820) * (-415.446) (-412.993) (-412.145) [-415.169] -- 0:00:17
706000 -- (-413.781) (-416.621) (-413.991) [-414.047] * [-412.881] (-415.088) (-412.626) (-415.373) -- 0:00:17
706500 -- (-414.195) [-414.766] (-412.836) (-415.048) * (-415.760) [-414.861] (-412.238) (-414.020) -- 0:00:17
707000 -- (-412.757) (-413.945) [-414.099] (-412.713) * (-415.464) (-413.258) [-412.070] (-413.418) -- 0:00:16
707500 -- (-413.846) [-413.858] (-414.484) (-418.670) * (-413.277) (-413.986) [-413.221] (-413.596) -- 0:00:16
708000 -- [-414.456] (-416.673) (-412.911) (-416.176) * (-412.398) (-418.364) (-415.796) [-413.081] -- 0:00:16
708500 -- [-412.482] (-413.764) (-413.580) (-415.905) * [-414.741] (-413.004) (-415.495) (-415.636) -- 0:00:16
709000 -- (-413.368) [-414.579] (-415.628) (-412.407) * [-412.844] (-414.666) (-411.639) (-413.429) -- 0:00:16
709500 -- (-413.813) (-414.953) (-414.529) [-413.994] * (-413.706) (-414.258) [-413.274] (-414.137) -- 0:00:16
710000 -- [-415.987] (-420.425) (-413.079) (-416.770) * (-414.214) [-414.375] (-415.615) (-418.800) -- 0:00:16
Average standard deviation of split frequencies: 0.010655
710500 -- (-415.727) (-414.946) [-413.551] (-415.304) * (-413.571) (-412.558) [-412.470] (-419.304) -- 0:00:16
711000 -- [-414.034] (-413.898) (-416.275) (-414.345) * (-424.086) (-418.773) [-414.831] (-416.044) -- 0:00:16
711500 -- (-412.177) [-412.713] (-414.648) (-416.308) * [-413.591] (-414.895) (-417.177) (-414.408) -- 0:00:16
712000 -- (-412.547) (-412.600) [-415.610] (-414.411) * (-415.484) (-416.567) (-416.398) [-414.727] -- 0:00:16
712500 -- (-412.659) (-413.703) (-417.401) [-414.283] * (-414.970) [-413.600] (-412.697) (-414.593) -- 0:00:16
713000 -- (-412.713) (-416.006) (-412.991) [-415.948] * [-413.985] (-413.802) (-417.717) (-416.857) -- 0:00:16
713500 -- [-412.362] (-417.656) (-412.790) (-416.381) * [-413.061] (-414.464) (-412.206) (-412.287) -- 0:00:16
714000 -- [-412.966] (-414.626) (-412.813) (-415.207) * (-412.521) (-412.866) (-416.510) [-415.944] -- 0:00:16
714500 -- (-412.363) (-415.314) [-412.680] (-413.664) * (-414.547) [-414.468] (-413.656) (-414.851) -- 0:00:16
715000 -- (-412.540) (-418.655) (-413.657) [-412.148] * (-416.344) (-413.577) [-412.450] (-414.061) -- 0:00:16
Average standard deviation of split frequencies: 0.010534
715500 -- (-412.327) [-414.188] (-413.841) (-412.142) * (-412.509) (-416.368) [-414.669] (-413.492) -- 0:00:16
716000 -- (-412.036) (-413.818) (-413.375) [-412.690] * [-412.632] (-416.267) (-411.928) (-413.636) -- 0:00:16
716500 -- (-413.008) (-413.529) (-412.908) [-411.708] * [-412.638] (-412.377) (-414.726) (-412.006) -- 0:00:16
717000 -- (-415.415) [-413.218] (-412.530) (-412.683) * (-413.111) (-413.448) (-414.805) [-412.668] -- 0:00:16
717500 -- (-412.332) [-414.520] (-416.360) (-412.962) * (-412.871) (-415.305) [-414.603] (-411.908) -- 0:00:16
718000 -- (-412.775) [-415.842] (-412.276) (-413.093) * [-413.160] (-417.064) (-413.404) (-411.772) -- 0:00:16
718500 -- (-413.114) (-413.150) (-413.710) [-413.019] * [-414.774] (-413.497) (-413.079) (-411.718) -- 0:00:16
719000 -- [-416.659] (-412.539) (-412.993) (-414.899) * [-416.155] (-414.604) (-417.470) (-413.967) -- 0:00:16
719500 -- (-414.784) (-412.670) [-416.202] (-412.081) * (-415.691) (-415.749) [-415.010] (-412.801) -- 0:00:16
720000 -- (-412.652) (-414.362) [-415.624] (-413.150) * (-414.038) (-413.205) (-418.368) [-412.152] -- 0:00:16
Average standard deviation of split frequencies: 0.010302
720500 -- (-412.240) (-412.536) (-417.361) [-415.103] * [-417.456] (-416.711) (-413.512) (-411.861) -- 0:00:16
721000 -- [-415.678] (-415.874) (-413.788) (-411.769) * (-412.922) [-414.419] (-416.906) (-414.092) -- 0:00:16
721500 -- (-415.030) [-412.352] (-412.758) (-413.700) * (-412.940) (-421.072) [-413.641] (-413.056) -- 0:00:16
722000 -- (-414.211) (-414.441) [-414.567] (-413.718) * (-414.303) (-414.212) [-416.013] (-413.546) -- 0:00:16
722500 -- (-411.906) (-413.576) (-413.280) [-413.314] * [-413.900] (-413.983) (-414.870) (-413.533) -- 0:00:16
723000 -- (-412.462) [-414.722] (-413.073) (-416.515) * [-416.914] (-413.846) (-412.490) (-417.562) -- 0:00:16
723500 -- [-412.045] (-413.057) (-412.987) (-417.001) * [-413.043] (-412.422) (-412.782) (-418.310) -- 0:00:16
724000 -- (-419.064) [-413.938] (-417.580) (-412.188) * [-416.066] (-417.469) (-412.552) (-414.810) -- 0:00:16
724500 -- [-415.426] (-412.835) (-412.570) (-417.166) * (-413.836) [-414.650] (-419.006) (-416.202) -- 0:00:15
725000 -- (-413.099) [-413.144] (-412.903) (-421.910) * [-413.240] (-414.644) (-419.319) (-414.553) -- 0:00:15
Average standard deviation of split frequencies: 0.009821
725500 -- (-414.650) [-414.544] (-411.837) (-415.313) * (-416.639) (-414.207) [-415.167] (-415.591) -- 0:00:15
726000 -- (-416.417) [-413.733] (-412.229) (-413.948) * [-413.124] (-412.104) (-421.163) (-413.757) -- 0:00:15
726500 -- (-413.889) [-412.421] (-413.892) (-415.112) * [-412.249] (-413.240) (-415.164) (-417.853) -- 0:00:15
727000 -- [-414.131] (-412.660) (-414.589) (-416.582) * [-413.271] (-412.516) (-415.328) (-415.534) -- 0:00:15
727500 -- (-414.284) [-412.458] (-412.729) (-413.442) * (-415.887) (-415.199) [-414.508] (-414.317) -- 0:00:15
728000 -- (-412.508) (-412.144) [-414.213] (-414.612) * (-412.979) (-413.158) (-414.283) [-419.432] -- 0:00:15
728500 -- (-415.884) (-415.663) (-417.289) [-412.947] * (-412.727) (-414.363) (-417.666) [-413.049] -- 0:00:15
729000 -- (-413.023) (-412.695) (-412.805) [-416.614] * (-415.714) (-413.831) (-415.732) [-413.085] -- 0:00:15
729500 -- (-414.521) (-413.289) [-413.171] (-414.970) * (-414.505) (-416.099) [-415.385] (-412.665) -- 0:00:15
730000 -- (-414.447) (-415.782) (-414.533) [-413.436] * (-415.768) (-415.116) (-412.863) [-415.372] -- 0:00:15
Average standard deviation of split frequencies: 0.009678
730500 -- (-413.962) [-414.148] (-412.205) (-415.047) * [-414.238] (-418.485) (-412.466) (-416.388) -- 0:00:15
731000 -- (-412.113) (-416.847) (-412.718) [-413.433] * (-413.483) [-411.996] (-413.178) (-414.079) -- 0:00:15
731500 -- (-413.633) (-414.557) [-414.026] (-413.547) * (-412.605) [-414.275] (-417.508) (-415.463) -- 0:00:15
732000 -- (-413.811) [-412.529] (-417.096) (-413.521) * [-413.332] (-413.762) (-416.389) (-414.613) -- 0:00:15
732500 -- [-416.275] (-412.283) (-413.525) (-415.294) * (-413.258) (-413.136) (-414.560) [-414.238] -- 0:00:15
733000 -- (-414.532) (-412.701) (-415.861) [-415.487] * (-413.685) (-413.788) [-413.555] (-413.468) -- 0:00:15
733500 -- (-415.846) (-413.146) (-415.015) [-412.563] * (-412.923) (-413.817) (-413.484) [-413.799] -- 0:00:15
734000 -- (-414.294) (-413.059) (-414.887) [-417.437] * [-412.983] (-412.851) (-413.624) (-414.328) -- 0:00:15
734500 -- (-415.148) [-412.426] (-414.354) (-412.321) * (-412.757) (-420.675) [-414.266] (-413.547) -- 0:00:15
735000 -- [-415.937] (-413.763) (-413.995) (-412.419) * (-413.636) (-414.494) [-413.473] (-415.451) -- 0:00:15
Average standard deviation of split frequencies: 0.009207
735500 -- (-412.649) [-413.322] (-412.160) (-415.617) * (-421.164) [-412.965] (-413.521) (-412.894) -- 0:00:15
736000 -- (-417.018) [-417.042] (-414.094) (-415.730) * [-416.409] (-415.438) (-413.417) (-414.356) -- 0:00:15
736500 -- (-413.650) (-417.972) [-412.680] (-414.265) * (-415.368) [-414.219] (-413.321) (-412.986) -- 0:00:15
737000 -- (-412.591) (-413.867) (-414.863) [-414.856] * [-412.820] (-415.869) (-413.782) (-417.356) -- 0:00:15
737500 -- (-415.228) (-413.458) [-413.789] (-413.813) * (-417.831) [-415.479] (-414.558) (-414.999) -- 0:00:15
738000 -- (-415.245) (-413.751) (-417.658) [-417.791] * (-417.700) [-413.472] (-411.802) (-416.843) -- 0:00:15
738500 -- (-414.630) (-414.839) (-413.672) [-412.403] * (-416.127) (-412.341) [-414.602] (-414.043) -- 0:00:15
739000 -- (-413.420) (-415.768) [-413.691] (-413.095) * (-412.848) [-414.433] (-418.638) (-416.447) -- 0:00:15
739500 -- (-413.404) (-412.730) [-413.365] (-414.073) * (-413.211) (-414.730) [-416.179] (-414.736) -- 0:00:15
740000 -- (-413.484) (-414.279) [-416.686] (-415.088) * (-413.475) (-417.817) (-414.539) [-413.320] -- 0:00:15
Average standard deviation of split frequencies: 0.009348
740500 -- (-413.506) [-412.268] (-413.048) (-413.316) * (-413.551) (-413.011) (-416.564) [-412.419] -- 0:00:15
741000 -- (-412.133) (-412.855) [-412.389] (-412.375) * (-415.465) [-413.180] (-417.183) (-413.102) -- 0:00:15
741500 -- (-412.595) (-413.822) [-412.405] (-417.733) * (-416.443) [-413.754] (-413.493) (-412.216) -- 0:00:14
742000 -- (-412.697) (-412.753) (-413.711) [-415.597] * (-416.893) (-415.523) (-412.316) [-411.990] -- 0:00:14
742500 -- (-413.537) (-416.212) [-415.121] (-414.855) * [-414.663] (-415.701) (-413.868) (-413.255) -- 0:00:14
743000 -- (-413.420) (-417.466) [-413.396] (-413.803) * (-413.448) (-416.894) (-413.515) [-414.545] -- 0:00:14
743500 -- (-414.628) (-412.672) (-411.990) [-413.803] * (-413.701) (-413.692) [-413.023] (-413.701) -- 0:00:14
744000 -- (-412.579) (-412.395) (-414.939) [-414.601] * (-415.151) [-413.528] (-411.740) (-416.320) -- 0:00:14
744500 -- (-411.980) [-413.682] (-415.025) (-415.866) * [-416.001] (-413.609) (-411.768) (-415.680) -- 0:00:14
745000 -- (-418.124) (-417.165) (-414.748) [-416.232] * (-418.907) [-412.485] (-412.626) (-416.685) -- 0:00:14
Average standard deviation of split frequencies: 0.010032
745500 -- [-415.352] (-413.942) (-413.127) (-415.263) * [-412.475] (-412.317) (-414.235) (-417.159) -- 0:00:14
746000 -- (-413.909) (-415.121) [-412.394] (-414.385) * (-412.531) [-415.759] (-412.075) (-414.958) -- 0:00:14
746500 -- (-413.110) (-415.392) (-414.569) [-414.543] * [-414.181] (-413.841) (-413.015) (-413.844) -- 0:00:14
747000 -- (-414.493) [-417.154] (-413.931) (-411.960) * (-416.129) (-413.530) [-412.800] (-413.583) -- 0:00:14
747500 -- [-413.098] (-412.080) (-415.586) (-411.563) * (-416.851) [-413.427] (-414.775) (-413.519) -- 0:00:14
748000 -- (-413.536) [-416.619] (-413.793) (-412.718) * [-413.647] (-413.418) (-413.836) (-419.794) -- 0:00:14
748500 -- [-412.514] (-413.371) (-413.513) (-415.349) * (-415.882) (-415.839) [-416.635] (-414.175) -- 0:00:14
749000 -- (-412.512) (-414.421) (-419.503) [-414.751] * (-416.526) (-418.489) (-414.733) [-418.506] -- 0:00:14
749500 -- (-413.854) (-414.829) [-412.740] (-417.594) * (-412.066) [-415.091] (-416.535) (-412.947) -- 0:00:14
750000 -- (-417.315) [-413.531] (-412.702) (-415.145) * (-414.620) [-414.556] (-414.683) (-412.950) -- 0:00:14
Average standard deviation of split frequencies: 0.010440
750500 -- (-412.581) (-412.996) (-412.586) [-415.202] * (-415.596) (-417.016) (-413.700) [-411.815] -- 0:00:14
751000 -- (-413.796) (-417.076) (-414.415) [-413.611] * (-412.730) [-414.521] (-416.963) (-416.115) -- 0:00:14
751500 -- (-417.023) [-412.151] (-412.197) (-412.573) * (-415.346) (-415.678) [-417.050] (-419.287) -- 0:00:14
752000 -- (-412.624) (-412.729) (-412.362) [-413.831] * (-414.502) (-414.153) [-423.157] (-419.993) -- 0:00:14
752500 -- [-414.763] (-414.822) (-412.374) (-412.315) * (-415.875) [-412.134] (-412.986) (-416.538) -- 0:00:14
753000 -- [-411.906] (-415.390) (-411.930) (-413.891) * (-413.637) (-413.175) (-412.902) [-414.235] -- 0:00:14
753500 -- (-412.270) (-415.176) [-412.541] (-413.657) * (-415.549) (-413.096) [-413.219] (-413.163) -- 0:00:14
754000 -- (-412.564) [-413.493] (-412.112) (-414.574) * (-413.639) (-413.147) [-414.118] (-411.782) -- 0:00:14
754500 -- [-416.421] (-416.549) (-412.571) (-412.997) * [-412.560] (-415.400) (-412.905) (-414.561) -- 0:00:14
755000 -- (-415.505) (-414.081) [-415.404] (-413.357) * (-412.624) (-414.928) (-412.592) [-413.367] -- 0:00:14
Average standard deviation of split frequencies: 0.010873
755500 -- (-415.397) (-414.607) (-414.981) [-412.303] * [-412.291] (-412.910) (-418.644) (-412.812) -- 0:00:14
756000 -- (-413.640) [-414.990] (-413.124) (-415.197) * (-412.976) (-414.675) [-414.145] (-414.830) -- 0:00:14
756500 -- [-413.127] (-414.583) (-412.488) (-415.398) * (-414.713) [-414.619] (-412.203) (-413.275) -- 0:00:14
757000 -- (-418.040) [-415.139] (-412.480) (-413.736) * [-415.600] (-416.770) (-415.066) (-414.839) -- 0:00:14
757500 -- [-415.832] (-413.683) (-414.534) (-413.673) * [-413.498] (-414.119) (-413.934) (-413.583) -- 0:00:14
758000 -- (-411.907) [-411.734] (-416.261) (-412.364) * (-415.822) (-415.821) [-415.105] (-413.842) -- 0:00:14
758500 -- (-412.076) [-415.699] (-415.479) (-414.424) * [-416.236] (-416.357) (-420.972) (-417.264) -- 0:00:14
759000 -- (-412.489) (-413.573) [-413.946] (-413.255) * [-414.049] (-416.526) (-415.762) (-416.357) -- 0:00:13
759500 -- [-418.593] (-412.075) (-414.183) (-415.415) * [-413.756] (-413.944) (-417.994) (-414.302) -- 0:00:13
760000 -- (-413.732) (-414.901) (-414.148) [-416.765] * (-412.574) (-412.892) [-414.495] (-416.052) -- 0:00:13
Average standard deviation of split frequencies: 0.010497
760500 -- (-417.190) [-413.681] (-413.261) (-412.589) * [-417.881] (-411.872) (-414.541) (-416.028) -- 0:00:13
761000 -- (-417.114) (-415.483) (-416.166) [-414.500] * (-415.325) (-413.192) (-414.287) [-412.553] -- 0:00:13
761500 -- (-413.363) (-414.702) [-416.641] (-420.996) * (-411.994) [-412.003] (-417.660) (-414.168) -- 0:00:13
762000 -- (-415.197) (-413.409) [-412.098] (-415.313) * [-413.670] (-414.894) (-414.910) (-417.845) -- 0:00:13
762500 -- (-419.058) [-413.062] (-413.168) (-412.572) * (-411.897) [-412.209] (-413.082) (-417.421) -- 0:00:13
763000 -- [-416.830] (-414.228) (-413.982) (-414.541) * [-412.553] (-412.296) (-412.572) (-412.896) -- 0:00:13
763500 -- (-414.276) (-412.255) (-412.637) [-413.491] * (-413.668) (-413.837) [-413.722] (-412.455) -- 0:00:13
764000 -- (-414.594) (-412.926) [-416.693] (-414.534) * [-416.055] (-417.319) (-415.051) (-414.049) -- 0:00:13
764500 -- (-414.100) [-413.400] (-416.089) (-414.776) * [-414.654] (-413.716) (-414.891) (-412.391) -- 0:00:13
765000 -- [-412.940] (-415.561) (-414.961) (-413.383) * (-411.890) (-413.998) [-414.639] (-415.529) -- 0:00:13
Average standard deviation of split frequencies: 0.010808
765500 -- (-415.055) (-415.454) (-422.385) [-413.320] * (-414.269) (-415.987) [-415.610] (-413.646) -- 0:00:13
766000 -- (-412.767) (-417.115) [-416.080] (-414.431) * (-413.964) (-415.912) [-413.152] (-412.882) -- 0:00:13
766500 -- (-413.703) (-413.073) [-414.617] (-416.628) * [-414.446] (-413.572) (-415.537) (-416.364) -- 0:00:13
767000 -- (-413.900) (-414.227) [-416.479] (-413.108) * (-413.860) (-419.781) [-412.583] (-415.546) -- 0:00:13
767500 -- (-413.178) (-414.914) [-412.959] (-414.706) * (-412.191) (-415.480) (-416.510) [-412.012] -- 0:00:13
768000 -- (-413.782) (-413.174) (-414.452) [-414.559] * (-418.423) [-413.924] (-413.646) (-414.165) -- 0:00:13
768500 -- [-415.327] (-415.369) (-415.003) (-414.261) * [-414.805] (-412.788) (-412.780) (-412.197) -- 0:00:13
769000 -- (-415.163) (-413.348) (-413.763) [-413.824] * (-412.112) (-412.770) [-412.334] (-415.109) -- 0:00:13
769500 -- [-413.179] (-413.485) (-415.365) (-413.137) * (-412.070) (-414.287) [-412.126] (-413.250) -- 0:00:13
770000 -- (-414.152) [-414.627] (-413.292) (-413.111) * (-412.361) (-412.625) [-415.434] (-412.500) -- 0:00:13
Average standard deviation of split frequencies: 0.011010
770500 -- [-414.725] (-412.633) (-412.351) (-419.351) * (-413.431) (-412.325) (-412.800) [-413.511] -- 0:00:13
771000 -- (-412.140) (-414.082) [-412.779] (-421.414) * (-414.490) (-417.191) [-412.545] (-413.720) -- 0:00:13
771500 -- [-413.051] (-412.337) (-413.660) (-413.299) * (-412.820) (-418.223) (-412.559) [-413.029] -- 0:00:13
772000 -- (-412.337) (-412.862) (-415.762) [-412.859] * [-415.993] (-413.860) (-412.945) (-413.769) -- 0:00:13
772500 -- [-413.276] (-413.395) (-419.439) (-415.292) * (-416.286) (-412.928) [-413.233] (-414.226) -- 0:00:13
773000 -- [-411.948] (-412.625) (-414.899) (-413.456) * (-412.783) [-414.436] (-412.518) (-412.681) -- 0:00:13
773500 -- [-412.634] (-415.276) (-415.859) (-417.259) * (-412.428) (-413.037) (-414.392) [-415.236] -- 0:00:13
774000 -- (-415.707) (-416.686) [-412.870] (-414.493) * (-413.229) (-412.215) [-412.287] (-415.440) -- 0:00:13
774500 -- (-412.959) (-412.993) [-413.467] (-412.579) * [-413.216] (-413.453) (-413.592) (-415.400) -- 0:00:13
775000 -- (-412.018) [-420.974] (-413.096) (-411.801) * (-418.018) [-415.436] (-413.113) (-413.718) -- 0:00:13
Average standard deviation of split frequencies: 0.010517
775500 -- [-412.186] (-414.950) (-412.728) (-413.824) * (-412.484) [-415.820] (-413.108) (-415.449) -- 0:00:13
776000 -- [-413.672] (-413.429) (-413.018) (-415.088) * [-413.519] (-413.810) (-413.746) (-414.289) -- 0:00:12
776500 -- [-411.670] (-412.791) (-413.531) (-417.726) * (-412.940) (-415.840) (-418.322) [-417.665] -- 0:00:12
777000 -- [-412.525] (-414.509) (-414.676) (-414.689) * (-415.282) (-413.217) (-416.740) [-412.554] -- 0:00:12
777500 -- (-412.396) [-413.086] (-411.933) (-413.128) * (-415.573) [-412.717] (-413.960) (-413.994) -- 0:00:12
778000 -- (-413.735) (-413.564) (-416.866) [-412.525] * (-412.621) (-413.469) (-414.807) [-412.832] -- 0:00:12
778500 -- (-413.988) (-412.426) (-416.987) [-415.930] * (-417.016) [-413.754] (-416.232) (-413.248) -- 0:00:12
779000 -- (-412.834) [-411.734] (-413.517) (-412.765) * (-413.663) (-416.240) (-413.502) [-414.502] -- 0:00:12
779500 -- (-418.181) (-413.087) [-413.009] (-415.308) * (-412.654) (-413.786) (-416.631) [-412.338] -- 0:00:12
780000 -- (-414.424) (-414.312) [-412.042] (-413.296) * [-416.007] (-414.872) (-412.998) (-417.932) -- 0:00:12
Average standard deviation of split frequencies: 0.010416
780500 -- [-413.712] (-413.177) (-413.097) (-412.394) * [-413.805] (-412.795) (-415.069) (-413.805) -- 0:00:12
781000 -- [-415.523] (-413.456) (-413.279) (-414.318) * (-418.442) (-414.809) (-413.711) [-412.364] -- 0:00:12
781500 -- (-416.347) [-413.759] (-412.901) (-413.319) * (-413.887) (-412.778) [-415.377] (-413.235) -- 0:00:12
782000 -- (-415.459) (-413.641) [-414.625] (-413.501) * (-413.246) (-412.973) [-414.895] (-412.897) -- 0:00:12
782500 -- (-415.620) (-414.181) [-412.795] (-412.271) * (-413.272) (-414.017) (-413.804) [-414.663] -- 0:00:12
783000 -- [-413.242] (-414.141) (-414.795) (-412.323) * [-413.400] (-415.256) (-416.383) (-416.125) -- 0:00:12
783500 -- (-415.396) [-413.375] (-416.064) (-418.333) * [-416.806] (-413.385) (-416.524) (-414.246) -- 0:00:12
784000 -- (-413.993) (-416.818) [-415.087] (-415.054) * [-415.915] (-420.041) (-414.628) (-412.963) -- 0:00:12
784500 -- (-412.574) [-415.600] (-413.630) (-413.343) * (-413.792) [-415.022] (-415.599) (-414.243) -- 0:00:12
785000 -- (-418.355) (-415.533) [-413.385] (-413.631) * (-417.420) [-413.134] (-413.387) (-414.167) -- 0:00:12
Average standard deviation of split frequencies: 0.010046
785500 -- (-418.762) (-413.137) [-414.070] (-413.533) * [-415.521] (-414.781) (-416.558) (-415.136) -- 0:00:12
786000 -- (-413.919) (-416.256) (-414.783) [-413.157] * (-415.657) [-412.872] (-412.473) (-415.559) -- 0:00:12
786500 -- [-413.735] (-413.444) (-413.477) (-413.628) * (-416.636) (-411.910) (-412.854) [-414.345] -- 0:00:12
787000 -- (-414.700) (-414.260) (-413.312) [-412.334] * [-415.436] (-411.910) (-412.773) (-415.216) -- 0:00:12
787500 -- [-416.351] (-413.279) (-413.635) (-417.573) * (-415.467) [-413.014] (-414.394) (-413.462) -- 0:00:12
788000 -- (-414.304) (-414.317) [-415.221] (-416.933) * (-415.775) [-413.906] (-412.298) (-413.345) -- 0:00:12
788500 -- [-413.134] (-413.057) (-413.035) (-412.185) * (-417.537) (-416.962) (-413.819) [-413.598] -- 0:00:12
789000 -- (-412.619) (-412.416) [-413.418] (-412.685) * (-412.627) (-413.508) (-418.105) [-412.449] -- 0:00:12
789500 -- (-412.593) (-414.118) (-416.021) [-411.781] * (-416.065) (-413.836) [-413.859] (-413.321) -- 0:00:12
790000 -- (-415.974) (-413.206) (-412.420) [-413.250] * [-413.005] (-411.815) (-415.112) (-412.479) -- 0:00:12
Average standard deviation of split frequencies: 0.009651
790500 -- [-413.196] (-414.362) (-415.480) (-415.876) * [-416.228] (-413.690) (-413.867) (-412.152) -- 0:00:12
791000 -- (-415.871) (-412.280) [-415.940] (-416.108) * [-412.975] (-413.946) (-415.046) (-417.027) -- 0:00:12
791500 -- (-414.032) (-415.495) (-415.020) [-412.370] * [-417.396] (-413.259) (-413.944) (-417.009) -- 0:00:12
792000 -- [-414.158] (-412.193) (-417.081) (-418.117) * (-414.608) (-412.808) [-413.170] (-413.297) -- 0:00:12
792500 -- (-413.902) [-415.132] (-417.547) (-414.160) * (-413.807) (-417.098) [-412.635] (-411.965) -- 0:00:12
793000 -- [-415.764] (-412.556) (-411.780) (-413.265) * (-413.125) [-412.501] (-412.756) (-414.514) -- 0:00:12
793500 -- [-412.376] (-415.028) (-413.981) (-412.793) * (-413.715) (-414.359) [-413.274] (-412.634) -- 0:00:11
794000 -- (-413.185) (-413.727) (-414.069) [-412.264] * (-413.766) (-415.881) (-415.053) [-412.361] -- 0:00:11
794500 -- [-412.688] (-413.568) (-413.765) (-413.809) * [-411.735] (-415.045) (-413.069) (-413.297) -- 0:00:11
795000 -- (-414.177) [-413.642] (-412.449) (-412.434) * (-412.421) [-415.136] (-413.441) (-413.670) -- 0:00:11
Average standard deviation of split frequencies: 0.009809
795500 -- [-413.963] (-414.705) (-414.186) (-413.952) * [-412.547] (-414.057) (-412.164) (-415.803) -- 0:00:11
796000 -- [-416.633] (-414.003) (-411.764) (-421.760) * (-412.309) (-415.322) [-412.340] (-416.085) -- 0:00:11
796500 -- (-413.798) [-412.837] (-412.230) (-415.476) * (-414.234) (-414.847) [-414.162] (-415.386) -- 0:00:11
797000 -- [-414.810] (-413.149) (-412.365) (-415.092) * [-416.129] (-413.047) (-414.281) (-413.494) -- 0:00:11
797500 -- (-413.389) [-415.663] (-414.029) (-414.022) * (-412.358) [-412.254] (-413.526) (-417.399) -- 0:00:11
798000 -- (-412.760) (-415.187) (-415.708) [-413.627] * [-412.308] (-415.969) (-413.221) (-416.267) -- 0:00:11
798500 -- (-412.737) [-413.189] (-413.625) (-415.778) * (-412.544) (-412.757) (-415.828) [-417.448] -- 0:00:11
799000 -- [-412.569] (-422.370) (-413.128) (-417.594) * (-413.824) [-412.722] (-413.688) (-416.063) -- 0:00:11
799500 -- (-413.792) [-414.282] (-412.542) (-414.929) * (-420.633) [-412.526] (-412.450) (-414.647) -- 0:00:11
800000 -- (-414.035) [-415.248] (-413.053) (-413.177) * (-416.220) (-417.567) [-415.059] (-414.613) -- 0:00:11
Average standard deviation of split frequencies: 0.009641
800500 -- (-414.020) [-413.549] (-412.894) (-412.421) * (-413.696) [-413.302] (-418.180) (-420.171) -- 0:00:11
801000 -- [-413.588] (-415.107) (-411.614) (-412.645) * (-413.435) (-416.419) [-412.218] (-415.504) -- 0:00:11
801500 -- (-413.197) (-415.305) [-412.173] (-413.002) * [-412.186] (-413.651) (-413.793) (-414.199) -- 0:00:11
802000 -- (-412.125) (-416.161) [-412.087] (-413.317) * (-411.775) [-415.835] (-414.478) (-413.473) -- 0:00:11
802500 -- [-411.583] (-415.298) (-413.829) (-413.123) * [-412.571] (-413.378) (-412.720) (-413.016) -- 0:00:11
803000 -- [-412.564] (-416.296) (-414.732) (-415.895) * (-415.265) [-412.575] (-415.481) (-418.888) -- 0:00:11
803500 -- (-414.986) (-412.535) (-416.447) [-412.867] * [-415.201] (-412.907) (-414.542) (-415.020) -- 0:00:11
804000 -- (-417.582) (-413.114) [-415.073] (-414.511) * (-413.534) [-413.452] (-412.992) (-414.122) -- 0:00:11
804500 -- (-413.189) (-412.449) (-413.182) [-412.646] * [-413.291] (-414.331) (-417.733) (-415.052) -- 0:00:11
805000 -- [-416.895] (-414.984) (-416.628) (-413.192) * (-413.399) (-416.562) [-414.478] (-418.122) -- 0:00:11
Average standard deviation of split frequencies: 0.009504
805500 -- [-421.647] (-412.304) (-414.573) (-412.861) * (-414.403) [-413.362] (-414.446) (-418.446) -- 0:00:11
806000 -- [-413.607] (-415.013) (-414.401) (-413.636) * (-415.404) (-414.530) (-416.393) [-415.129] -- 0:00:11
806500 -- (-412.616) (-412.209) [-414.252] (-415.045) * [-413.280] (-413.691) (-413.918) (-413.287) -- 0:00:11
807000 -- (-412.525) (-412.933) (-415.888) [-412.527] * (-411.920) (-415.891) (-415.018) [-412.929] -- 0:00:11
807500 -- [-414.780] (-414.711) (-412.832) (-412.530) * (-413.551) [-414.853] (-414.085) (-412.873) -- 0:00:11
808000 -- (-414.284) [-415.396] (-415.203) (-418.901) * (-413.920) (-413.442) [-414.638] (-414.619) -- 0:00:11
808500 -- (-418.485) [-412.895] (-414.358) (-413.770) * (-412.627) (-413.935) [-412.794] (-413.917) -- 0:00:11
809000 -- (-419.785) (-417.029) (-415.275) [-414.187] * (-414.488) [-415.176] (-419.911) (-414.080) -- 0:00:11
809500 -- (-417.744) (-413.976) (-412.025) [-413.372] * (-416.138) (-415.945) [-414.736] (-412.617) -- 0:00:11
810000 -- (-417.426) (-414.877) (-411.717) [-417.647] * (-415.469) (-416.981) [-412.767] (-413.385) -- 0:00:11
Average standard deviation of split frequencies: 0.009847
810500 -- (-414.531) [-412.334] (-412.312) (-416.369) * (-416.077) (-413.986) [-413.130] (-413.677) -- 0:00:10
811000 -- [-413.165] (-414.273) (-415.709) (-412.020) * [-412.804] (-413.457) (-413.990) (-415.076) -- 0:00:10
811500 -- (-419.039) (-413.306) [-417.996] (-413.564) * (-412.317) (-420.657) [-412.929] (-412.600) -- 0:00:10
812000 -- (-414.675) (-413.692) [-416.375] (-416.109) * (-413.121) (-414.697) (-412.199) [-412.031] -- 0:00:10
812500 -- (-414.218) (-423.312) [-414.694] (-412.641) * (-413.051) (-415.518) [-413.886] (-414.733) -- 0:00:10
813000 -- (-416.356) (-416.278) (-413.695) [-414.028] * (-413.346) (-412.258) (-413.520) [-414.114] -- 0:00:10
813500 -- (-412.983) (-414.780) (-417.562) [-413.664] * (-415.582) [-414.499] (-413.744) (-412.744) -- 0:00:10
814000 -- (-414.014) [-415.179] (-413.691) (-413.239) * (-416.853) (-413.074) [-414.609] (-413.883) -- 0:00:10
814500 -- (-413.587) (-415.572) [-413.450] (-416.028) * (-420.309) [-414.064] (-412.663) (-413.933) -- 0:00:10
815000 -- (-414.418) (-416.746) [-412.786] (-418.366) * (-412.649) [-413.101] (-412.224) (-414.787) -- 0:00:10
Average standard deviation of split frequencies: 0.009859
815500 -- (-415.035) [-415.034] (-412.786) (-414.541) * (-414.106) [-413.035] (-413.548) (-415.668) -- 0:00:10
816000 -- (-413.632) (-412.093) [-412.014] (-416.729) * (-416.675) [-413.515] (-413.294) (-412.989) -- 0:00:10
816500 -- (-412.937) [-412.567] (-414.470) (-416.888) * [-415.731] (-414.911) (-413.037) (-416.939) -- 0:00:10
817000 -- (-417.266) (-414.903) (-416.533) [-412.036] * (-414.113) (-414.641) (-414.106) [-415.693] -- 0:00:10
817500 -- (-420.950) [-414.711] (-421.759) (-411.554) * [-415.165] (-414.613) (-412.910) (-413.649) -- 0:00:10
818000 -- (-415.875) (-413.499) (-419.002) [-413.768] * (-417.739) [-412.714] (-412.688) (-415.851) -- 0:00:10
818500 -- [-417.852] (-415.240) (-414.617) (-413.167) * (-411.889) (-413.219) [-414.415] (-415.589) -- 0:00:10
819000 -- (-415.030) [-411.950] (-414.165) (-415.423) * (-412.107) (-414.688) (-412.672) [-413.070] -- 0:00:10
819500 -- [-416.110] (-419.698) (-414.549) (-416.082) * [-413.155] (-417.577) (-414.937) (-412.961) -- 0:00:10
820000 -- (-416.286) (-414.360) (-413.907) [-413.703] * [-413.000] (-421.200) (-412.544) (-417.696) -- 0:00:10
Average standard deviation of split frequencies: 0.009382
820500 -- (-416.893) (-413.297) (-412.914) [-413.182] * [-413.061] (-415.576) (-415.418) (-413.886) -- 0:00:10
821000 -- (-414.521) (-413.270) [-414.865] (-412.321) * (-411.633) (-415.319) [-413.303] (-414.693) -- 0:00:10
821500 -- (-415.894) (-414.041) (-412.985) [-415.926] * (-413.998) [-411.868] (-412.739) (-414.433) -- 0:00:10
822000 -- [-411.643] (-418.944) (-416.078) (-415.169) * (-417.666) (-412.845) (-415.391) [-414.397] -- 0:00:10
822500 -- [-412.391] (-414.420) (-414.148) (-414.014) * (-412.519) (-413.391) (-412.301) [-413.710] -- 0:00:10
823000 -- [-412.672] (-413.813) (-412.686) (-414.006) * (-413.231) (-414.608) [-412.926] (-416.472) -- 0:00:10
823500 -- (-413.165) [-418.417] (-414.728) (-414.202) * (-416.890) (-415.484) [-413.069] (-414.121) -- 0:00:10
824000 -- (-412.075) (-414.382) (-412.416) [-412.188] * (-414.662) (-415.969) (-414.712) [-413.208] -- 0:00:10
824500 -- (-417.759) (-413.631) (-414.474) [-412.106] * (-414.831) (-416.629) (-412.984) [-414.639] -- 0:00:10
825000 -- (-416.420) [-416.079] (-413.063) (-412.010) * (-413.684) [-415.378] (-413.645) (-414.176) -- 0:00:10
Average standard deviation of split frequencies: 0.009892
825500 -- [-415.579] (-415.377) (-412.686) (-412.374) * (-416.855) [-413.870] (-414.582) (-412.197) -- 0:00:10
826000 -- [-419.627] (-417.144) (-415.118) (-415.217) * (-414.639) [-413.778] (-416.210) (-412.259) -- 0:00:10
826500 -- [-415.171] (-416.735) (-415.003) (-414.858) * (-416.459) [-413.424] (-414.967) (-412.860) -- 0:00:10
827000 -- (-414.212) (-412.166) [-413.855] (-412.149) * (-416.006) (-413.964) (-415.771) [-412.480] -- 0:00:10
827500 -- (-419.458) (-413.772) [-413.179] (-412.439) * [-413.767] (-413.058) (-412.063) (-416.463) -- 0:00:10
828000 -- (-411.899) (-412.477) [-412.168] (-414.038) * (-413.404) (-413.091) (-415.705) [-413.648] -- 0:00:09
828500 -- (-415.537) (-413.272) (-413.029) [-412.700] * (-415.562) [-414.248] (-413.496) (-412.945) -- 0:00:09
829000 -- [-415.911] (-413.331) (-413.208) (-415.458) * [-414.085] (-417.008) (-413.953) (-412.765) -- 0:00:09
829500 -- [-416.378] (-414.695) (-414.300) (-415.100) * (-412.385) (-416.719) [-417.654] (-416.667) -- 0:00:09
830000 -- (-414.553) (-416.029) [-412.784] (-413.838) * (-414.149) [-413.186] (-420.644) (-415.916) -- 0:00:09
Average standard deviation of split frequencies: 0.010442
830500 -- (-413.162) [-415.313] (-414.538) (-414.883) * (-419.347) (-413.351) (-413.370) [-413.820] -- 0:00:09
831000 -- (-413.414) [-412.805] (-411.919) (-413.573) * (-411.931) [-414.714] (-413.876) (-413.538) -- 0:00:09
831500 -- [-413.036] (-413.041) (-412.706) (-414.455) * (-412.114) (-414.410) [-414.916] (-413.369) -- 0:00:09
832000 -- [-412.539] (-416.103) (-413.329) (-413.528) * (-414.622) (-412.951) (-414.143) [-414.443] -- 0:00:09
832500 -- (-412.778) (-414.496) [-413.445] (-414.192) * (-414.574) (-419.989) (-414.232) [-412.438] -- 0:00:09
833000 -- (-412.566) [-412.614] (-412.754) (-414.045) * (-421.858) (-414.648) (-415.547) [-413.660] -- 0:00:09
833500 -- (-413.270) (-412.277) (-413.605) [-414.313] * [-415.939] (-417.673) (-414.743) (-413.473) -- 0:00:09
834000 -- (-413.197) (-420.784) [-411.900] (-412.592) * (-415.735) (-416.523) [-414.220] (-413.789) -- 0:00:09
834500 -- (-414.635) (-416.484) [-414.477] (-411.887) * (-414.513) [-413.317] (-414.046) (-413.700) -- 0:00:09
835000 -- (-420.153) [-413.772] (-414.045) (-412.099) * (-414.750) [-415.647] (-416.801) (-412.740) -- 0:00:09
Average standard deviation of split frequencies: 0.010601
835500 -- (-412.608) (-414.088) [-413.003] (-413.532) * (-413.301) [-415.258] (-414.413) (-412.284) -- 0:00:09
836000 -- (-413.466) [-414.362] (-414.115) (-414.254) * (-413.564) (-413.287) (-412.965) [-411.955] -- 0:00:09
836500 -- (-415.551) [-417.876] (-412.876) (-412.534) * (-414.961) (-414.665) [-417.074] (-413.313) -- 0:00:09
837000 -- (-412.770) (-414.871) [-414.404] (-411.998) * (-413.171) (-417.810) (-414.602) [-413.776] -- 0:00:09
837500 -- (-414.483) [-412.901] (-415.480) (-412.323) * (-412.111) (-413.441) (-415.469) [-412.781] -- 0:00:09
838000 -- (-415.725) (-412.518) [-416.203] (-412.982) * [-412.627] (-413.386) (-415.722) (-420.427) -- 0:00:09
838500 -- (-415.822) (-412.667) [-415.037] (-412.673) * (-414.264) [-416.804] (-414.355) (-417.552) -- 0:00:09
839000 -- (-412.274) (-412.862) (-416.138) [-412.524] * (-417.718) [-413.561] (-412.987) (-414.207) -- 0:00:09
839500 -- (-412.954) [-412.521] (-413.720) (-414.003) * (-416.760) (-415.402) (-412.078) [-416.837] -- 0:00:09
840000 -- [-412.634] (-412.560) (-415.736) (-411.959) * (-415.512) (-416.659) [-413.094] (-416.498) -- 0:00:09
Average standard deviation of split frequencies: 0.010542
840500 -- (-414.222) [-414.729] (-414.648) (-413.026) * (-413.782) [-413.434] (-412.037) (-414.348) -- 0:00:09
841000 -- (-414.412) (-415.490) (-413.936) [-414.285] * (-416.357) (-413.887) [-413.095] (-416.324) -- 0:00:09
841500 -- (-413.151) [-416.355] (-415.627) (-416.685) * [-412.666] (-416.317) (-414.803) (-415.155) -- 0:00:09
842000 -- (-415.628) [-413.974] (-413.294) (-412.430) * [-412.006] (-414.139) (-413.380) (-413.320) -- 0:00:09
842500 -- (-413.920) [-417.385] (-414.806) (-413.378) * (-412.795) (-411.915) [-415.061] (-415.159) -- 0:00:09
843000 -- (-414.532) (-412.877) (-416.714) [-413.752] * (-414.698) (-413.302) (-421.646) [-417.273] -- 0:00:09
843500 -- (-414.188) (-413.933) (-418.175) [-414.133] * (-415.938) [-413.388] (-420.895) (-416.002) -- 0:00:09
844000 -- [-414.614] (-414.854) (-417.767) (-415.020) * [-413.135] (-413.296) (-414.530) (-411.876) -- 0:00:09
844500 -- (-415.016) (-416.166) (-412.019) [-416.269] * (-414.072) (-412.132) [-412.826] (-413.243) -- 0:00:09
845000 -- (-417.061) [-412.553] (-417.188) (-415.551) * [-414.203] (-412.553) (-412.723) (-413.053) -- 0:00:08
Average standard deviation of split frequencies: 0.010884
845500 -- (-416.534) [-413.127] (-416.614) (-412.302) * (-417.655) (-415.476) (-412.426) [-412.884] -- 0:00:08
846000 -- (-412.824) (-412.696) (-416.443) [-413.255] * (-415.412) (-415.702) [-413.829] (-412.062) -- 0:00:08
846500 -- [-413.197] (-416.960) (-417.855) (-413.035) * (-420.523) [-414.459] (-414.537) (-412.656) -- 0:00:08
847000 -- [-417.019] (-413.292) (-414.213) (-414.588) * [-413.043] (-415.926) (-413.425) (-416.942) -- 0:00:08
847500 -- (-417.090) (-413.047) (-414.828) [-413.916] * [-412.709] (-414.301) (-414.317) (-417.973) -- 0:00:08
848000 -- (-412.228) (-416.019) [-414.305] (-415.873) * (-413.777) [-412.522] (-412.697) (-421.296) -- 0:00:08
848500 -- (-420.356) (-413.773) (-413.834) [-413.410] * [-413.974] (-412.989) (-413.910) (-413.903) -- 0:00:08
849000 -- (-413.791) (-414.044) (-412.910) [-414.247] * (-415.485) [-412.302] (-416.230) (-413.167) -- 0:00:08
849500 -- (-415.753) (-412.838) [-416.209] (-412.145) * (-412.431) (-413.369) (-413.053) [-413.345] -- 0:00:08
850000 -- (-412.867) (-413.636) (-414.947) [-413.394] * [-412.546] (-412.065) (-416.757) (-412.853) -- 0:00:08
Average standard deviation of split frequencies: 0.011194
850500 -- (-412.683) (-413.977) [-414.950] (-413.569) * (-414.003) [-417.879] (-414.519) (-412.348) -- 0:00:08
851000 -- (-412.942) [-413.124] (-414.569) (-412.636) * [-413.573] (-415.525) (-419.066) (-412.881) -- 0:00:08
851500 -- [-415.545] (-413.461) (-412.296) (-414.322) * (-411.724) (-415.988) (-416.802) [-414.286] -- 0:00:08
852000 -- (-417.192) (-413.276) [-412.094] (-415.106) * [-413.679] (-415.084) (-416.302) (-416.806) -- 0:00:08
852500 -- (-415.131) (-412.958) (-418.858) [-414.065] * (-414.999) [-414.129] (-412.742) (-412.638) -- 0:00:08
853000 -- (-415.169) (-414.580) (-415.507) [-412.570] * (-415.001) [-416.364] (-418.489) (-411.701) -- 0:00:08
853500 -- (-411.984) [-413.498] (-414.890) (-415.781) * (-417.186) (-413.436) (-414.248) [-412.867] -- 0:00:08
854000 -- [-412.514] (-412.879) (-414.753) (-412.320) * (-416.824) (-414.916) [-412.978] (-418.227) -- 0:00:08
854500 -- [-415.280] (-413.648) (-413.847) (-414.072) * (-419.678) (-414.900) (-413.987) [-414.735] -- 0:00:08
855000 -- [-412.266] (-413.345) (-415.891) (-418.337) * (-413.032) [-413.397] (-414.058) (-412.259) -- 0:00:08
Average standard deviation of split frequencies: 0.011014
855500 -- (-414.845) (-412.780) [-415.808] (-413.259) * (-416.882) [-415.924] (-416.020) (-412.107) -- 0:00:08
856000 -- [-413.831] (-414.558) (-417.897) (-413.916) * (-415.219) [-413.513] (-412.509) (-414.086) -- 0:00:08
856500 -- (-413.884) [-412.903] (-419.120) (-414.212) * (-414.432) (-412.073) [-415.031] (-416.347) -- 0:00:08
857000 -- (-412.973) [-415.596] (-416.249) (-415.172) * (-413.447) (-412.385) (-414.160) [-415.831] -- 0:00:08
857500 -- (-414.087) [-412.214] (-418.509) (-415.351) * [-414.094] (-413.579) (-413.689) (-413.967) -- 0:00:08
858000 -- (-415.072) [-413.355] (-412.944) (-416.207) * (-413.991) [-414.070] (-413.674) (-414.396) -- 0:00:08
858500 -- (-414.711) (-412.718) [-412.797] (-412.556) * (-415.360) (-413.357) (-413.674) [-414.831] -- 0:00:08
859000 -- (-413.750) (-412.674) [-413.236] (-418.369) * [-415.781] (-412.149) (-414.187) (-415.028) -- 0:00:08
859500 -- (-412.884) (-415.308) [-412.726] (-414.603) * (-414.588) (-415.434) [-412.189] (-415.166) -- 0:00:08
860000 -- (-412.471) (-411.702) [-413.661] (-414.596) * (-414.006) (-414.444) [-412.915] (-423.626) -- 0:00:08
Average standard deviation of split frequencies: 0.011064
860500 -- (-412.029) (-412.407) [-412.692] (-412.795) * (-413.722) (-414.274) [-414.273] (-418.789) -- 0:00:08
861000 -- (-413.984) [-417.983] (-412.712) (-412.713) * [-415.728] (-414.415) (-413.548) (-413.691) -- 0:00:08
861500 -- (-419.565) (-414.704) (-415.118) [-414.992] * [-413.653] (-416.980) (-412.805) (-412.964) -- 0:00:08
862000 -- (-412.595) [-415.887] (-415.631) (-413.327) * (-412.706) (-413.135) (-413.581) [-413.366] -- 0:00:08
862500 -- (-414.467) [-412.662] (-416.633) (-413.935) * (-415.245) (-415.068) (-413.941) [-414.765] -- 0:00:07
863000 -- (-413.794) [-413.047] (-415.845) (-414.509) * (-413.318) [-414.316] (-415.959) (-412.341) -- 0:00:07
863500 -- (-412.511) (-415.629) (-417.153) [-413.620] * (-413.757) (-417.936) [-415.086] (-416.888) -- 0:00:07
864000 -- (-413.163) (-413.004) [-413.324] (-415.293) * [-412.015] (-412.710) (-412.638) (-413.925) -- 0:00:07
864500 -- (-419.023) (-419.277) [-413.834] (-420.939) * (-413.821) (-412.450) [-414.147] (-415.634) -- 0:00:07
865000 -- (-414.494) [-412.168] (-412.566) (-413.409) * [-415.514] (-414.850) (-418.622) (-414.552) -- 0:00:07
Average standard deviation of split frequencies: 0.011032
865500 -- [-416.162] (-413.803) (-414.276) (-416.231) * (-415.694) [-414.634] (-412.611) (-412.936) -- 0:00:07
866000 -- (-413.764) [-412.007] (-413.968) (-415.742) * (-416.605) (-413.377) (-412.563) [-413.849] -- 0:00:07
866500 -- (-415.397) [-413.096] (-413.286) (-413.101) * (-414.279) [-414.254] (-412.323) (-414.608) -- 0:00:07
867000 -- (-416.190) (-414.500) (-413.965) [-414.144] * (-412.185) (-413.753) [-412.220] (-414.118) -- 0:00:07
867500 -- (-417.901) (-412.982) (-412.401) [-412.496] * [-414.069] (-413.923) (-414.741) (-415.706) -- 0:00:07
868000 -- (-414.915) (-412.393) (-417.184) [-412.872] * [-414.516] (-413.104) (-412.045) (-417.090) -- 0:00:07
868500 -- [-413.490] (-417.540) (-414.343) (-412.687) * [-416.122] (-412.014) (-413.366) (-417.844) -- 0:00:07
869000 -- [-413.410] (-412.423) (-412.283) (-415.416) * (-412.468) (-413.688) (-413.285) [-412.866] -- 0:00:07
869500 -- (-417.691) (-412.878) [-411.969] (-414.484) * (-412.986) [-414.237] (-414.993) (-413.018) -- 0:00:07
870000 -- (-415.506) [-413.181] (-413.502) (-413.268) * (-415.345) (-414.126) [-414.262] (-413.046) -- 0:00:07
Average standard deviation of split frequencies: 0.011009
870500 -- (-414.377) (-413.886) [-411.836] (-412.078) * (-417.609) [-412.064] (-413.453) (-413.271) -- 0:00:07
871000 -- (-411.889) (-415.349) [-416.877] (-412.565) * (-417.242) (-412.131) (-412.097) [-414.223] -- 0:00:07
871500 -- (-411.889) (-415.726) [-412.010] (-414.197) * (-416.086) (-412.878) (-411.857) [-413.975] -- 0:00:07
872000 -- (-412.404) [-414.658] (-412.203) (-414.254) * (-417.440) (-412.897) [-412.547] (-413.108) -- 0:00:07
872500 -- [-413.027] (-412.907) (-414.046) (-417.835) * (-416.002) (-415.745) (-413.385) [-415.699] -- 0:00:07
873000 -- (-412.471) [-413.114] (-413.775) (-412.379) * (-414.758) (-412.943) [-415.244] (-414.054) -- 0:00:07
873500 -- [-413.839] (-416.241) (-415.424) (-415.371) * (-416.299) (-412.996) (-417.204) [-412.243] -- 0:00:07
874000 -- (-413.037) (-413.623) (-414.492) [-414.920] * (-414.984) (-416.186) (-413.320) [-411.735] -- 0:00:07
874500 -- [-414.475] (-413.512) (-418.684) (-413.745) * (-412.925) (-415.023) (-414.230) [-414.870] -- 0:00:07
875000 -- (-412.929) (-412.922) [-413.464] (-412.324) * (-414.821) (-415.553) (-417.946) [-415.720] -- 0:00:07
Average standard deviation of split frequencies: 0.011552
875500 -- (-413.453) (-413.299) (-412.741) [-412.745] * (-414.562) (-415.855) (-414.197) [-416.601] -- 0:00:07
876000 -- (-414.441) (-411.928) (-412.368) [-415.669] * [-412.515] (-412.757) (-411.982) (-414.258) -- 0:00:07
876500 -- (-414.923) (-415.715) [-413.618] (-413.430) * (-415.029) [-412.050] (-414.128) (-416.656) -- 0:00:07
877000 -- (-417.964) (-413.245) [-413.180] (-413.262) * (-416.068) (-412.852) (-414.124) [-413.864] -- 0:00:07
877500 -- (-411.772) (-412.576) (-419.197) [-413.394] * [-414.280] (-414.236) (-412.218) (-412.070) -- 0:00:07
878000 -- (-413.732) [-416.440] (-413.501) (-412.227) * (-413.218) [-412.553] (-412.777) (-418.580) -- 0:00:07
878500 -- (-411.611) [-413.842] (-413.118) (-412.169) * (-412.912) (-414.714) (-413.565) [-413.520] -- 0:00:07
879000 -- [-412.841] (-414.815) (-413.679) (-416.094) * (-412.093) (-414.553) [-414.957] (-414.461) -- 0:00:07
879500 -- (-416.193) [-414.369] (-413.281) (-414.181) * (-413.268) [-416.861] (-414.385) (-412.865) -- 0:00:06
880000 -- [-411.687] (-418.268) (-413.350) (-415.685) * (-415.421) (-414.296) [-416.158] (-414.256) -- 0:00:06
Average standard deviation of split frequencies: 0.011241
880500 -- [-412.825] (-414.721) (-412.676) (-421.482) * (-419.089) (-413.122) [-418.437] (-415.939) -- 0:00:06
881000 -- (-414.721) [-413.434] (-416.292) (-414.198) * (-414.625) (-413.009) [-418.637] (-414.505) -- 0:00:06
881500 -- [-413.482] (-413.797) (-414.793) (-412.353) * (-412.080) (-412.069) [-416.766] (-413.304) -- 0:00:06
882000 -- (-413.145) [-412.457] (-419.515) (-412.426) * (-415.919) [-414.754] (-415.800) (-413.753) -- 0:00:06
882500 -- (-412.821) [-413.627] (-417.238) (-417.015) * (-413.977) [-417.049] (-414.253) (-418.480) -- 0:00:06
883000 -- (-417.468) (-412.264) (-417.386) [-412.901] * (-415.134) (-416.061) (-416.093) [-414.419] -- 0:00:06
883500 -- [-412.357] (-412.443) (-412.786) (-414.290) * [-417.476] (-412.635) (-420.365) (-411.944) -- 0:00:06
884000 -- (-412.482) (-419.914) [-413.068] (-416.438) * (-416.634) (-413.509) (-414.753) [-413.102] -- 0:00:06
884500 -- (-415.058) (-415.173) [-415.234] (-415.321) * (-414.943) (-414.396) [-414.581] (-413.584) -- 0:00:06
885000 -- [-413.923] (-415.644) (-412.559) (-415.495) * [-413.745] (-414.476) (-415.447) (-413.470) -- 0:00:06
Average standard deviation of split frequencies: 0.011067
885500 -- (-412.316) [-414.073] (-413.812) (-413.069) * (-415.002) (-415.976) (-417.321) [-413.129] -- 0:00:06
886000 -- [-413.172] (-416.055) (-413.392) (-413.565) * [-412.946] (-418.778) (-415.262) (-412.287) -- 0:00:06
886500 -- (-416.209) (-422.506) (-415.019) [-415.570] * [-413.015] (-417.974) (-412.882) (-415.597) -- 0:00:06
887000 -- (-415.829) (-419.679) [-414.408] (-415.745) * (-415.407) [-414.790] (-413.196) (-415.322) -- 0:00:06
887500 -- (-412.609) (-415.355) (-412.113) [-413.538] * (-414.861) (-413.347) [-413.794] (-414.517) -- 0:00:06
888000 -- [-412.596] (-412.868) (-413.212) (-412.697) * (-415.526) (-412.652) [-415.477] (-412.799) -- 0:00:06
888500 -- [-413.661] (-418.663) (-412.565) (-412.774) * [-411.949] (-413.224) (-414.819) (-412.829) -- 0:00:06
889000 -- [-413.843] (-416.595) (-412.088) (-412.127) * (-413.915) (-414.007) (-413.647) [-417.207] -- 0:00:06
889500 -- (-414.831) (-419.575) [-413.335] (-412.109) * (-413.453) [-413.212] (-412.589) (-416.975) -- 0:00:06
890000 -- (-413.858) (-416.576) [-413.677] (-414.831) * (-414.268) (-415.401) (-412.835) [-412.853] -- 0:00:06
Average standard deviation of split frequencies: 0.011609
890500 -- [-413.089] (-417.246) (-415.891) (-412.414) * [-412.546] (-413.641) (-415.836) (-413.626) -- 0:00:06
891000 -- (-413.289) (-413.449) [-412.176] (-412.168) * [-413.321] (-412.367) (-412.746) (-414.440) -- 0:00:06
891500 -- (-413.350) (-415.317) (-416.130) [-414.569] * (-412.420) (-415.275) (-416.890) [-414.027] -- 0:00:06
892000 -- (-411.889) (-413.731) [-413.063] (-412.545) * (-420.221) [-416.671] (-418.426) (-412.569) -- 0:00:06
892500 -- (-412.287) (-413.562) (-414.746) [-416.868] * (-412.573) (-413.711) (-416.825) [-414.030] -- 0:00:06
893000 -- (-414.687) (-414.239) (-414.777) [-414.817] * (-412.421) (-418.722) [-415.420] (-415.238) -- 0:00:06
893500 -- [-415.030] (-413.091) (-417.165) (-413.850) * [-412.437] (-413.229) (-412.985) (-413.574) -- 0:00:06
894000 -- (-412.876) (-413.135) (-413.700) [-415.963] * (-417.225) (-416.299) [-413.141] (-412.955) -- 0:00:06
894500 -- (-413.700) [-414.359] (-413.237) (-413.268) * (-422.019) (-414.517) [-412.986] (-415.281) -- 0:00:06
895000 -- (-415.391) [-416.290] (-412.459) (-412.836) * (-425.768) (-415.431) (-414.344) [-416.128] -- 0:00:06
Average standard deviation of split frequencies: 0.011575
895500 -- (-416.180) [-414.712] (-417.920) (-414.695) * (-417.977) [-414.526] (-416.754) (-416.220) -- 0:00:06
896000 -- (-421.441) [-412.895] (-412.730) (-413.038) * (-418.028) [-412.774] (-418.934) (-419.832) -- 0:00:06
896500 -- (-412.288) (-413.695) [-413.023] (-412.494) * (-413.623) (-421.643) (-414.969) [-415.855] -- 0:00:06
897000 -- (-413.948) (-412.782) [-414.607] (-414.469) * (-412.656) (-415.549) (-411.860) [-413.405] -- 0:00:05
897500 -- [-414.351] (-415.247) (-415.646) (-415.557) * (-412.746) (-412.894) (-414.718) [-415.660] -- 0:00:05
898000 -- (-413.601) (-415.212) [-412.848] (-414.999) * (-413.916) [-412.318] (-413.498) (-416.246) -- 0:00:05
898500 -- (-418.251) (-414.398) [-412.260] (-415.868) * (-415.337) (-414.450) [-412.523] (-419.311) -- 0:00:05
899000 -- (-416.368) (-413.702) (-415.139) [-413.431] * [-415.491] (-415.509) (-412.191) (-419.040) -- 0:00:05
899500 -- [-415.120] (-412.458) (-413.876) (-415.839) * [-413.082] (-411.698) (-417.038) (-419.756) -- 0:00:05
900000 -- (-419.163) [-413.779] (-413.258) (-415.750) * (-415.984) [-413.599] (-413.846) (-412.203) -- 0:00:05
Average standard deviation of split frequencies: 0.011270
900500 -- (-420.085) (-414.078) [-413.029] (-414.728) * [-413.936] (-415.600) (-413.267) (-412.473) -- 0:00:05
901000 -- (-411.852) (-416.356) [-414.910] (-414.791) * (-415.156) (-416.479) [-415.602] (-413.038) -- 0:00:05
901500 -- [-412.980] (-415.675) (-415.758) (-421.326) * (-412.376) [-412.188] (-413.363) (-414.811) -- 0:00:05
902000 -- (-414.130) (-415.051) (-413.620) [-415.357] * [-414.866] (-413.122) (-414.309) (-413.937) -- 0:00:05
902500 -- [-413.411] (-418.648) (-412.698) (-414.643) * (-416.588) [-413.941] (-414.416) (-415.039) -- 0:00:05
903000 -- [-413.761] (-419.276) (-413.190) (-412.427) * (-417.868) (-412.705) (-415.113) [-416.382] -- 0:00:05
903500 -- (-419.610) [-413.110] (-417.297) (-411.916) * (-414.821) (-415.147) [-416.591] (-415.392) -- 0:00:05
904000 -- (-416.440) (-412.997) [-415.105] (-414.310) * (-413.222) [-413.340] (-413.068) (-413.252) -- 0:00:05
904500 -- (-414.548) [-415.939] (-415.644) (-415.961) * (-413.787) [-412.401] (-415.853) (-416.860) -- 0:00:05
905000 -- (-413.686) [-412.612] (-411.952) (-414.446) * (-414.321) (-411.822) [-414.902] (-413.718) -- 0:00:05
Average standard deviation of split frequencies: 0.011343
905500 -- (-412.856) [-411.809] (-413.055) (-412.954) * [-412.224] (-413.071) (-417.002) (-413.719) -- 0:00:05
906000 -- (-414.564) (-414.074) (-413.854) [-415.464] * [-414.343] (-412.280) (-414.391) (-415.259) -- 0:00:05
906500 -- (-413.174) (-413.073) (-413.724) [-412.835] * (-413.320) (-417.523) [-414.152] (-415.170) -- 0:00:05
907000 -- (-415.684) [-416.939] (-413.092) (-413.502) * (-416.648) (-414.915) (-412.198) [-417.057] -- 0:00:05
907500 -- (-412.498) (-413.617) (-413.819) [-411.914] * (-414.009) (-417.255) (-417.914) [-413.667] -- 0:00:05
908000 -- (-412.147) [-415.641] (-413.340) (-413.358) * (-416.020) [-415.037] (-414.281) (-414.845) -- 0:00:05
908500 -- (-412.247) (-415.410) [-413.273] (-412.858) * (-415.596) (-416.748) (-412.377) [-414.732] -- 0:00:05
909000 -- [-412.931] (-419.009) (-412.426) (-413.516) * (-415.489) [-413.107] (-415.288) (-411.985) -- 0:00:05
909500 -- (-416.909) (-417.811) [-415.274] (-417.538) * (-414.553) (-416.443) [-412.845] (-417.857) -- 0:00:05
910000 -- [-412.999] (-415.815) (-413.696) (-415.135) * [-414.123] (-414.248) (-413.661) (-414.505) -- 0:00:05
Average standard deviation of split frequencies: 0.011319
910500 -- [-413.190] (-416.250) (-413.114) (-413.666) * (-413.215) (-412.236) [-414.520] (-413.504) -- 0:00:05
911000 -- (-412.458) (-413.438) (-414.400) [-417.143] * (-412.089) [-412.099] (-417.155) (-414.823) -- 0:00:05
911500 -- (-413.358) (-413.536) [-412.267] (-413.544) * [-412.360] (-413.272) (-414.001) (-415.151) -- 0:00:05
912000 -- (-415.363) (-416.801) (-416.205) [-412.231] * (-413.677) (-416.669) [-413.522] (-414.818) -- 0:00:05
912500 -- (-412.717) (-416.117) [-413.899] (-412.460) * (-413.341) (-412.801) (-412.871) [-412.299] -- 0:00:05
913000 -- (-413.575) [-413.025] (-412.622) (-417.360) * (-414.084) [-415.946] (-413.234) (-412.675) -- 0:00:05
913500 -- (-415.104) (-413.096) [-419.590] (-412.763) * (-413.731) (-414.221) [-413.144] (-412.289) -- 0:00:05
914000 -- [-414.851] (-419.008) (-415.128) (-414.202) * (-415.047) [-416.442] (-413.329) (-412.232) -- 0:00:04
914500 -- (-413.797) (-416.862) (-415.108) [-416.791] * (-415.254) (-414.030) [-413.007] (-412.806) -- 0:00:04
915000 -- (-414.240) (-414.614) (-417.293) [-412.819] * (-413.102) (-413.599) (-412.333) [-414.112] -- 0:00:04
Average standard deviation of split frequencies: 0.011562
915500 -- [-413.363] (-416.468) (-413.589) (-416.520) * (-414.510) (-413.102) [-412.904] (-415.883) -- 0:00:04
916000 -- (-416.340) (-412.811) (-415.321) [-412.567] * (-415.024) (-412.388) (-412.913) [-416.055] -- 0:00:04
916500 -- (-413.159) (-414.951) (-415.522) [-413.367] * (-413.631) (-414.577) [-413.663] (-413.557) -- 0:00:04
917000 -- [-413.684] (-412.856) (-413.520) (-412.082) * (-414.917) (-413.663) [-412.629] (-414.521) -- 0:00:04
917500 -- (-416.035) (-412.380) (-414.014) [-412.363] * (-414.137) [-412.568] (-415.537) (-413.284) -- 0:00:04
918000 -- [-416.140] (-415.935) (-413.817) (-414.604) * (-417.246) (-413.993) [-414.757] (-413.577) -- 0:00:04
918500 -- (-416.756) (-414.720) (-412.316) [-414.466] * [-412.409] (-411.823) (-412.651) (-412.584) -- 0:00:04
919000 -- [-414.330] (-413.985) (-412.809) (-418.462) * (-412.779) (-411.939) [-413.718] (-414.615) -- 0:00:04
919500 -- (-413.630) (-414.388) (-414.766) [-414.117] * (-413.066) [-413.046] (-412.518) (-415.950) -- 0:00:04
920000 -- (-414.540) (-415.388) (-416.171) [-413.135] * (-412.703) (-422.020) (-415.206) [-415.647] -- 0:00:04
Average standard deviation of split frequencies: 0.011981
920500 -- (-412.904) [-412.623] (-416.444) (-414.385) * (-412.718) [-416.216] (-414.928) (-416.869) -- 0:00:04
921000 -- (-413.054) [-412.844] (-413.618) (-414.779) * (-414.790) (-413.936) (-413.228) [-413.841] -- 0:00:04
921500 -- [-413.614] (-411.571) (-412.454) (-412.765) * (-414.175) (-413.067) (-414.404) [-412.668] -- 0:00:04
922000 -- (-413.627) (-412.515) (-413.336) [-413.487] * (-414.366) [-412.126] (-413.225) (-413.213) -- 0:00:04
922500 -- (-414.037) (-411.927) (-413.440) [-411.866] * [-414.521] (-415.323) (-412.674) (-413.020) -- 0:00:04
923000 -- (-417.994) (-415.958) (-412.455) [-412.592] * (-412.738) (-416.954) [-414.179] (-412.819) -- 0:00:04
923500 -- [-412.084] (-417.950) (-414.212) (-414.619) * (-413.424) (-416.184) [-417.372] (-415.317) -- 0:00:04
924000 -- [-413.097] (-416.393) (-411.873) (-412.601) * (-418.369) [-420.225] (-414.943) (-415.805) -- 0:00:04
924500 -- (-413.717) [-412.655] (-412.803) (-414.708) * (-413.257) [-415.575] (-413.240) (-412.914) -- 0:00:04
925000 -- [-413.667] (-412.645) (-412.269) (-418.388) * (-413.434) (-412.988) [-414.392] (-412.755) -- 0:00:04
Average standard deviation of split frequencies: 0.011912
925500 -- (-413.631) (-412.817) (-412.238) [-415.505] * [-415.942] (-418.445) (-414.194) (-413.589) -- 0:00:04
926000 -- [-412.823] (-413.735) (-411.870) (-415.320) * (-416.593) (-415.596) (-412.568) [-416.620] -- 0:00:04
926500 -- [-412.800] (-414.526) (-414.377) (-413.360) * [-413.672] (-414.161) (-413.982) (-414.066) -- 0:00:04
927000 -- (-413.578) [-412.414] (-415.666) (-413.077) * (-414.512) [-413.108] (-412.146) (-417.506) -- 0:00:04
927500 -- [-411.700] (-415.947) (-413.444) (-417.664) * (-416.445) [-417.811] (-411.912) (-415.669) -- 0:00:04
928000 -- [-417.597] (-413.836) (-421.465) (-421.918) * (-415.832) [-415.423] (-416.637) (-412.318) -- 0:00:04
928500 -- (-413.597) [-414.487] (-413.276) (-417.165) * (-414.863) (-414.613) (-416.850) [-413.230] -- 0:00:04
929000 -- [-412.270] (-413.957) (-414.694) (-415.966) * (-415.704) (-414.200) (-416.401) [-413.658] -- 0:00:04
929500 -- (-412.930) (-413.111) (-414.239) [-416.281] * [-414.008] (-413.142) (-413.346) (-414.405) -- 0:00:04
930000 -- (-411.850) [-413.874] (-412.243) (-414.623) * [-414.462] (-412.553) (-412.276) (-414.252) -- 0:00:04
Average standard deviation of split frequencies: 0.011785
930500 -- (-414.409) (-414.057) [-411.932] (-416.944) * (-414.434) (-414.233) [-414.294] (-415.930) -- 0:00:04
931000 -- (-413.850) (-415.352) [-417.596] (-417.088) * (-415.436) (-412.860) [-413.577] (-415.335) -- 0:00:04
931500 -- (-417.694) [-413.010] (-412.808) (-413.156) * (-415.642) (-414.482) (-415.899) [-412.935] -- 0:00:03
932000 -- (-418.963) (-412.758) (-413.272) [-412.557] * (-414.409) [-412.416] (-412.289) (-416.977) -- 0:00:03
932500 -- (-414.896) (-415.531) (-412.685) [-412.587] * [-415.471] (-412.585) (-412.363) (-421.101) -- 0:00:03
933000 -- (-413.237) [-412.836] (-412.863) (-414.453) * (-416.066) [-414.244] (-412.828) (-415.658) -- 0:00:03
933500 -- (-418.803) (-413.155) [-412.804] (-414.228) * (-413.433) (-412.901) (-413.226) [-412.318] -- 0:00:03
934000 -- (-413.775) [-417.735] (-414.464) (-417.904) * (-413.291) (-413.835) [-414.436] (-412.864) -- 0:00:03
934500 -- (-414.746) (-412.732) [-412.251] (-414.184) * [-413.582] (-412.122) (-413.946) (-415.349) -- 0:00:03
935000 -- (-414.491) (-418.128) [-414.510] (-414.118) * [-413.739] (-414.260) (-416.519) (-413.865) -- 0:00:03
Average standard deviation of split frequencies: 0.011315
935500 -- (-413.955) [-416.682] (-416.787) (-413.701) * (-416.743) [-414.402] (-416.122) (-414.574) -- 0:00:03
936000 -- [-414.057] (-414.259) (-415.348) (-414.322) * (-415.311) (-412.848) [-415.165] (-416.853) -- 0:00:03
936500 -- (-416.414) (-413.936) [-413.517] (-412.398) * (-418.668) (-414.524) (-411.869) [-415.130] -- 0:00:03
937000 -- (-415.080) (-414.017) (-414.690) [-414.758] * (-415.229) (-416.171) (-414.606) [-413.612] -- 0:00:03
937500 -- [-411.989] (-413.005) (-415.310) (-412.949) * (-415.333) (-413.335) [-413.724] (-412.691) -- 0:00:03
938000 -- (-412.144) (-412.134) (-414.166) [-413.064] * [-412.182] (-415.185) (-412.477) (-415.873) -- 0:00:03
938500 -- (-412.682) (-414.790) [-415.095] (-412.643) * (-413.414) [-413.440] (-415.556) (-415.992) -- 0:00:03
939000 -- (-414.431) (-414.567) [-413.209] (-413.923) * [-412.772] (-419.756) (-415.962) (-422.029) -- 0:00:03
939500 -- (-412.373) (-416.682) [-412.696] (-419.149) * (-412.921) (-417.176) [-414.853] (-417.421) -- 0:00:03
940000 -- (-411.994) (-412.698) (-414.368) [-413.683] * (-412.301) (-413.280) [-413.722] (-415.041) -- 0:00:03
Average standard deviation of split frequencies: 0.011860
940500 -- (-412.355) (-412.617) [-413.685] (-416.140) * [-412.951] (-417.215) (-413.132) (-412.061) -- 0:00:03
941000 -- (-413.173) [-417.192] (-412.526) (-413.448) * [-412.017] (-412.842) (-415.925) (-414.561) -- 0:00:03
941500 -- [-413.103] (-412.309) (-413.285) (-413.213) * [-415.651] (-414.778) (-414.859) (-414.448) -- 0:00:03
942000 -- (-412.013) [-414.728] (-413.986) (-414.688) * [-414.308] (-414.763) (-413.602) (-414.883) -- 0:00:03
942500 -- [-414.041] (-414.539) (-415.625) (-415.925) * (-413.186) [-412.921] (-416.336) (-415.841) -- 0:00:03
943000 -- (-413.965) (-414.437) [-413.160] (-416.003) * [-412.751] (-412.537) (-413.534) (-416.738) -- 0:00:03
943500 -- (-417.338) (-411.977) [-413.641] (-413.716) * [-412.332] (-414.290) (-414.620) (-415.197) -- 0:00:03
944000 -- (-419.089) [-414.895] (-413.158) (-416.015) * (-412.332) (-414.321) (-414.725) [-412.377] -- 0:00:03
944500 -- (-415.743) [-413.756] (-412.448) (-417.308) * (-413.426) (-414.667) (-413.223) [-413.509] -- 0:00:03
945000 -- (-414.644) [-412.718] (-414.269) (-420.576) * [-414.801] (-415.565) (-413.831) (-415.819) -- 0:00:03
Average standard deviation of split frequencies: 0.011860
945500 -- (-413.644) (-412.804) [-417.869] (-416.363) * (-417.997) (-413.537) [-416.478] (-415.701) -- 0:00:03
946000 -- [-412.003] (-413.314) (-414.962) (-412.658) * [-416.322] (-414.244) (-413.764) (-413.395) -- 0:00:03
946500 -- [-412.032] (-413.127) (-418.055) (-412.249) * (-415.187) (-416.997) (-414.400) [-413.445] -- 0:00:03
947000 -- [-412.382] (-412.525) (-413.405) (-413.600) * (-413.032) (-412.547) [-413.385] (-413.453) -- 0:00:03
947500 -- (-416.503) (-413.596) (-413.095) [-415.215] * (-413.167) [-412.920] (-414.147) (-413.286) -- 0:00:03
948000 -- [-414.786] (-413.398) (-415.177) (-414.363) * (-414.534) [-414.043] (-412.595) (-416.477) -- 0:00:03
948500 -- (-412.662) (-416.075) [-413.399] (-416.587) * (-417.803) (-413.098) (-412.595) [-413.348] -- 0:00:02
949000 -- (-412.358) (-418.371) [-420.325] (-414.821) * (-414.044) (-412.909) [-412.417] (-414.709) -- 0:00:02
949500 -- (-412.886) (-418.833) [-414.122] (-413.049) * (-414.933) [-413.562] (-411.777) (-416.865) -- 0:00:02
950000 -- (-413.316) (-416.463) (-417.057) [-413.378] * (-413.214) (-414.841) [-412.403] (-413.379) -- 0:00:02
Average standard deviation of split frequencies: 0.011802
950500 -- (-417.046) (-415.296) (-416.880) [-413.668] * (-412.865) (-412.559) [-412.785] (-415.059) -- 0:00:02
951000 -- (-412.799) (-413.262) (-416.163) [-412.390] * (-414.107) (-412.544) [-414.279] (-415.462) -- 0:00:02
951500 -- (-412.298) (-414.014) [-417.150] (-416.560) * [-416.847] (-413.539) (-413.087) (-413.207) -- 0:00:02
952000 -- [-414.898] (-412.702) (-411.930) (-416.973) * (-422.959) (-413.239) (-416.401) [-411.969] -- 0:00:02
952500 -- (-419.404) [-412.753] (-414.705) (-414.892) * (-420.419) [-414.843] (-412.401) (-416.162) -- 0:00:02
953000 -- (-417.254) (-414.103) [-412.289] (-416.003) * (-414.263) (-417.500) (-412.671) [-413.020] -- 0:00:02
953500 -- (-414.759) (-412.781) [-413.101] (-416.628) * (-418.497) [-413.823] (-414.271) (-414.153) -- 0:00:02
954000 -- (-414.452) (-411.727) (-418.944) [-412.309] * (-415.888) (-415.273) [-413.873] (-414.358) -- 0:00:02
954500 -- (-416.173) [-414.616] (-414.095) (-414.454) * (-413.827) [-413.897] (-414.440) (-416.176) -- 0:00:02
955000 -- (-415.180) (-415.111) (-414.258) [-412.631] * (-419.061) (-416.491) (-415.533) [-413.111] -- 0:00:02
Average standard deviation of split frequencies: 0.011769
955500 -- (-415.784) (-414.860) (-415.593) [-412.788] * (-417.442) (-419.271) (-415.851) [-412.401] -- 0:00:02
956000 -- [-416.152] (-421.257) (-414.322) (-412.794) * (-412.555) (-418.532) [-412.449] (-413.258) -- 0:00:02
956500 -- (-418.760) (-416.140) (-415.152) [-415.456] * (-413.427) (-417.291) (-414.941) [-413.930] -- 0:00:02
957000 -- [-412.681] (-413.489) (-414.067) (-414.184) * (-413.627) (-413.819) (-414.510) [-413.631] -- 0:00:02
957500 -- (-414.967) (-414.150) (-414.251) [-417.259] * (-415.983) (-416.545) [-412.053] (-412.673) -- 0:00:02
958000 -- (-412.391) (-413.333) [-415.809] (-416.119) * (-412.619) (-416.809) [-412.338] (-415.585) -- 0:00:02
958500 -- (-412.817) (-416.015) [-413.861] (-414.415) * (-414.641) (-415.468) (-414.283) [-413.998] -- 0:00:02
959000 -- [-413.294] (-415.744) (-417.506) (-415.017) * (-414.601) (-413.090) [-412.910] (-420.772) -- 0:00:02
959500 -- (-413.248) (-413.649) (-416.159) [-413.171] * (-412.969) (-414.316) (-415.592) [-412.758] -- 0:00:02
960000 -- (-415.494) (-413.348) [-413.825] (-412.377) * [-414.411] (-413.837) (-413.257) (-414.484) -- 0:00:02
Average standard deviation of split frequencies: 0.011679
960500 -- (-412.151) (-414.623) (-413.185) [-413.170] * (-417.489) [-413.885] (-414.440) (-415.726) -- 0:00:02
961000 -- [-415.277] (-414.455) (-412.180) (-413.148) * [-413.362] (-416.189) (-417.839) (-412.158) -- 0:00:02
961500 -- (-414.613) [-413.551] (-412.751) (-415.050) * (-419.485) (-417.438) [-415.397] (-412.852) -- 0:00:02
962000 -- (-414.534) (-421.085) (-413.820) [-415.297] * (-416.366) (-413.354) (-412.740) [-412.071] -- 0:00:02
962500 -- (-416.227) [-415.865] (-416.173) (-417.880) * (-414.043) [-414.436] (-417.889) (-411.709) -- 0:00:02
963000 -- (-416.234) [-415.053] (-416.274) (-413.426) * (-413.554) (-413.288) (-413.245) [-412.810] -- 0:00:02
963500 -- (-414.449) (-416.342) (-413.362) [-412.079] * (-415.593) [-413.025] (-416.762) (-415.470) -- 0:00:02
964000 -- (-412.529) (-415.369) (-414.015) [-412.698] * (-415.557) [-412.685] (-412.131) (-417.496) -- 0:00:02
964500 -- (-415.391) (-415.046) [-411.698] (-413.181) * [-413.432] (-414.259) (-415.488) (-413.131) -- 0:00:02
965000 -- [-416.327] (-415.378) (-411.975) (-413.079) * (-414.001) [-421.343] (-414.098) (-413.337) -- 0:00:02
Average standard deviation of split frequencies: 0.011582
965500 -- (-415.772) (-413.639) [-412.355] (-415.198) * (-414.765) (-414.703) [-413.082] (-414.687) -- 0:00:02
966000 -- [-413.335] (-415.741) (-415.103) (-420.667) * (-417.474) [-415.234] (-413.527) (-411.934) -- 0:00:01
966500 -- (-416.346) (-415.357) [-413.154] (-420.608) * [-414.561] (-411.970) (-417.046) (-413.535) -- 0:00:01
967000 -- (-413.262) (-414.232) [-414.853] (-420.383) * [-412.100] (-413.051) (-415.170) (-413.960) -- 0:00:01
967500 -- (-414.153) (-413.184) [-413.395] (-412.963) * [-412.272] (-413.888) (-413.289) (-413.461) -- 0:00:01
968000 -- [-412.348] (-416.192) (-419.158) (-412.579) * [-412.269] (-414.853) (-414.453) (-413.607) -- 0:00:01
968500 -- (-415.036) [-413.027] (-416.659) (-414.310) * (-415.635) [-413.321] (-415.768) (-413.816) -- 0:00:01
969000 -- (-414.824) (-412.734) [-414.050] (-413.403) * (-413.927) (-414.953) [-416.315] (-413.773) -- 0:00:01
969500 -- (-416.108) (-414.116) [-414.459] (-415.137) * [-414.885] (-415.289) (-412.791) (-413.707) -- 0:00:01
970000 -- (-413.425) [-414.815] (-416.415) (-418.140) * (-413.179) (-413.466) [-416.224] (-414.482) -- 0:00:01
Average standard deviation of split frequencies: 0.012077
970500 -- (-417.534) [-414.709] (-414.786) (-411.954) * (-415.993) [-413.362] (-412.545) (-413.363) -- 0:00:01
971000 -- (-416.554) (-413.129) [-412.245] (-414.852) * (-421.421) [-412.926] (-413.991) (-413.084) -- 0:00:01
971500 -- (-420.452) (-413.414) [-413.118] (-416.610) * (-417.364) (-411.730) [-412.640] (-412.516) -- 0:00:01
972000 -- [-414.381] (-416.001) (-412.182) (-421.074) * (-415.867) (-412.523) [-413.716] (-415.712) -- 0:00:01
972500 -- (-413.636) (-414.331) (-413.752) [-414.043] * [-411.597] (-416.726) (-414.695) (-415.626) -- 0:00:01
973000 -- (-417.836) [-413.243] (-412.960) (-412.549) * (-412.856) (-414.488) (-413.025) [-412.306] -- 0:00:01
973500 -- (-413.924) [-414.571] (-415.850) (-412.587) * [-411.679] (-413.227) (-413.942) (-413.529) -- 0:00:01
974000 -- (-413.326) (-416.569) (-414.655) [-412.472] * (-411.829) [-413.948] (-414.699) (-415.519) -- 0:00:01
974500 -- (-413.134) (-415.695) [-415.077] (-413.267) * [-415.402] (-412.288) (-415.866) (-415.036) -- 0:00:01
975000 -- (-414.748) (-415.038) (-413.777) [-413.634] * (-413.288) [-412.579] (-415.425) (-413.174) -- 0:00:01
Average standard deviation of split frequencies: 0.011785
975500 -- [-413.964] (-415.054) (-412.878) (-413.751) * (-415.046) (-418.737) (-416.814) [-414.302] -- 0:00:01
976000 -- (-413.369) (-416.520) [-411.695] (-417.649) * (-413.468) [-416.230] (-415.928) (-417.508) -- 0:00:01
976500 -- (-413.231) (-413.436) (-413.087) [-412.980] * (-413.146) [-412.098] (-413.722) (-413.366) -- 0:00:01
977000 -- (-412.350) (-414.827) [-417.278] (-415.782) * (-412.900) (-414.779) (-412.570) [-417.844] -- 0:00:01
977500 -- (-413.100) (-412.884) [-414.811] (-416.929) * [-412.991] (-415.292) (-417.172) (-416.399) -- 0:00:01
978000 -- (-414.477) (-414.062) (-414.172) [-414.367] * (-413.453) (-418.534) (-414.342) [-416.316] -- 0:00:01
978500 -- (-415.583) (-413.761) (-411.741) [-413.943] * (-417.042) (-412.646) (-416.401) [-413.396] -- 0:00:01
979000 -- (-418.728) (-412.912) [-411.758] (-414.816) * [-412.620] (-413.552) (-413.784) (-416.521) -- 0:00:01
979500 -- (-414.060) [-415.012] (-417.422) (-414.207) * [-413.514] (-413.805) (-416.186) (-413.581) -- 0:00:01
980000 -- (-415.980) [-413.529] (-416.354) (-414.408) * [-412.148] (-415.168) (-415.969) (-412.732) -- 0:00:01
Average standard deviation of split frequencies: 0.011505
980500 -- (-415.293) (-414.104) (-416.425) [-416.089] * (-416.622) (-417.819) [-412.847] (-414.204) -- 0:00:01
981000 -- (-412.339) [-413.555] (-415.676) (-416.512) * (-416.583) (-416.695) [-414.727] (-416.009) -- 0:00:01
981500 -- (-414.095) [-418.846] (-417.290) (-419.174) * (-415.826) (-412.278) (-416.970) [-412.699] -- 0:00:01
982000 -- [-413.261] (-418.282) (-416.641) (-417.668) * (-412.780) [-413.049] (-415.054) (-413.786) -- 0:00:01
982500 -- (-413.453) (-412.617) [-419.111] (-416.440) * (-413.212) (-413.105) (-411.835) [-414.097] -- 0:00:01
983000 -- (-412.050) [-411.906] (-412.173) (-412.312) * (-416.788) (-412.167) (-411.904) [-412.349] -- 0:00:00
983500 -- (-412.304) (-415.669) [-412.274] (-412.248) * (-414.978) (-414.335) [-412.281] (-413.049) -- 0:00:00
984000 -- (-414.805) (-411.908) (-413.034) [-412.915] * (-416.506) (-415.876) [-411.583] (-414.012) -- 0:00:00
984500 -- (-412.382) [-413.579] (-412.767) (-416.423) * (-412.438) [-412.424] (-414.528) (-412.490) -- 0:00:00
985000 -- [-414.715] (-412.555) (-414.100) (-412.260) * (-414.999) (-414.895) [-414.037] (-414.222) -- 0:00:00
Average standard deviation of split frequencies: 0.011666
985500 -- (-413.371) (-411.993) (-414.559) [-412.336] * (-415.756) [-419.014] (-413.410) (-416.252) -- 0:00:00
986000 -- (-413.866) (-411.889) (-413.306) [-413.093] * [-414.183] (-412.742) (-417.733) (-413.885) -- 0:00:00
986500 -- [-415.285] (-412.905) (-413.892) (-414.575) * (-413.884) (-413.460) (-419.804) [-412.557] -- 0:00:00
987000 -- (-414.978) (-414.799) (-412.951) [-413.360] * (-415.058) [-412.530] (-413.894) (-413.378) -- 0:00:00
987500 -- (-415.574) (-413.982) (-412.113) [-413.563] * (-413.768) (-412.764) [-414.486] (-411.902) -- 0:00:00
988000 -- (-412.645) (-412.768) (-416.140) [-412.507] * (-418.318) [-413.445] (-412.896) (-412.774) -- 0:00:00
988500 -- (-416.154) (-414.805) [-415.007] (-415.443) * (-414.541) (-415.824) [-413.815] (-416.092) -- 0:00:00
989000 -- (-418.529) (-412.922) (-418.333) [-413.774] * (-412.514) (-417.391) (-419.176) [-415.874] -- 0:00:00
989500 -- [-417.678] (-413.840) (-413.889) (-415.289) * (-412.075) [-412.590] (-420.412) (-413.596) -- 0:00:00
990000 -- [-414.226] (-413.039) (-413.537) (-411.961) * (-413.671) (-412.247) [-420.941] (-415.602) -- 0:00:00
Average standard deviation of split frequencies: 0.011642
990500 -- [-413.627] (-413.380) (-416.643) (-411.743) * [-413.574] (-414.059) (-413.122) (-415.586) -- 0:00:00
991000 -- [-414.251] (-412.123) (-419.423) (-415.752) * (-415.883) [-414.442] (-412.915) (-414.042) -- 0:00:00
991500 -- (-412.819) (-419.731) (-416.564) [-415.133] * (-414.430) (-413.342) (-413.351) [-413.180] -- 0:00:00
992000 -- [-413.156] (-415.103) (-414.097) (-412.395) * (-412.392) (-412.097) (-413.404) [-413.261] -- 0:00:00
992500 -- [-412.757] (-413.109) (-411.663) (-413.462) * (-413.136) [-412.236] (-412.855) (-412.517) -- 0:00:00
993000 -- (-413.608) (-413.554) (-415.445) [-412.922] * (-419.274) (-411.935) (-413.296) [-412.054] -- 0:00:00
993500 -- (-412.632) [-413.542] (-414.745) (-417.728) * (-413.421) [-412.863] (-412.635) (-419.750) -- 0:00:00
994000 -- (-417.664) [-414.418] (-413.086) (-413.619) * (-417.011) (-413.697) [-413.610] (-414.185) -- 0:00:00
994500 -- (-416.107) (-416.329) [-412.443] (-413.397) * (-417.203) (-415.672) (-414.955) [-414.207] -- 0:00:00
995000 -- (-416.918) [-414.150] (-414.673) (-415.643) * (-416.752) (-412.817) [-417.035] (-415.294) -- 0:00:00
Average standard deviation of split frequencies: 0.011264
995500 -- (-414.794) [-414.592] (-412.720) (-414.734) * (-414.228) [-412.629] (-416.473) (-418.566) -- 0:00:00
996000 -- [-416.702] (-414.574) (-414.240) (-417.698) * (-414.394) [-412.099] (-414.986) (-416.522) -- 0:00:00
996500 -- [-414.216] (-413.668) (-413.657) (-412.599) * (-414.087) [-413.819] (-416.144) (-415.115) -- 0:00:00
997000 -- (-415.136) (-412.032) (-414.123) [-412.441] * (-414.605) [-413.943] (-419.917) (-414.092) -- 0:00:00
997500 -- [-413.332] (-413.183) (-414.411) (-414.106) * [-416.047] (-414.108) (-416.085) (-414.442) -- 0:00:00
998000 -- (-413.887) (-413.372) (-413.343) [-411.905] * (-415.422) [-414.253] (-418.383) (-412.068) -- 0:00:00
998500 -- (-419.524) [-414.197] (-413.383) (-411.837) * (-415.172) [-412.371] (-412.952) (-416.464) -- 0:00:00
999000 -- [-416.945] (-413.669) (-415.616) (-414.399) * (-415.777) [-414.652] (-413.957) (-415.929) -- 0:00:00
999500 -- (-412.970) [-415.000] (-412.293) (-415.037) * (-413.891) (-415.433) (-413.554) [-412.042] -- 0:00:00
1000000 -- (-412.695) [-413.361] (-413.413) (-413.071) * (-412.793) (-416.031) (-415.236) [-415.109] -- 0:00:00
Average standard deviation of split frequencies: 0.011369
Analysis completed in 58 seconds
Analysis used 57.25 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -411.50
Likelihood of best state for "cold" chain of run 2 was -411.50
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
39.0 % ( 38 %) Dirichlet(Pi{all})
38.3 % ( 28 %) Slider(Pi{all})
78.1 % ( 49 %) Multiplier(Alpha{1,2})
77.4 % ( 56 %) Multiplier(Alpha{3})
25.7 % ( 32 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.7 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 75 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
38.8 % ( 26 %) Dirichlet(Pi{all})
38.7 % ( 28 %) Slider(Pi{all})
78.7 % ( 60 %) Multiplier(Alpha{1,2})
77.9 % ( 52 %) Multiplier(Alpha{3})
26.1 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 78 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 94 %) ParsSPR(Tau{all},V{all})
28.2 % ( 28 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.3 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166899 0.82 0.67
3 | 167246 166142 0.84
4 | 166281 166772 166660
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166185 0.82 0.67
3 | 166795 166804 0.84
4 | 166031 167304 166881
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -413.29
| 2 1 |
| 1 1 2 |
|11 1 1 2 2 2 |
| 22 1 1 2 2 2 1 2 |
| * 2 2 1 1 1 21 2 1 1 |
| 2 2 2 2 1 22112 1 1 1 2 |
| 12 11 1 111 1 2 1 1 2 1 1 1 2|
| 2 2 2 21 2 2 2 11 22 1 11|
| 2 * 1 21 2 22 2 |
|2 2 22 1* 1 2 11 1 *12 2 |
| 21 1 2 2 2 |
| 1 1 2 2 |
| 1 1 |
| |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -414.88
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -413.22 -416.15
2 -413.24 -416.64
--------------------------------------
TOTAL -413.23 -416.43
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893412 0.089697 0.378004 1.490698 0.857451 1467.01 1479.46 1.000
r(A<->C){all} 0.168571 0.019418 0.000101 0.452683 0.133660 192.04 247.46 1.003
r(A<->G){all} 0.159544 0.019322 0.000068 0.443841 0.123872 170.29 245.11 1.000
r(A<->T){all} 0.168504 0.021095 0.000340 0.463655 0.128234 209.28 248.90 1.000
r(C<->G){all} 0.166569 0.021447 0.000035 0.478987 0.124437 145.76 186.09 1.003
r(C<->T){all} 0.163120 0.020770 0.000021 0.475406 0.120855 133.26 151.94 1.001
r(G<->T){all} 0.173692 0.021294 0.000035 0.469612 0.131926 202.60 217.82 1.011
pi(A){all} 0.154126 0.000416 0.113746 0.192489 0.153706 1120.87 1236.07 1.001
pi(C){all} 0.242046 0.000590 0.194374 0.288774 0.242117 994.91 1110.42 1.000
pi(G){all} 0.354126 0.000726 0.299925 0.404674 0.353881 1338.91 1363.83 1.000
pi(T){all} 0.249701 0.000612 0.200545 0.298421 0.249272 1286.09 1341.58 1.000
alpha{1,2} 0.401400 0.221764 0.000154 1.343454 0.238121 896.79 1104.21 1.000
alpha{3} 0.456107 0.240622 0.000226 1.463940 0.300139 1356.35 1428.67 1.000
pinvar{all} 0.994574 0.000040 0.982326 0.999998 0.996670 1299.83 1340.39 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- ...*.*
9 -- ..*..*
10 -- .*.*..
11 -- ..****
12 -- .***.*
13 -- ....**
14 -- .*..*.
15 -- ...**.
16 -- .****.
17 -- ..**..
18 -- .**.**
19 -- ..*.*.
20 -- .*...*
21 -- .**...
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 461 0.153564 0.021199 0.138574 0.168554 2
8 454 0.151233 0.005653 0.147235 0.155230 2
9 452 0.150566 0.000942 0.149900 0.151233 2
10 445 0.148235 0.006124 0.143904 0.152565 2
11 445 0.148235 0.008009 0.142572 0.153897 2
12 443 0.147568 0.026852 0.128581 0.166556 2
13 425 0.141572 0.011777 0.133245 0.149900 2
14 421 0.140240 0.032505 0.117255 0.163225 2
15 421 0.140240 0.000471 0.139907 0.140573 2
16 417 0.138907 0.009893 0.131912 0.145903 2
17 416 0.138574 0.014133 0.128581 0.148568 2
18 414 0.137908 0.007537 0.132578 0.143238 2
19 409 0.136243 0.006124 0.131912 0.140573 2
20 404 0.134577 0.004711 0.131246 0.137908 2
21 401 0.133578 0.014604 0.123251 0.143904 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099216 0.009836 0.000096 0.300295 0.067418 1.000 2
length{all}[2] 0.099788 0.009326 0.000001 0.286634 0.073106 1.000 2
length{all}[3] 0.098858 0.009564 0.000106 0.299704 0.069150 1.000 2
length{all}[4] 0.097902 0.009396 0.000000 0.288885 0.068061 1.000 2
length{all}[5] 0.099287 0.009591 0.000022 0.298749 0.067886 1.000 2
length{all}[6] 0.099661 0.010140 0.000025 0.300254 0.068549 1.000 2
length{all}[7] 0.101684 0.008886 0.000007 0.281897 0.077400 0.998 2
length{all}[8] 0.100036 0.008646 0.000332 0.287366 0.070477 0.998 2
length{all}[9] 0.098012 0.008649 0.000007 0.274175 0.066449 0.999 2
length{all}[10] 0.101221 0.009287 0.000182 0.294922 0.067694 0.998 2
length{all}[11] 0.100406 0.009982 0.000018 0.294580 0.072437 0.998 2
length{all}[12] 0.094401 0.011238 0.000254 0.283478 0.061563 0.998 2
length{all}[13] 0.094732 0.010241 0.000133 0.289915 0.067341 0.998 2
length{all}[14] 0.096875 0.011175 0.000369 0.312705 0.060368 0.999 2
length{all}[15] 0.095483 0.010814 0.000174 0.286635 0.061509 1.000 2
length{all}[16] 0.106516 0.010679 0.001090 0.319270 0.070791 1.003 2
length{all}[17] 0.097736 0.011745 0.000097 0.304597 0.062455 0.998 2
length{all}[18] 0.101098 0.009653 0.000236 0.290994 0.072933 0.998 2
length{all}[19] 0.103339 0.012274 0.000319 0.341223 0.068546 0.998 2
length{all}[20] 0.093286 0.009397 0.000013 0.298686 0.058943 1.006 2
length{all}[21] 0.098777 0.008130 0.000223 0.283614 0.077655 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.011369
Maximum standard deviation of split frequencies = 0.032505
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 306
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 44 patterns at 102 / 102 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 44 patterns at 102 / 102 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
42944 bytes for conP
3872 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.029816 0.055163 0.081096 0.073770 0.038255 0.086312 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -432.729522
Iterating by ming2
Initial: fx= 432.729522
x= 0.02982 0.05516 0.08110 0.07377 0.03826 0.08631 0.30000 1.30000
1 h-m-p 0.0000 0.0003 243.2446 +++ 415.022435 m 0.0003 14 | 1/8
2 h-m-p 0.0032 0.0179 20.8470 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 223.0659 ++ 410.808466 m 0.0001 46 | 2/8
4 h-m-p 0.0011 0.0285 15.5164 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 199.5636 +++ 404.023932 m 0.0002 78 | 3/8
6 h-m-p 0.0024 0.0413 12.2375 ------------.. | 3/8
7 h-m-p 0.0000 0.0002 173.1815 +++ 398.379687 m 0.0002 111 | 4/8
8 h-m-p 0.0030 0.0843 8.8489 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 141.8219 ++ 396.888700 m 0.0001 143 | 5/8
10 h-m-p 0.0013 0.2332 5.8778 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 100.3750 ++ 396.356643 m 0.0001 174 | 6/8
12 h-m-p 0.4794 8.0000 0.0000 Y 396.356643 0 0.4794 185 | 6/8
13 h-m-p 0.7531 8.0000 0.0000 -----------Y 396.356643 0 0.0000 209
Out..
lnL = -396.356643
210 lfun, 210 eigenQcodon, 1260 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070764 0.013188 0.076933 0.081493 0.029784 0.079375 0.299940 0.733846 0.509635
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.295703
np = 9
lnL0 = -431.035117
Iterating by ming2
Initial: fx= 431.035117
x= 0.07076 0.01319 0.07693 0.08149 0.02978 0.07937 0.29994 0.73385 0.50964
1 h-m-p 0.0000 0.0001 238.6076 ++ 423.384248 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0007 121.1154 ++ 415.268236 m 0.0007 26 | 2/9
3 h-m-p 0.0001 0.0007 157.2467 ++ 399.815655 m 0.0007 38 | 3/9
4 h-m-p 0.0005 0.0023 51.8451 ++ 396.472434 m 0.0023 50 | 4/9
5 h-m-p 0.0000 0.0000 411.4012 ++ 396.410916 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 4316.8904 ++ 396.356632 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0005 ++ 396.356632 m 8.0000 86 | 6/9
8 h-m-p 0.0392 2.1436 0.0975 +++ 396.356626 m 2.1436 102 | 7/9
9 h-m-p 0.5131 8.0000 0.0671 ----------Y 396.356626 0 0.0000 127 | 7/9
10 h-m-p 0.0160 8.0000 0.0001 --------Y 396.356626 0 0.0000 149
Out..
lnL = -396.356626
150 lfun, 450 eigenQcodon, 1800 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.032428 0.014929 0.057098 0.102051 0.076388 0.081487 0.273960 0.987756 0.166050 0.489809 1.382760
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.184704
np = 11
lnL0 = -431.970924
Iterating by ming2
Initial: fx= 431.970924
x= 0.03243 0.01493 0.05710 0.10205 0.07639 0.08149 0.27396 0.98776 0.16605 0.48981 1.38276
1 h-m-p 0.0000 0.0002 234.1871 ++ 423.448211 m 0.0002 16 | 1/11
2 h-m-p 0.0002 0.0010 102.1234 ++ 414.784654 m 0.0010 30 | 2/11
3 h-m-p 0.0001 0.0004 205.6017 ++ 405.911647 m 0.0004 44 | 3/11
4 h-m-p 0.0004 0.0019 96.0792 ++ 399.037920 m 0.0019 58 | 4/11
5 h-m-p 0.0000 0.0000 2134.3732 ++ 398.063746 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0001 2575.1481 ++ 397.134437 m 0.0001 86 | 6/11
7 h-m-p 0.0041 0.0645 9.3376 ------------.. | 6/11
8 h-m-p 0.0000 0.0001 99.4752 ++ 396.356635 m 0.0001 124 | 7/11
9 h-m-p 0.0845 8.0000 0.0000 ++++ 396.356635 m 8.0000 140 | 7/11
10 h-m-p 0.0735 8.0000 0.0004 ++++ 396.356635 m 8.0000 160 | 7/11
11 h-m-p 0.0010 0.5012 7.9781 ----------C 396.356635 0 0.0000 188 | 7/11
12 h-m-p 0.0160 8.0000 0.0004 +++++ 396.356635 m 8.0000 205 | 7/11
13 h-m-p 0.0013 0.6261 12.1772 -----------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 396.356635 m 8.0000 249 | 7/11
15 h-m-p 0.0160 8.0000 0.0159 +++++ 396.356634 m 8.0000 270 | 7/11
16 h-m-p 0.0731 8.0000 1.7418 --------------.. | 7/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 396.356634 m 8.0000 317 | 7/11
18 h-m-p 0.0287 8.0000 0.0023 -----Y 396.356634 0 0.0000 340 | 7/11
19 h-m-p 0.0160 8.0000 0.0002 --------Y 396.356634 0 0.0000 366 | 7/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 396.356634 m 8.0000 387 | 7/11
21 h-m-p 0.0160 8.0000 1.2282 ----------Y 396.356634 0 0.0000 415 | 7/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 396.356634 m 8.0000 432 | 7/11
23 h-m-p 0.0160 8.0000 0.0904 +++++ 396.356629 m 8.0000 453 | 7/11
24 h-m-p 0.1411 0.7057 3.8584 ------------Y 396.356629 0 0.0000 483 | 7/11
25 h-m-p 0.0160 8.0000 0.0001 +++++ 396.356629 m 8.0000 500 | 7/11
26 h-m-p 0.0006 0.2756 7.1703 --------Y 396.356629 0 0.0000 526 | 7/11
27 h-m-p 0.0160 8.0000 0.0002 ---Y 396.356629 0 0.0001 543 | 7/11
28 h-m-p 0.0160 8.0000 0.0005 ----N 396.356629 0 0.0000 565
Out..
lnL = -396.356629
566 lfun, 2264 eigenQcodon, 10188 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -396.363753 S = -396.355722 -0.003071
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:04
did 20 / 44 patterns 0:04
did 30 / 44 patterns 0:04
did 40 / 44 patterns 0:04
did 44 / 44 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.050971 0.026320 0.106975 0.089653 0.037074 0.074429 0.188555 0.443281 1.150676
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.938355
np = 9
lnL0 = -433.054052
Iterating by ming2
Initial: fx= 433.054052
x= 0.05097 0.02632 0.10698 0.08965 0.03707 0.07443 0.18855 0.44328 1.15068
1 h-m-p 0.0000 0.0003 223.6975 +++ 418.601515 m 0.0003 15 | 1/9
2 h-m-p 0.0023 0.0123 24.6274 ++ 415.482776 m 0.0123 27 | 2/9
3 h-m-p 0.0001 0.0003 224.1185 ++ 413.672951 m 0.0003 39 | 3/9
4 h-m-p 0.0000 0.0000 8286.2147 ++ 413.556753 m 0.0000 51 | 4/9
5 h-m-p 0.0015 0.0089 24.0368 ++ 397.996454 m 0.0089 63 | 5/9
6 h-m-p 0.0001 0.0006 50.6278 ++ 397.553755 m 0.0006 75 | 6/9
7 h-m-p 0.0027 0.1018 11.2618 ------------.. | 6/9
8 h-m-p 0.0000 0.0001 98.6778 ++ 396.356623 m 0.0001 109 | 7/9
9 h-m-p 1.3056 8.0000 0.0000 ++ 396.356623 m 8.0000 121 | 7/9
10 h-m-p 0.2415 8.0000 0.0001 +++ 396.356623 m 8.0000 136 | 7/9
11 h-m-p 0.0160 8.0000 0.3330 +++++ 396.356621 m 8.0000 153 | 7/9
12 h-m-p 1.6000 8.0000 0.1778 ++ 396.356621 m 8.0000 167 | 7/9
13 h-m-p 1.1685 8.0000 1.2173 ++ 396.356621 m 8.0000 181 | 7/9
14 h-m-p 1.6000 8.0000 3.6151 ++ 396.356621 m 8.0000 193 | 7/9
15 h-m-p 1.6000 8.0000 2.1953 ---------Y 396.356621 0 0.0000 214 | 7/9
16 h-m-p 1.3026 8.0000 0.0000 C 396.356621 0 0.3257 226 | 7/9
17 h-m-p 1.6000 8.0000 0.0000 Y 396.356621 0 1.6000 240
Out..
lnL = -396.356621
241 lfun, 2651 eigenQcodon, 14460 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.014963 0.091119 0.091516 0.049888 0.054464 0.075686 0.000100 0.900000 0.621523 1.205255 1.299961
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.322888
np = 11
lnL0 = -432.014519
Iterating by ming2
Initial: fx= 432.014519
x= 0.01496 0.09112 0.09152 0.04989 0.05446 0.07569 0.00011 0.90000 0.62152 1.20525 1.29996
1 h-m-p 0.0000 0.0000 219.6801 ++ 431.729104 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0019 70.9298 ++++ 423.610746 m 0.0019 32 | 2/11
3 h-m-p 0.0003 0.0014 91.4913 ++ 406.754618 m 0.0014 46 | 3/11
4 h-m-p 0.0003 0.0013 53.5884 ++ 405.202382 m 0.0013 60 | 4/11
5 h-m-p 0.0000 0.0000 8184.0234 ++ 399.683110 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 6001.9898 ++ 397.122101 m 0.0000 88 | 6/11
7 h-m-p 0.0170 0.0852 9.5698 -------------.. | 6/11
8 h-m-p 0.0000 0.0000 140.2557 ++ 396.401712 m 0.0000 127 | 7/11
9 h-m-p 0.0016 0.1258 2.2148 -----------.. | 7/11
10 h-m-p 0.0000 0.0000 99.9818 ++ 396.356633 m 0.0000 164 | 8/11
11 h-m-p 0.0160 8.0000 0.0000 N 396.356633 0 0.0160 178 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 396.356633 m 8.0000 198 | 8/11
13 h-m-p 0.0160 8.0000 0.0440 +++++ 396.356632 m 8.0000 218 | 8/11
14 h-m-p 0.8363 5.3830 0.4212 ---------------Y 396.356632 0 0.0000 250 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 396.356632 m 8.0000 270 | 8/11
16 h-m-p 0.0047 2.3665 0.1683 +++++ 396.356630 m 2.3665 290 | 9/11
17 h-m-p 0.1725 1.8720 0.3304 ---------------.. | 9/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 396.356630 m 8.0000 339 | 9/11
19 h-m-p 0.0031 1.5736 0.3932 ------------.. | 9/11
20 h-m-p 0.0160 8.0000 0.0000 +++++ 396.356630 m 8.0000 384 | 9/11
21 h-m-p 0.0033 1.6383 0.3778 ----------Y 396.356630 0 0.0000 410 | 9/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 396.356630 m 8.0000 429 | 9/11
23 h-m-p 0.0024 1.2017 0.7673 ----------N 396.356630 0 0.0000 455 | 9/11
24 h-m-p 0.0160 8.0000 0.0001 +++++ 396.356630 m 8.0000 474 | 9/11
25 h-m-p 0.0032 1.5945 0.4823 ---------C 396.356630 0 0.0000 499 | 9/11
26 h-m-p 0.0160 8.0000 0.0002 -------N 396.356630 0 0.0000 522 | 9/11
27 h-m-p 0.0160 8.0000 0.0000 +++++ 396.356630 m 8.0000 541 | 9/11
28 h-m-p 0.0032 1.6237 0.3841 ----------Y 396.356630 0 0.0000 567 | 9/11
29 h-m-p 0.0160 8.0000 0.0001 ------Y 396.356630 0 0.0000 589 | 9/11
30 h-m-p 0.0160 8.0000 0.0000 +++++ 396.356630 m 8.0000 608 | 9/11
31 h-m-p 0.0025 1.2695 0.6091 ---------Y 396.356630 0 0.0000 633 | 9/11
32 h-m-p 0.0160 8.0000 0.0001 +++++ 396.356630 m 8.0000 652 | 9/11
33 h-m-p 0.0031 1.5255 0.4947 ----------Y 396.356630 0 0.0000 678 | 9/11
34 h-m-p 0.0160 8.0000 0.0000 +++++ 396.356630 m 8.0000 697 | 9/11
35 h-m-p 0.0018 0.8863 0.9518 ----------C 396.356630 0 0.0000 723 | 9/11
36 h-m-p 0.0160 8.0000 0.0000 +++++ 396.356630 m 8.0000 742 | 9/11
37 h-m-p 0.0027 1.3284 0.6746 ---------Y 396.356630 0 0.0000 767 | 9/11
38 h-m-p 0.0160 8.0000 0.0001 +++++ 396.356630 m 8.0000 786 | 9/11
39 h-m-p 0.0032 1.5915 0.5456 -----------Y 396.356630 0 0.0000 813 | 9/11
40 h-m-p 0.0160 8.0000 0.0000 +++++ 396.356630 m 8.0000 832 | 9/11
41 h-m-p 0.0005 0.2267 3.1292 +++++ 396.356608 m 0.2267 851 | 10/11
42 h-m-p 1.6000 8.0000 0.0000 N 396.356608 0 1.6000 865 | 10/11
43 h-m-p 0.0160 8.0000 0.0000 Y 396.356608 0 0.0160 880
Out..
lnL = -396.356608
881 lfun, 10572 eigenQcodon, 58146 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -396.376124 S = -396.356910 -0.008448
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:21
did 20 / 44 patterns 0:22
did 30 / 44 patterns 0:22
did 40 / 44 patterns 0:22
did 44 / 44 patterns 0:22
Time used: 0:22
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=102
NC_011896_1_WP_010907781_1_556_MLBR_RS02635 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
NC_002677_1_NP_301457_1_329_PE MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
NZ_LVXE01000008_1_WP_010907781_1_2726_A3216_RS04425 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
NZ_LYPH01000055_1_WP_010907781_1_2053_A8144_RS09830 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
NZ_CP029543_1_WP_010907781_1_570_DIJ64_RS02910 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
NZ_AP014567_1_WP_010907781_1_588_JK2ML_RS03000 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
**************************************************
NC_011896_1_WP_010907781_1_556_MLBR_RS02635 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
NC_002677_1_NP_301457_1_329_PE QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
NZ_LVXE01000008_1_WP_010907781_1_2726_A3216_RS04425 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
NZ_LYPH01000055_1_WP_010907781_1_2053_A8144_RS09830 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
NZ_CP029543_1_WP_010907781_1_570_DIJ64_RS02910 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
NZ_AP014567_1_WP_010907781_1_588_JK2ML_RS03000 QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
**************************************************
NC_011896_1_WP_010907781_1_556_MLBR_RS02635 GL
NC_002677_1_NP_301457_1_329_PE GL
NZ_LVXE01000008_1_WP_010907781_1_2726_A3216_RS04425 GL
NZ_LYPH01000055_1_WP_010907781_1_2053_A8144_RS09830 GL
NZ_CP029543_1_WP_010907781_1_570_DIJ64_RS02910 GL
NZ_AP014567_1_WP_010907781_1_588_JK2ML_RS03000 GL
**
>NC_011896_1_WP_010907781_1_556_MLBR_RS02635 ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT GGGCTA >NC_002677_1_NP_301457_1_329_PE ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT GGGCTA >NZ_LVXE01000008_1_WP_010907781_1_2726_A3216_RS04425 ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT GGGCTA >NZ_LYPH01000055_1_WP_010907781_1_2053_A8144_RS09830 ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT GGGCTA >NZ_CP029543_1_WP_010907781_1_570_DIJ64_RS02910 ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT GGGCTA >NZ_AP014567_1_WP_010907781_1_588_JK2ML_RS03000 ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT GGGCTA
>NC_011896_1_WP_010907781_1_556_MLBR_RS02635 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG GL >NC_002677_1_NP_301457_1_329_PE MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG GL >NZ_LVXE01000008_1_WP_010907781_1_2726_A3216_RS04425 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG GL >NZ_LYPH01000055_1_WP_010907781_1_2053_A8144_RS09830 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG GL >NZ_CP029543_1_WP_010907781_1_570_DIJ64_RS02910 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG GL >NZ_AP014567_1_WP_010907781_1_588_JK2ML_RS03000 MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG GL
#NEXUS
[ID: 9127725198]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907781_1_556_MLBR_RS02635
NC_002677_1_NP_301457_1_329_PE
NZ_LVXE01000008_1_WP_010907781_1_2726_A3216_RS04425
NZ_LYPH01000055_1_WP_010907781_1_2053_A8144_RS09830
NZ_CP029543_1_WP_010907781_1_570_DIJ64_RS02910
NZ_AP014567_1_WP_010907781_1_588_JK2ML_RS03000
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907781_1_556_MLBR_RS02635,
2 NC_002677_1_NP_301457_1_329_PE,
3 NZ_LVXE01000008_1_WP_010907781_1_2726_A3216_RS04425,
4 NZ_LYPH01000055_1_WP_010907781_1_2053_A8144_RS09830,
5 NZ_CP029543_1_WP_010907781_1_570_DIJ64_RS02910,
6 NZ_AP014567_1_WP_010907781_1_588_JK2ML_RS03000
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06741753,2:0.07310637,3:0.06915039,4:0.06806135,5:0.06788619,6:0.06854878);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06741753,2:0.07310637,3:0.06915039,4:0.06806135,5:0.06788619,6:0.06854878);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -413.22 -416.15
2 -413.24 -416.64
--------------------------------------
TOTAL -413.23 -416.43
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893412 0.089697 0.378004 1.490698 0.857451 1467.01 1479.46 1.000
r(A<->C){all} 0.168571 0.019418 0.000101 0.452683 0.133660 192.04 247.46 1.003
r(A<->G){all} 0.159544 0.019322 0.000068 0.443841 0.123872 170.29 245.11 1.000
r(A<->T){all} 0.168504 0.021095 0.000340 0.463655 0.128234 209.28 248.90 1.000
r(C<->G){all} 0.166569 0.021447 0.000035 0.478987 0.124437 145.76 186.09 1.003
r(C<->T){all} 0.163120 0.020770 0.000021 0.475406 0.120855 133.26 151.94 1.001
r(G<->T){all} 0.173692 0.021294 0.000035 0.469612 0.131926 202.60 217.82 1.011
pi(A){all} 0.154126 0.000416 0.113746 0.192489 0.153706 1120.87 1236.07 1.001
pi(C){all} 0.242046 0.000590 0.194374 0.288774 0.242117 994.91 1110.42 1.000
pi(G){all} 0.354126 0.000726 0.299925 0.404674 0.353881 1338.91 1363.83 1.000
pi(T){all} 0.249701 0.000612 0.200545 0.298421 0.249272 1286.09 1341.58 1.000
alpha{1,2} 0.401400 0.221764 0.000154 1.343454 0.238121 896.79 1104.21 1.000
alpha{3} 0.456107 0.240622 0.000226 1.463940 0.300139 1356.35 1428.67 1.000
pinvar{all} 0.994574 0.000040 0.982326 0.999998 0.996670 1299.83 1340.39 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/PE/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 102
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 0 0 0 0 0 0
CTC 0 0 0 0 0 0 | CCC 2 2 2 2 2 2 | CAC 2 2 2 2 2 2 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 0 0 0 0 0 0 | CAG 3 3 3 3 3 3 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 2 2 2 2 2 2
ATC 3 3 3 3 3 3 | ACC 2 2 2 2 2 2 | AAC 1 1 1 1 1 1 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 1 1 1 1 1 1 | AAG 0 0 0 0 0 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 4 4 4 4 4 4 | Asp GAT 1 1 1 1 1 1 | Gly GGT 5 5 5 5 5 5
GTC 2 2 2 2 2 2 | GCC 4 4 4 4 4 4 | GAC 0 0 0 0 0 0 | GGC 5 5 5 5 5 5
GTA 1 1 1 1 1 1 | GCA 1 1 1 1 1 1 | Glu GAA 5 5 5 5 5 5 | GGA 2 2 2 2 2 2
GTG 5 5 5 5 5 5 | GCG 7 7 7 7 7 7 | GAG 3 3 3 3 3 3 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907781_1_556_MLBR_RS02635
position 1: T:0.14706 C:0.18627 A:0.14706 G:0.51961
position 2: T:0.30392 C:0.28431 A:0.20588 G:0.20588
position 3: T:0.29412 C:0.25490 A:0.10784 G:0.34314
Average T:0.24837 C:0.24183 A:0.15359 G:0.35621
#2: NC_002677_1_NP_301457_1_329_PE
position 1: T:0.14706 C:0.18627 A:0.14706 G:0.51961
position 2: T:0.30392 C:0.28431 A:0.20588 G:0.20588
position 3: T:0.29412 C:0.25490 A:0.10784 G:0.34314
Average T:0.24837 C:0.24183 A:0.15359 G:0.35621
#3: NZ_LVXE01000008_1_WP_010907781_1_2726_A3216_RS04425
position 1: T:0.14706 C:0.18627 A:0.14706 G:0.51961
position 2: T:0.30392 C:0.28431 A:0.20588 G:0.20588
position 3: T:0.29412 C:0.25490 A:0.10784 G:0.34314
Average T:0.24837 C:0.24183 A:0.15359 G:0.35621
#4: NZ_LYPH01000055_1_WP_010907781_1_2053_A8144_RS09830
position 1: T:0.14706 C:0.18627 A:0.14706 G:0.51961
position 2: T:0.30392 C:0.28431 A:0.20588 G:0.20588
position 3: T:0.29412 C:0.25490 A:0.10784 G:0.34314
Average T:0.24837 C:0.24183 A:0.15359 G:0.35621
#5: NZ_CP029543_1_WP_010907781_1_570_DIJ64_RS02910
position 1: T:0.14706 C:0.18627 A:0.14706 G:0.51961
position 2: T:0.30392 C:0.28431 A:0.20588 G:0.20588
position 3: T:0.29412 C:0.25490 A:0.10784 G:0.34314
Average T:0.24837 C:0.24183 A:0.15359 G:0.35621
#6: NZ_AP014567_1_WP_010907781_1_588_JK2ML_RS03000
position 1: T:0.14706 C:0.18627 A:0.14706 G:0.51961
position 2: T:0.30392 C:0.28431 A:0.20588 G:0.20588
position 3: T:0.29412 C:0.25490 A:0.10784 G:0.34314
Average T:0.24837 C:0.24183 A:0.15359 G:0.35621
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 0
TTC 12 | TCC 0 | TAC 6 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 24 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 0
CTC 0 | CCC 12 | CAC 12 | CGC 6
CTA 6 | CCA 6 | Gln Q CAA 0 | CGA 0
CTG 12 | CCG 0 | CAG 18 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 12
ATC 18 | ACC 12 | AAC 6 | AGC 0
ATA 0 | ACA 0 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 18 | ACG 6 | AAG 0 | AGG 0
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 24 | Asp D GAT 6 | Gly G GGT 30
GTC 12 | GCC 24 | GAC 0 | GGC 30
GTA 6 | GCA 6 | Glu E GAA 30 | GGA 12
GTG 30 | GCG 42 | GAG 18 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14706 C:0.18627 A:0.14706 G:0.51961
position 2: T:0.30392 C:0.28431 A:0.20588 G:0.20588
position 3: T:0.29412 C:0.25490 A:0.10784 G:0.34314
Average T:0.24837 C:0.24183 A:0.15359 G:0.35621
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -396.356643 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299940 1.299961
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907781_1_556_MLBR_RS02635: 0.000004, NC_002677_1_NP_301457_1_329_PE: 0.000004, NZ_LVXE01000008_1_WP_010907781_1_2726_A3216_RS04425: 0.000004, NZ_LYPH01000055_1_WP_010907781_1_2053_A8144_RS09830: 0.000004, NZ_CP029543_1_WP_010907781_1_570_DIJ64_RS02910: 0.000004, NZ_AP014567_1_WP_010907781_1_588_JK2ML_RS03000: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29994
omega (dN/dS) = 1.29996
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 216.1 89.9 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 216.1 89.9 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 216.1 89.9 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 216.1 89.9 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 216.1 89.9 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 216.1 89.9 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -396.356626 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.273960 0.764812 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907781_1_556_MLBR_RS02635: 0.000004, NC_002677_1_NP_301457_1_329_PE: 0.000004, NZ_LVXE01000008_1_WP_010907781_1_2726_A3216_RS04425: 0.000004, NZ_LYPH01000055_1_WP_010907781_1_2053_A8144_RS09830: 0.000004, NZ_CP029543_1_WP_010907781_1_570_DIJ64_RS02910: 0.000004, NZ_AP014567_1_WP_010907781_1_588_JK2ML_RS03000: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.27396
MLEs of dN/dS (w) for site classes (K=2)
p: 0.76481 0.23519
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 216.3 89.7 0.2352 0.0000 0.0000 0.0 0.0
7..2 0.000 216.3 89.7 0.2352 0.0000 0.0000 0.0 0.0
7..3 0.000 216.3 89.7 0.2352 0.0000 0.0000 0.0 0.0
7..4 0.000 216.3 89.7 0.2352 0.0000 0.0000 0.0 0.0
7..5 0.000 216.3 89.7 0.2352 0.0000 0.0000 0.0 0.0
7..6 0.000 216.3 89.7 0.2352 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -396.356629 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.188555 0.759219 0.101750 0.000001 1.615484
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907781_1_556_MLBR_RS02635: 0.000004, NC_002677_1_NP_301457_1_329_PE: 0.000004, NZ_LVXE01000008_1_WP_010907781_1_2726_A3216_RS04425: 0.000004, NZ_LYPH01000055_1_WP_010907781_1_2053_A8144_RS09830: 0.000004, NZ_CP029543_1_WP_010907781_1_570_DIJ64_RS02910: 0.000004, NZ_AP014567_1_WP_010907781_1_588_JK2ML_RS03000: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.18855
MLEs of dN/dS (w) for site classes (K=3)
p: 0.75922 0.10175 0.13903
w: 0.00000 1.00000 1.61548
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 216.9 89.1 0.3264 0.0000 0.0000 0.0 0.0
7..2 0.000 216.9 89.1 0.3264 0.0000 0.0000 0.0 0.0
7..3 0.000 216.9 89.1 0.3264 0.0000 0.0000 0.0 0.0
7..4 0.000 216.9 89.1 0.3264 0.0000 0.0000 0.0 0.0
7..5 0.000 216.9 89.1 0.3264 0.0000 0.0000 0.0 0.0
7..6 0.000 216.9 89.1 0.3264 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907781_1_556_MLBR_RS02635)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907781_1_556_MLBR_RS02635)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -396.356621 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 7.960400 42.937630
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907781_1_556_MLBR_RS02635: 0.000004, NC_002677_1_NP_301457_1_329_PE: 0.000004, NZ_LVXE01000008_1_WP_010907781_1_2726_A3216_RS04425: 0.000004, NZ_LYPH01000055_1_WP_010907781_1_2053_A8144_RS09830: 0.000004, NZ_CP029543_1_WP_010907781_1_570_DIJ64_RS02910: 0.000004, NZ_AP014567_1_WP_010907781_1_588_JK2ML_RS03000: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 7.96040 q = 42.93763
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.08177 0.10467 0.11999 0.13314 0.14562 0.15830 0.17200 0.18796 0.20892 0.24647
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 218.4 87.6 0.1559 0.0000 0.0000 0.0 0.0
7..2 0.000 218.4 87.6 0.1559 0.0000 0.0000 0.0 0.0
7..3 0.000 218.4 87.6 0.1559 0.0000 0.0000 0.0 0.0
7..4 0.000 218.4 87.6 0.1559 0.0000 0.0000 0.0 0.0
7..5 0.000 218.4 87.6 0.1559 0.0000 0.0000 0.0 0.0
7..6 0.000 218.4 87.6 0.1559 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -396.356608 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.994070 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907781_1_556_MLBR_RS02635: 0.000004, NC_002677_1_NP_301457_1_329_PE: 0.000004, NZ_LVXE01000008_1_WP_010907781_1_2726_A3216_RS04425: 0.000004, NZ_LYPH01000055_1_WP_010907781_1_2053_A8144_RS09830: 0.000004, NZ_CP029543_1_WP_010907781_1_570_DIJ64_RS02910: 0.000004, NZ_AP014567_1_WP_010907781_1_588_JK2ML_RS03000: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.99407
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 218.4 87.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 218.4 87.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 218.4 87.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 218.4 87.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 218.4 87.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 218.4 87.6 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907781_1_556_MLBR_RS02635)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:22
Model 1: NearlyNeutral -396.356626 Model 2: PositiveSelection -396.356629 Model 0: one-ratio -396.356643 Model 7: beta -396.356621 Model 8: beta&w>1 -396.356608 Model 0 vs 1 3.400000002784509E-5 Model 2 vs 1 5.999999984851456E-6 Model 8 vs 7 2.6000000048043148E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
