--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 12:35:03 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/PE/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -413.22          -416.15
2       -413.24          -416.64
--------------------------------------
TOTAL     -413.23          -416.43
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.893412    0.089697    0.378004    1.490698    0.857451   1467.01   1479.46    1.000
r(A<->C){all}   0.168571    0.019418    0.000101    0.452683    0.133660    192.04    247.46    1.003
r(A<->G){all}   0.159544    0.019322    0.000068    0.443841    0.123872    170.29    245.11    1.000
r(A<->T){all}   0.168504    0.021095    0.000340    0.463655    0.128234    209.28    248.90    1.000
r(C<->G){all}   0.166569    0.021447    0.000035    0.478987    0.124437    145.76    186.09    1.003
r(C<->T){all}   0.163120    0.020770    0.000021    0.475406    0.120855    133.26    151.94    1.001
r(G<->T){all}   0.173692    0.021294    0.000035    0.469612    0.131926    202.60    217.82    1.011
pi(A){all}      0.154126    0.000416    0.113746    0.192489    0.153706   1120.87   1236.07    1.001
pi(C){all}      0.242046    0.000590    0.194374    0.288774    0.242117    994.91   1110.42    1.000
pi(G){all}      0.354126    0.000726    0.299925    0.404674    0.353881   1338.91   1363.83    1.000
pi(T){all}      0.249701    0.000612    0.200545    0.298421    0.249272   1286.09   1341.58    1.000
alpha{1,2}      0.401400    0.221764    0.000154    1.343454    0.238121    896.79   1104.21    1.000
alpha{3}        0.456107    0.240622    0.000226    1.463940    0.300139   1356.35   1428.67    1.000
pinvar{all}     0.994574    0.000040    0.982326    0.999998    0.996670   1299.83   1340.39    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-396.356626
Model 2: PositiveSelection	-396.356629
Model 0: one-ratio	-396.356643
Model 7: beta	-396.356621
Model 8: beta&w>1	-396.356608


Model 0 vs 1	3.400000002784509E-5

Model 2 vs 1	5.999999984851456E-6

Model 8 vs 7	2.6000000048043148E-5
>C1
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C2
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C3
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C4
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C5
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C6
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=102 

C1              MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C2              MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C3              MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C4              MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C5              MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C6              MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
                **************************************************

C1              QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C2              QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C3              QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C4              QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C5              QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C6              QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
                **************************************************

C1              GL
C2              GL
C3              GL
C4              GL
C5              GL
C6              GL
                **




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  102 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  102 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3060]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3060]--->[3060]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.454 Mb, Max= 30.627 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C2              MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C3              MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C4              MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C5              MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
C6              MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
                **************************************************

C1              QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C2              QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C3              QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C4              QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C5              QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
C6              QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
                **************************************************

C1              GL
C2              GL
C3              GL
C4              GL
C5              GL
C6              GL
                **




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
C2              ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
C3              ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
C4              ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
C5              ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
C6              ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
                **************************************************

C1              CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
C2              CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
C3              CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
C4              CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
C5              CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
C6              CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
                **************************************************

C1              TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
C2              TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
C3              TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
C4              TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
C5              TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
C6              TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
                **************************************************

C1              CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
C2              CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
C3              CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
C4              CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
C5              CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
C6              CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
                **************************************************

C1              CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
C2              CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
C3              CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
C4              CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
C5              CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
C6              CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
                **************************************************

C1              TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
C2              TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
C3              TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
C4              TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
C5              TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
C6              TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
                **************************************************

C1              GGGCTA
C2              GGGCTA
C3              GGGCTA
C4              GGGCTA
C5              GGGCTA
C6              GGGCTA
                ******



>C1
ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
GGGCTA
>C2
ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
GGGCTA
>C3
ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
GGGCTA
>C4
ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
GGGCTA
>C5
ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
GGGCTA
>C6
ATGACGTTGGGAGTCATTCCCGAAGGCCTGGAAGGTGCCAGTGCTGTTAT
CGAAGCGTTGACCGCCCATCTGGCTACCGTGCATGCCGAAGCGGCTCCCT
TTATCATGGAGGTTATCCCACCTGGGTCTGGCTCGGTGTCGGTGCAGAAT
CAGGTTGGTTTCAACGTTCACGGTTGCCAGTATGTGGCGATGACTGCTCA
CGGGGCGGAGGAGCTTGGCCGCTGGGGCGTCGGAGTGGCCGAATCGGGTG
TTAGTTATGCGCTTCGGGATGCGTTCGCGGTAGCATCGTACCTTGGCGGT
GGGCTA
>C1
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C2
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C3
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C4
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C5
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL
>C6
MTLGVIPEGLEGASAVIEALTAHLATVHAEAAPFIMEVIPPGSGSVSVQN
QVGFNVHGCQYVAMTAHGAEELGRWGVGVAESGVSYALRDAFAVASYLGG
GL


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 306 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579782822
      Setting output file names to "/data/10res/PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 714912677
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9127725198
      Seed = 839034260
      Swapseed = 1579782822
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -684.842666 -- -24.965149
         Chain 2 -- -684.842666 -- -24.965149
         Chain 3 -- -684.842562 -- -24.965149
         Chain 4 -- -684.842626 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -684.842666 -- -24.965149
         Chain 2 -- -684.842626 -- -24.965149
         Chain 3 -- -684.842666 -- -24.965149
         Chain 4 -- -684.842626 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-684.843] (-684.843) (-684.843) (-684.843) * [-684.843] (-684.843) (-684.843) (-684.843) 
        500 -- (-422.562) (-421.458) (-427.416) [-422.879] * [-429.029] (-430.945) (-424.710) (-434.514) -- 0:00:00
       1000 -- (-422.792) (-421.447) (-420.479) [-422.603] * (-426.804) (-424.119) [-417.226] (-425.016) -- 0:00:00
       1500 -- (-423.795) (-419.819) (-421.244) [-421.927] * (-426.435) (-426.574) [-422.282] (-420.097) -- 0:00:00
       2000 -- (-422.843) (-420.722) [-424.323] (-421.698) * (-419.828) (-427.164) (-421.001) [-427.014] -- 0:00:00
       2500 -- (-425.450) (-419.790) [-421.109] (-434.973) * (-420.464) (-431.255) (-423.913) [-419.346] -- 0:00:00
       3000 -- (-424.145) (-419.817) (-420.668) [-420.280] * (-429.594) (-419.134) (-429.896) [-422.315] -- 0:00:00
       3500 -- [-421.017] (-421.905) (-421.166) (-420.678) * [-417.583] (-424.886) (-422.654) (-418.939) -- 0:00:00
       4000 -- [-423.731] (-426.730) (-429.325) (-426.469) * (-423.399) (-423.681) [-421.214] (-422.203) -- 0:00:00
       4500 -- [-427.997] (-419.383) (-427.052) (-422.962) * (-420.195) (-417.246) [-428.879] (-425.860) -- 0:00:00
       5000 -- (-427.224) (-418.879) (-424.975) [-418.604] * (-419.852) [-421.210] (-422.985) (-425.329) -- 0:00:00

      Average standard deviation of split frequencies: 0.074826

       5500 -- (-422.133) [-421.297] (-429.902) (-423.350) * [-415.549] (-419.643) (-425.402) (-426.074) -- 0:00:00
       6000 -- (-420.045) (-426.498) [-427.861] (-419.085) * (-428.776) (-419.303) [-419.145] (-423.577) -- 0:00:00
       6500 -- (-418.058) [-420.743] (-421.654) (-425.978) * (-424.889) (-423.049) [-423.531] (-419.236) -- 0:00:00
       7000 -- (-427.832) (-421.796) (-418.038) [-421.041] * (-423.424) (-419.188) (-424.370) [-420.224] -- 0:00:00
       7500 -- (-422.904) [-417.811] (-424.228) (-423.198) * (-423.081) (-432.066) (-426.059) [-425.823] -- 0:00:00
       8000 -- [-424.283] (-425.491) (-420.287) (-430.270) * (-434.756) (-417.633) [-421.114] (-425.739) -- 0:00:00
       8500 -- [-429.916] (-432.976) (-421.413) (-419.224) * [-418.994] (-426.717) (-424.096) (-432.196) -- 0:00:00
       9000 -- (-420.428) (-421.645) [-421.102] (-436.103) * [-419.954] (-418.371) (-421.390) (-425.728) -- 0:00:00
       9500 -- (-422.880) (-417.904) [-423.984] (-426.405) * (-422.170) (-422.578) (-424.652) [-422.363] -- 0:00:00
      10000 -- (-422.924) (-418.784) (-426.684) [-415.994] * [-421.682] (-430.207) (-437.882) (-427.623) -- 0:01:39

      Average standard deviation of split frequencies: 0.069448

      10500 -- (-420.356) (-432.417) (-423.609) [-420.004] * (-425.618) [-426.692] (-420.017) (-430.337) -- 0:01:34
      11000 -- (-423.727) [-423.097] (-423.039) (-426.850) * [-428.096] (-427.806) (-421.064) (-424.098) -- 0:01:29
      11500 -- (-427.405) (-422.948) [-418.229] (-421.093) * (-423.754) (-419.032) (-423.554) [-419.317] -- 0:01:25
      12000 -- (-425.662) [-422.387] (-444.745) (-417.195) * (-427.612) (-420.596) (-426.255) [-422.964] -- 0:01:22
      12500 -- (-421.858) (-425.104) (-430.831) [-419.473] * (-431.760) (-426.925) (-426.117) [-423.540] -- 0:01:19
      13000 -- (-423.283) (-424.472) (-423.924) [-421.891] * (-426.112) [-425.274] (-421.608) (-423.674) -- 0:01:15
      13500 -- (-420.728) [-420.739] (-425.892) (-421.399) * (-418.626) (-424.645) [-419.303] (-425.681) -- 0:01:13
      14000 -- (-424.449) [-420.981] (-425.186) (-421.572) * (-434.611) (-423.372) (-430.368) [-425.630] -- 0:01:10
      14500 -- (-429.648) (-435.187) [-423.233] (-425.700) * [-420.821] (-418.370) (-423.046) (-422.987) -- 0:01:07
      15000 -- [-420.474] (-425.700) (-423.218) (-431.605) * (-414.062) [-422.211] (-430.664) (-428.240) -- 0:01:05

      Average standard deviation of split frequencies: 0.045667

      15500 -- (-416.724) (-412.611) (-424.651) [-421.449] * (-413.022) [-420.043] (-426.519) (-412.105) -- 0:01:03
      16000 -- (-425.049) (-414.980) (-427.417) [-420.615] * (-412.749) (-423.084) [-419.596] (-414.258) -- 0:01:01
      16500 -- (-427.664) (-411.914) (-426.140) [-419.024] * (-414.022) (-418.555) (-429.670) [-417.588] -- 0:00:59
      17000 -- (-423.193) [-411.909] (-431.286) (-422.284) * (-412.616) (-439.171) [-428.205] (-416.389) -- 0:00:57
      17500 -- (-427.670) [-413.553] (-422.960) (-425.736) * (-413.223) (-420.932) (-420.462) [-415.744] -- 0:00:56
      18000 -- (-435.035) [-413.138] (-424.271) (-432.126) * (-413.034) [-426.316] (-419.808) (-414.880) -- 0:00:54
      18500 -- (-419.118) [-413.906] (-423.134) (-412.975) * (-412.232) (-428.573) (-422.092) [-412.585] -- 0:00:53
      19000 -- (-418.527) (-412.227) (-422.576) [-413.208] * [-413.529] (-427.229) (-419.776) (-413.020) -- 0:00:51
      19500 -- (-419.206) (-412.772) (-413.392) [-415.044] * (-412.975) [-427.723] (-415.600) (-414.672) -- 0:00:50
      20000 -- [-427.351] (-414.883) (-413.453) (-414.378) * (-413.170) [-421.217] (-414.712) (-417.040) -- 0:00:49

      Average standard deviation of split frequencies: 0.042769

      20500 -- (-425.192) (-413.284) [-413.593] (-413.106) * (-415.729) [-426.492] (-416.145) (-415.444) -- 0:00:47
      21000 -- (-424.441) [-413.068] (-414.438) (-415.223) * (-413.971) (-420.365) [-412.520] (-418.627) -- 0:00:46
      21500 -- (-414.526) [-412.318] (-411.702) (-412.608) * [-413.430] (-419.335) (-412.478) (-413.814) -- 0:00:45
      22000 -- (-414.163) (-414.978) (-413.620) [-411.868] * (-417.858) (-426.132) (-413.425) [-414.466] -- 0:00:44
      22500 -- (-416.390) [-414.663] (-416.626) (-413.310) * [-414.506] (-424.999) (-416.084) (-412.657) -- 0:00:43
      23000 -- [-415.988] (-413.916) (-415.130) (-415.655) * (-412.505) [-426.092] (-416.184) (-414.777) -- 0:00:42
      23500 -- (-413.724) (-412.740) [-414.686] (-414.233) * (-417.246) (-426.721) (-414.664) [-414.525] -- 0:00:41
      24000 -- (-412.779) (-412.661) [-415.852] (-414.428) * [-413.261] (-428.570) (-414.984) (-418.346) -- 0:00:40
      24500 -- (-413.613) (-412.364) [-413.058] (-414.195) * (-416.724) [-419.970] (-417.672) (-413.512) -- 0:00:39
      25000 -- (-413.469) (-415.371) [-418.705] (-412.666) * [-416.545] (-425.098) (-415.656) (-417.360) -- 0:00:39

      Average standard deviation of split frequencies: 0.045759

      25500 -- (-415.266) (-415.242) [-413.363] (-413.010) * (-414.248) (-424.980) [-412.483] (-413.206) -- 0:00:38
      26000 -- (-412.727) [-414.386] (-412.331) (-411.823) * (-413.581) (-427.464) [-414.841] (-417.472) -- 0:00:37
      26500 -- (-412.118) (-417.197) (-413.965) [-412.175] * [-415.359] (-424.901) (-412.957) (-419.444) -- 0:00:36
      27000 -- (-412.887) (-415.089) [-417.693] (-412.662) * (-412.238) (-428.745) [-412.989] (-413.537) -- 0:01:12
      27500 -- (-418.751) [-412.324] (-418.121) (-413.253) * (-414.439) [-422.358] (-414.625) (-414.434) -- 0:01:10
      28000 -- (-418.649) [-412.172] (-414.993) (-412.103) * (-414.790) (-430.905) (-415.060) [-414.150] -- 0:01:09
      28500 -- (-416.291) [-414.943] (-419.920) (-413.333) * (-414.355) (-418.417) [-414.771] (-411.865) -- 0:01:08
      29000 -- [-411.714] (-415.451) (-417.988) (-413.826) * [-412.650] (-424.968) (-413.257) (-419.732) -- 0:01:06
      29500 -- [-411.510] (-414.890) (-415.721) (-413.780) * (-414.180) (-423.910) [-415.155] (-417.491) -- 0:01:05
      30000 -- (-415.233) (-412.028) [-412.106] (-420.034) * (-413.996) [-417.759] (-412.883) (-413.330) -- 0:01:04

      Average standard deviation of split frequencies: 0.035136

      30500 -- (-416.668) [-415.365] (-413.209) (-421.084) * (-413.668) [-419.644] (-414.075) (-414.128) -- 0:01:03
      31000 -- [-414.615] (-415.250) (-412.433) (-417.244) * (-412.521) [-425.843] (-413.667) (-414.705) -- 0:01:02
      31500 -- [-414.343] (-414.294) (-413.436) (-413.707) * (-413.920) [-420.153] (-413.423) (-413.027) -- 0:01:01
      32000 -- [-413.892] (-414.992) (-414.176) (-415.597) * (-413.074) [-418.882] (-412.723) (-418.598) -- 0:01:00
      32500 -- (-415.939) (-415.076) (-414.339) [-413.118] * (-414.458) (-420.749) [-412.105] (-413.708) -- 0:00:59
      33000 -- (-413.889) (-414.496) (-415.204) [-415.627] * (-413.192) [-420.172] (-415.994) (-414.347) -- 0:00:58
      33500 -- (-412.944) (-414.007) [-415.645] (-415.110) * (-412.247) (-423.704) (-413.087) [-415.813] -- 0:00:57
      34000 -- [-414.732] (-413.012) (-415.927) (-415.534) * [-411.860] (-427.285) (-414.252) (-418.933) -- 0:00:56
      34500 -- (-413.356) (-414.341) (-413.543) [-411.875] * (-412.010) (-423.451) [-412.438] (-413.340) -- 0:00:55
      35000 -- (-413.337) (-417.459) (-413.475) [-412.619] * (-412.509) [-416.032] (-415.088) (-413.182) -- 0:00:55

      Average standard deviation of split frequencies: 0.038037

      35500 -- (-415.720) (-414.547) [-413.450] (-412.526) * [-415.267] (-423.877) (-414.148) (-413.467) -- 0:00:54
      36000 -- (-412.679) [-414.143] (-412.542) (-413.156) * [-417.444] (-422.245) (-412.292) (-421.096) -- 0:00:53
      36500 -- [-412.797] (-416.420) (-412.420) (-413.229) * (-413.792) [-425.419] (-412.538) (-414.660) -- 0:00:52
      37000 -- [-413.007] (-416.124) (-414.242) (-414.911) * (-413.112) (-423.583) [-415.750] (-416.560) -- 0:00:52
      37500 -- (-414.382) [-412.913] (-417.216) (-414.226) * (-414.251) (-424.452) [-412.291] (-412.950) -- 0:00:51
      38000 -- [-413.374] (-413.420) (-413.385) (-412.096) * [-412.565] (-426.044) (-412.316) (-415.214) -- 0:00:50
      38500 -- [-415.818] (-414.443) (-412.645) (-411.860) * [-414.457] (-419.818) (-411.711) (-414.785) -- 0:00:49
      39000 -- [-412.897] (-413.333) (-413.209) (-412.966) * (-413.181) [-422.130] (-415.426) (-416.380) -- 0:00:49
      39500 -- (-413.738) (-412.884) (-415.339) [-413.263] * (-414.151) [-421.288] (-412.790) (-414.784) -- 0:00:48
      40000 -- [-413.933] (-416.450) (-413.281) (-416.544) * (-413.730) (-427.863) [-413.676] (-415.251) -- 0:00:48

      Average standard deviation of split frequencies: 0.034196

      40500 -- [-412.185] (-415.649) (-417.043) (-414.726) * (-418.767) (-421.658) (-412.010) [-414.482] -- 0:00:47
      41000 -- [-412.817] (-413.199) (-414.489) (-413.825) * (-414.417) (-421.156) (-414.786) [-412.391] -- 0:00:46
      41500 -- (-413.435) [-414.337] (-413.118) (-414.092) * (-414.397) [-421.933] (-414.486) (-414.825) -- 0:00:46
      42000 -- (-416.058) [-414.825] (-412.350) (-417.135) * (-414.546) (-423.489) (-413.266) [-414.202] -- 0:00:45
      42500 -- (-412.566) (-415.963) (-415.524) [-411.805] * (-414.499) (-421.117) (-414.939) [-415.598] -- 0:00:45
      43000 -- (-415.326) (-416.311) [-419.289] (-413.573) * (-415.525) (-430.256) (-413.698) [-414.556] -- 0:00:44
      43500 -- [-413.627] (-413.917) (-418.085) (-414.312) * (-414.814) (-430.921) [-413.174] (-414.533) -- 0:00:43
      44000 -- (-412.489) (-413.673) (-414.446) [-414.460] * (-416.911) (-421.270) [-413.175] (-413.555) -- 0:00:43
      44500 -- (-413.722) (-412.888) (-413.490) [-414.074] * (-412.000) (-418.192) (-413.710) [-412.437] -- 0:01:04
      45000 -- (-414.919) [-412.086] (-412.824) (-413.966) * (-412.687) [-421.045] (-412.710) (-413.334) -- 0:01:03

      Average standard deviation of split frequencies: 0.033672

      45500 -- (-414.359) [-414.343] (-414.186) (-412.948) * (-412.526) (-421.675) (-412.069) [-417.125] -- 0:01:02
      46000 -- (-413.011) [-412.716] (-417.090) (-415.306) * (-414.317) (-420.852) [-414.947] (-413.996) -- 0:01:02
      46500 -- (-413.290) [-416.050] (-413.143) (-421.484) * (-412.219) (-431.727) [-412.450] (-415.974) -- 0:01:01
      47000 -- (-412.705) (-412.484) [-412.951] (-412.949) * (-414.014) [-421.646] (-412.142) (-412.558) -- 0:01:00
      47500 -- [-413.473] (-413.371) (-413.586) (-418.768) * [-413.696] (-420.019) (-412.377) (-414.847) -- 0:01:00
      48000 -- [-412.378] (-412.943) (-415.791) (-413.325) * (-415.195) (-430.389) [-413.374] (-413.335) -- 0:00:59
      48500 -- (-414.200) (-414.402) [-413.431] (-412.623) * (-415.589) (-430.023) [-413.663] (-413.184) -- 0:00:58
      49000 -- (-412.159) [-411.897] (-417.396) (-415.121) * [-413.654] (-416.113) (-417.268) (-415.658) -- 0:00:58
      49500 -- (-412.330) (-411.839) (-415.070) [-412.967] * (-413.321) [-417.648] (-414.372) (-415.183) -- 0:00:57
      50000 -- (-415.214) (-414.420) (-413.037) [-412.191] * (-412.399) (-414.341) [-413.264] (-415.452) -- 0:00:57

      Average standard deviation of split frequencies: 0.029308

      50500 -- (-419.482) (-413.278) (-416.369) [-414.905] * (-413.627) (-415.127) (-412.510) [-412.973] -- 0:00:56
      51000 -- (-415.937) (-415.738) (-412.977) [-411.678] * (-412.056) [-413.135] (-416.036) (-416.395) -- 0:00:55
      51500 -- (-416.916) (-418.807) (-419.354) [-413.341] * (-416.510) (-416.432) (-414.285) [-413.054] -- 0:00:55
      52000 -- (-414.634) (-416.486) [-419.324] (-414.425) * (-412.982) [-413.466] (-414.204) (-412.706) -- 0:00:54
      52500 -- [-415.379] (-412.597) (-415.571) (-412.469) * (-414.045) (-416.454) (-412.726) [-413.582] -- 0:00:54
      53000 -- (-414.413) (-417.594) [-414.189] (-412.484) * (-413.630) (-414.547) [-412.941] (-419.559) -- 0:00:53
      53500 -- (-412.211) (-418.406) (-414.661) [-413.446] * (-413.246) [-414.738] (-416.165) (-411.808) -- 0:00:53
      54000 -- (-418.693) (-414.992) (-413.417) [-412.827] * [-413.648] (-412.147) (-415.013) (-412.691) -- 0:00:52
      54500 -- (-419.528) [-416.911] (-416.043) (-416.159) * (-415.774) (-419.433) (-414.140) [-412.180] -- 0:00:52
      55000 -- (-414.539) (-414.393) (-415.333) [-413.238] * [-412.892] (-422.503) (-412.339) (-413.987) -- 0:00:51

      Average standard deviation of split frequencies: 0.030127

      55500 -- [-413.997] (-413.733) (-413.481) (-412.328) * [-415.965] (-419.717) (-412.956) (-413.063) -- 0:00:51
      56000 -- (-413.992) [-417.179] (-415.241) (-413.658) * (-414.812) [-413.429] (-414.695) (-413.779) -- 0:00:50
      56500 -- (-417.105) (-413.179) (-413.093) [-413.800] * [-413.262] (-416.844) (-414.551) (-414.092) -- 0:00:50
      57000 -- [-414.712] (-412.289) (-413.069) (-417.531) * [-415.297] (-417.766) (-413.540) (-413.949) -- 0:00:49
      57500 -- (-413.347) (-412.344) (-412.727) [-415.450] * [-412.926] (-414.026) (-414.473) (-415.722) -- 0:00:49
      58000 -- (-415.292) (-412.920) (-415.832) [-415.753] * (-413.372) [-416.113] (-420.612) (-413.239) -- 0:00:48
      58500 -- (-419.020) (-415.753) [-412.810] (-413.790) * (-412.789) [-413.514] (-416.809) (-417.727) -- 0:00:48
      59000 -- (-416.412) [-413.065] (-414.963) (-413.617) * (-414.525) [-413.352] (-414.560) (-413.434) -- 0:00:47
      59500 -- (-413.241) [-413.000] (-415.327) (-412.722) * [-414.351] (-413.316) (-413.931) (-414.659) -- 0:00:47
      60000 -- [-416.038] (-415.783) (-411.710) (-412.954) * [-415.532] (-421.084) (-417.183) (-412.713) -- 0:00:47

      Average standard deviation of split frequencies: 0.028060

      60500 -- (-412.351) (-414.217) [-414.875] (-413.230) * (-414.709) (-418.095) (-412.744) [-412.010] -- 0:00:46
      61000 -- (-416.116) (-412.908) (-412.717) [-413.578] * (-412.752) [-415.907] (-414.725) (-413.043) -- 0:01:01
      61500 -- (-416.679) [-413.489] (-415.624) (-414.153) * (-412.544) [-412.722] (-413.949) (-417.130) -- 0:01:01
      62000 -- (-414.163) [-413.541] (-413.812) (-414.011) * (-413.758) [-413.708] (-415.855) (-412.937) -- 0:01:00
      62500 -- (-413.954) (-419.583) (-412.857) [-412.480] * [-412.580] (-415.289) (-413.240) (-415.380) -- 0:01:00
      63000 -- (-414.424) (-416.339) (-414.480) [-412.688] * (-414.934) [-414.159] (-412.506) (-417.314) -- 0:00:59
      63500 -- (-415.484) (-416.114) (-413.156) [-412.321] * [-413.971] (-413.513) (-414.623) (-417.682) -- 0:00:58
      64000 -- (-413.982) [-412.128] (-415.464) (-413.474) * (-411.988) (-412.312) (-412.585) [-413.302] -- 0:00:58
      64500 -- (-412.619) [-415.631] (-414.247) (-416.183) * (-413.044) (-415.705) (-412.661) [-413.933] -- 0:00:58
      65000 -- (-414.767) (-414.046) [-417.960] (-413.212) * [-413.944] (-414.144) (-412.803) (-412.657) -- 0:00:57

      Average standard deviation of split frequencies: 0.026189

      65500 -- (-414.362) (-413.276) (-413.620) [-414.296] * (-413.391) [-413.860] (-414.069) (-414.113) -- 0:00:57
      66000 -- [-415.756] (-412.490) (-413.835) (-412.913) * (-412.800) (-415.409) [-413.369] (-424.184) -- 0:00:56
      66500 -- (-416.756) [-413.447] (-413.677) (-412.718) * (-413.891) [-412.100] (-414.411) (-415.009) -- 0:00:56
      67000 -- [-415.149] (-412.921) (-413.234) (-414.640) * (-412.649) [-412.611] (-412.853) (-417.869) -- 0:00:55
      67500 -- (-415.462) [-412.608] (-412.373) (-413.051) * (-415.048) (-412.786) [-414.728] (-413.341) -- 0:00:55
      68000 -- [-415.701] (-415.045) (-415.911) (-413.777) * (-413.155) (-417.711) [-412.577] (-412.363) -- 0:00:54
      68500 -- (-418.378) (-411.622) [-413.177] (-411.862) * (-413.445) (-414.055) [-417.202] (-414.598) -- 0:00:54
      69000 -- (-416.303) (-413.675) (-414.484) [-416.236] * (-412.602) (-414.778) (-419.673) [-413.864] -- 0:00:53
      69500 -- (-416.573) (-414.547) [-416.376] (-413.794) * (-417.801) (-413.312) [-412.753] (-413.608) -- 0:00:53
      70000 -- (-413.107) (-413.767) (-414.872) [-413.052] * (-413.397) [-413.125] (-412.972) (-412.490) -- 0:00:53

      Average standard deviation of split frequencies: 0.028685

      70500 -- (-415.913) (-418.700) [-415.588] (-412.251) * (-412.981) (-413.241) (-412.989) [-413.491] -- 0:00:52
      71000 -- [-413.286] (-415.722) (-416.073) (-412.501) * [-413.645] (-413.963) (-412.621) (-416.575) -- 0:00:52
      71500 -- (-413.723) (-414.984) (-416.519) [-415.182] * (-412.446) (-414.381) [-413.700] (-413.263) -- 0:00:51
      72000 -- (-415.246) (-412.208) (-416.382) [-412.416] * (-415.101) (-414.341) [-413.894] (-414.619) -- 0:00:51
      72500 -- (-412.032) (-412.639) (-413.032) [-414.634] * [-414.241] (-415.011) (-413.396) (-413.664) -- 0:00:51
      73000 -- (-413.653) [-412.481] (-413.229) (-413.519) * (-421.665) (-414.238) (-416.737) [-413.157] -- 0:00:50
      73500 -- (-412.577) [-414.854] (-414.737) (-414.214) * (-416.213) (-413.110) (-414.210) [-413.021] -- 0:00:50
      74000 -- [-412.847] (-413.637) (-413.168) (-413.733) * (-416.292) (-413.459) (-416.709) [-414.571] -- 0:00:50
      74500 -- (-415.039) [-416.078] (-416.312) (-413.058) * (-414.373) (-414.039) (-415.700) [-413.057] -- 0:00:49
      75000 -- [-413.873] (-414.774) (-415.212) (-415.389) * (-412.048) (-417.602) [-413.599] (-417.746) -- 0:00:49

      Average standard deviation of split frequencies: 0.029708

      75500 -- (-415.313) (-413.528) [-417.000] (-416.893) * (-413.717) (-418.203) (-411.629) [-416.104] -- 0:00:48
      76000 -- (-415.787) (-412.640) [-414.178] (-412.759) * (-418.136) (-413.008) [-413.169] (-421.335) -- 0:00:48
      76500 -- (-415.920) (-413.798) [-412.902] (-416.063) * (-414.828) (-412.531) (-413.964) [-413.139] -- 0:00:48
      77000 -- (-418.542) (-412.308) (-412.273) [-416.300] * [-412.686] (-417.034) (-420.274) (-414.971) -- 0:00:47
      77500 -- (-419.084) [-412.341] (-413.291) (-419.507) * [-414.039] (-417.244) (-412.974) (-418.581) -- 0:00:47
      78000 -- (-415.316) (-412.185) (-412.465) [-412.859] * (-415.176) (-414.045) [-412.244] (-415.131) -- 0:00:59
      78500 -- (-413.551) [-412.202] (-419.449) (-412.372) * (-416.661) (-413.167) [-413.565] (-414.140) -- 0:00:58
      79000 -- (-414.741) (-412.944) (-412.955) [-413.880] * (-415.381) (-413.568) (-414.185) [-412.683] -- 0:00:58
      79500 -- (-416.257) [-414.164] (-417.335) (-413.663) * (-414.115) (-418.736) (-414.369) [-416.337] -- 0:00:57
      80000 -- (-414.279) (-419.699) (-415.407) [-413.124] * [-413.327] (-419.543) (-413.043) (-414.153) -- 0:00:57

      Average standard deviation of split frequencies: 0.030450

      80500 -- (-414.170) (-415.793) [-415.434] (-415.058) * [-412.784] (-424.104) (-413.559) (-413.123) -- 0:00:57
      81000 -- [-412.174] (-413.283) (-415.521) (-412.145) * (-413.093) (-413.544) [-414.320] (-414.154) -- 0:00:56
      81500 -- (-412.151) (-412.803) (-413.869) [-412.820] * [-413.150] (-411.964) (-413.921) (-413.062) -- 0:00:56
      82000 -- (-414.435) [-416.220] (-414.782) (-415.709) * [-415.644] (-414.764) (-412.843) (-414.787) -- 0:00:55
      82500 -- [-412.769] (-413.317) (-412.946) (-414.299) * (-418.907) (-411.671) (-414.902) [-413.064] -- 0:00:55
      83000 -- (-412.959) [-413.857] (-412.375) (-412.563) * (-414.839) (-413.373) (-414.702) [-412.197] -- 0:00:55
      83500 -- (-412.916) (-413.538) (-413.488) [-413.848] * (-415.308) (-412.790) (-415.183) [-412.504] -- 0:00:54
      84000 -- (-414.749) (-417.376) [-413.072] (-414.916) * (-415.560) [-412.844] (-413.826) (-413.481) -- 0:00:54
      84500 -- (-414.829) (-413.566) [-412.526] (-414.133) * (-412.407) [-414.664] (-412.017) (-413.404) -- 0:00:54
      85000 -- [-415.628] (-414.574) (-415.551) (-415.638) * (-419.701) (-412.232) (-413.719) [-414.428] -- 0:00:53

      Average standard deviation of split frequencies: 0.025319

      85500 -- [-414.570] (-415.473) (-412.703) (-414.255) * [-416.073] (-411.923) (-414.180) (-414.632) -- 0:00:53
      86000 -- (-414.647) (-417.068) (-414.412) [-413.200] * (-413.429) (-413.305) (-412.256) [-414.824] -- 0:00:53
      86500 -- (-414.990) (-416.300) (-415.961) [-412.565] * (-413.967) [-413.736] (-413.271) (-417.631) -- 0:00:52
      87000 -- (-414.635) (-415.148) (-412.270) [-415.650] * [-413.662] (-413.850) (-413.294) (-414.916) -- 0:00:52
      87500 -- (-414.876) [-421.544] (-413.815) (-413.462) * (-413.128) (-415.545) [-412.400] (-418.329) -- 0:00:52
      88000 -- (-414.109) [-416.668] (-412.013) (-412.856) * (-413.386) (-413.362) [-413.080] (-415.132) -- 0:00:51
      88500 -- (-412.286) (-411.900) [-415.281] (-413.754) * [-414.579] (-416.637) (-414.009) (-416.313) -- 0:00:51
      89000 -- (-412.262) [-413.409] (-415.402) (-413.526) * [-415.492] (-415.223) (-417.663) (-414.231) -- 0:00:51
      89500 -- (-414.881) (-414.390) [-412.922] (-415.604) * [-412.289] (-412.023) (-416.263) (-414.010) -- 0:00:50
      90000 -- [-414.810] (-412.607) (-415.619) (-420.892) * [-412.985] (-412.147) (-413.073) (-413.684) -- 0:00:50

      Average standard deviation of split frequencies: 0.024697

      90500 -- [-412.360] (-413.459) (-416.222) (-414.175) * (-413.593) (-417.062) (-413.345) [-414.906] -- 0:00:50
      91000 -- (-412.321) [-413.410] (-417.781) (-415.672) * (-413.226) (-411.930) (-416.736) [-414.727] -- 0:00:49
      91500 -- (-413.752) (-412.554) [-415.744] (-412.740) * (-413.230) [-413.375] (-413.840) (-417.391) -- 0:00:49
      92000 -- (-414.835) (-412.439) (-413.676) [-413.447] * [-413.686] (-413.365) (-414.197) (-420.640) -- 0:00:49
      92500 -- (-414.174) (-412.993) (-414.768) [-415.395] * [-413.488] (-415.029) (-413.272) (-417.345) -- 0:00:49
      93000 -- (-412.617) (-413.131) (-412.123) [-412.878] * [-413.879] (-414.286) (-413.527) (-418.519) -- 0:00:48
      93500 -- (-412.143) [-414.687] (-418.332) (-411.768) * (-412.544) [-412.559] (-415.925) (-418.951) -- 0:00:48
      94000 -- (-414.310) (-412.308) [-414.090] (-413.316) * (-416.923) (-413.958) (-415.302) [-414.980] -- 0:00:48
      94500 -- [-415.583] (-413.343) (-412.615) (-411.763) * (-413.786) (-412.716) (-413.809) [-415.923] -- 0:00:47
      95000 -- (-412.135) (-414.949) [-414.864] (-414.915) * (-415.688) (-413.667) (-413.234) [-415.073] -- 0:00:47

      Average standard deviation of split frequencies: 0.021824

      95500 -- (-411.643) (-413.188) (-413.593) [-412.551] * (-418.869) (-419.038) [-415.544] (-413.786) -- 0:00:56
      96000 -- (-412.097) (-415.143) [-413.517] (-414.688) * [-415.273] (-415.599) (-416.290) (-412.187) -- 0:00:56
      96500 -- (-412.603) (-414.217) [-411.827] (-413.038) * (-415.090) (-414.983) (-413.605) [-412.216] -- 0:00:56
      97000 -- (-412.953) (-415.684) [-414.403] (-417.196) * (-416.162) (-413.671) [-414.792] (-421.447) -- 0:00:55
      97500 -- (-413.237) (-415.289) (-412.019) [-413.035] * (-414.496) (-412.299) (-412.676) [-415.368] -- 0:00:55
      98000 -- (-416.304) (-416.444) [-413.051] (-413.504) * (-418.335) (-411.798) [-415.082] (-414.444) -- 0:00:55
      98500 -- [-413.505] (-414.557) (-413.764) (-414.601) * (-414.159) (-414.540) [-413.917] (-415.595) -- 0:00:54
      99000 -- [-416.961] (-412.627) (-414.626) (-415.785) * (-413.894) [-412.017] (-413.110) (-414.571) -- 0:00:54
      99500 -- [-418.182] (-414.369) (-413.718) (-413.574) * (-412.206) (-413.300) (-413.400) [-413.025] -- 0:00:54
      100000 -- (-412.430) (-414.591) [-412.935] (-413.985) * [-414.784] (-412.019) (-413.741) (-411.702) -- 0:00:54

      Average standard deviation of split frequencies: 0.022312

      100500 -- (-413.541) [-415.655] (-415.425) (-414.869) * (-415.210) (-414.762) (-415.959) [-414.389] -- 0:00:53
      101000 -- (-422.993) (-414.114) [-416.792] (-413.558) * (-412.984) (-412.276) [-414.747] (-415.409) -- 0:00:53
      101500 -- (-417.452) [-415.692] (-416.352) (-412.175) * [-414.233] (-412.798) (-417.904) (-417.762) -- 0:00:53
      102000 -- (-415.123) (-416.438) (-413.801) [-411.994] * (-412.116) (-412.709) [-415.880] (-412.797) -- 0:00:52
      102500 -- (-413.903) (-415.008) (-413.157) [-412.204] * (-413.012) (-415.971) (-415.247) [-413.196] -- 0:00:52
      103000 -- [-415.056] (-412.560) (-414.322) (-414.871) * (-412.051) (-413.029) [-415.004] (-412.167) -- 0:00:52
      103500 -- (-415.899) [-417.217] (-413.776) (-414.113) * (-415.069) (-413.595) (-415.037) [-412.512] -- 0:00:51
      104000 -- (-412.882) [-417.949] (-413.462) (-414.641) * [-414.938] (-413.429) (-414.539) (-414.029) -- 0:00:51
      104500 -- (-412.167) (-415.346) [-413.296] (-414.057) * (-413.794) (-413.679) (-413.131) [-411.884] -- 0:00:51
      105000 -- (-412.240) [-412.386] (-412.497) (-413.321) * [-413.521] (-414.305) (-413.672) (-412.333) -- 0:00:51

      Average standard deviation of split frequencies: 0.021495

      105500 -- (-412.237) [-412.718] (-414.733) (-420.239) * (-413.551) [-413.908] (-415.378) (-413.110) -- 0:00:50
      106000 -- (-412.883) [-412.750] (-412.296) (-421.027) * [-414.264] (-415.478) (-415.377) (-416.258) -- 0:00:50
      106500 -- (-412.911) (-412.812) (-416.527) [-412.669] * (-412.521) (-412.986) (-415.084) [-412.305] -- 0:00:50
      107000 -- (-413.517) (-419.976) [-414.750] (-418.435) * [-413.419] (-412.555) (-413.813) (-414.880) -- 0:00:50
      107500 -- [-412.247] (-417.662) (-421.521) (-414.826) * (-414.702) (-412.797) (-413.525) [-415.424] -- 0:00:49
      108000 -- (-414.026) (-414.130) (-415.952) [-413.264] * (-414.490) [-413.320] (-413.218) (-415.064) -- 0:00:49
      108500 -- [-411.771] (-417.475) (-415.436) (-412.248) * (-413.851) (-416.547) [-412.484] (-415.884) -- 0:00:49
      109000 -- (-413.060) (-415.520) [-416.290] (-415.262) * [-412.466] (-414.379) (-412.305) (-412.925) -- 0:00:49
      109500 -- (-414.258) (-417.630) [-413.372] (-414.483) * (-416.538) (-413.363) [-413.767] (-412.494) -- 0:00:48
      110000 -- (-415.501) (-413.352) (-413.668) [-413.599] * [-413.037] (-413.887) (-416.816) (-414.839) -- 0:00:48

      Average standard deviation of split frequencies: 0.019879

      110500 -- (-412.969) (-413.216) (-413.737) [-413.873] * (-415.510) [-414.470] (-415.968) (-414.218) -- 0:00:48
      111000 -- (-412.255) [-415.440] (-413.266) (-414.050) * (-414.244) (-414.246) [-414.579] (-414.252) -- 0:00:48
      111500 -- (-412.521) (-413.843) (-416.509) [-412.252] * [-416.396] (-414.547) (-415.969) (-413.970) -- 0:00:47
      112000 -- (-414.443) (-413.126) (-413.605) [-412.901] * [-412.726] (-413.421) (-414.643) (-414.532) -- 0:00:47
      112500 -- [-412.486] (-415.325) (-413.435) (-413.232) * [-414.550] (-416.825) (-415.640) (-414.067) -- 0:00:55
      113000 -- (-412.825) (-412.483) [-415.406] (-416.423) * (-413.941) (-414.711) (-412.392) [-412.737] -- 0:00:54
      113500 -- (-413.470) (-417.421) (-414.360) [-414.374] * (-414.065) [-416.968] (-419.927) (-417.179) -- 0:00:54
      114000 -- (-412.975) [-416.235] (-413.200) (-415.159) * [-413.146] (-413.874) (-419.706) (-414.525) -- 0:00:54
      114500 -- [-412.061] (-416.876) (-413.375) (-412.689) * [-412.627] (-413.607) (-413.276) (-414.725) -- 0:00:54
      115000 -- (-414.376) (-411.726) [-416.283] (-417.075) * (-413.210) (-412.068) (-412.138) [-414.776] -- 0:00:53

      Average standard deviation of split frequencies: 0.020558

      115500 -- [-411.882] (-413.739) (-414.496) (-414.054) * (-413.010) (-412.289) [-414.679] (-414.540) -- 0:00:53
      116000 -- (-419.734) (-417.475) [-414.465] (-412.043) * (-412.786) (-412.436) [-413.034] (-417.323) -- 0:00:53
      116500 -- [-411.779] (-412.104) (-416.287) (-413.150) * (-414.992) (-411.923) [-412.588] (-413.769) -- 0:00:53
      117000 -- (-412.321) [-412.330] (-419.139) (-414.540) * (-416.354) (-413.243) [-414.063] (-414.447) -- 0:00:52
      117500 -- (-417.538) [-414.190] (-414.126) (-413.046) * (-416.337) (-414.772) [-413.071] (-416.205) -- 0:00:52
      118000 -- (-416.853) (-412.369) (-415.524) [-411.650] * (-415.001) (-415.206) (-412.858) [-413.222] -- 0:00:52
      118500 -- [-415.703] (-412.891) (-413.603) (-417.844) * (-415.595) (-412.781) [-412.197] (-412.552) -- 0:00:52
      119000 -- [-413.725] (-415.518) (-412.938) (-412.881) * [-413.633] (-414.774) (-415.138) (-412.767) -- 0:00:51
      119500 -- [-412.243] (-414.228) (-413.499) (-414.029) * (-414.094) (-420.131) [-415.507] (-413.049) -- 0:00:51
      120000 -- (-412.319) [-413.015] (-413.975) (-413.017) * (-414.233) [-413.498] (-413.688) (-415.218) -- 0:00:51

      Average standard deviation of split frequencies: 0.018384

      120500 -- (-412.243) (-414.910) (-414.329) [-412.592] * (-412.778) (-415.217) [-414.295] (-413.410) -- 0:00:51
      121000 -- [-413.108] (-414.076) (-412.859) (-412.190) * [-415.786] (-413.386) (-413.644) (-414.217) -- 0:00:50
      121500 -- (-415.658) (-414.931) [-412.481] (-414.446) * (-414.047) [-413.085] (-411.708) (-412.322) -- 0:00:50
      122000 -- [-414.368] (-415.767) (-413.868) (-419.330) * [-412.009] (-416.408) (-412.562) (-414.634) -- 0:00:50
      122500 -- (-415.085) (-412.892) [-416.419] (-420.155) * (-412.332) (-417.226) (-416.748) [-415.537] -- 0:00:50
      123000 -- (-411.819) (-413.749) (-414.253) [-416.155] * (-413.645) [-415.741] (-416.690) (-415.377) -- 0:00:49
      123500 -- (-413.763) [-413.152] (-412.464) (-414.104) * (-413.608) [-416.074] (-412.397) (-417.717) -- 0:00:49
      124000 -- (-416.705) (-413.582) [-416.255] (-416.219) * (-419.176) (-411.823) [-412.526] (-415.134) -- 0:00:49
      124500 -- (-420.730) (-414.682) [-416.845] (-414.942) * (-418.174) (-415.942) [-417.671] (-414.344) -- 0:00:49
      125000 -- [-417.744] (-414.619) (-413.832) (-414.579) * (-413.678) (-414.327) [-413.102] (-412.822) -- 0:00:49

      Average standard deviation of split frequencies: 0.019954

      125500 -- (-414.585) (-414.162) [-418.623] (-413.486) * (-412.538) (-413.777) [-411.986] (-414.653) -- 0:00:48
      126000 -- (-416.712) (-412.682) (-414.865) [-415.709] * (-413.568) (-411.609) [-412.800] (-415.058) -- 0:00:48
      126500 -- [-414.150] (-413.136) (-413.210) (-415.709) * (-415.547) (-412.494) (-414.211) [-413.682] -- 0:00:48
      127000 -- [-413.992] (-414.842) (-414.863) (-412.576) * [-414.559] (-416.651) (-414.621) (-416.340) -- 0:00:48
      127500 -- [-414.163] (-412.068) (-414.202) (-415.796) * (-416.356) (-412.401) (-412.640) [-415.344] -- 0:00:47
      128000 -- (-420.197) (-413.687) (-412.649) [-419.800] * (-414.446) (-413.269) [-418.779] (-413.585) -- 0:00:47
      128500 -- [-412.861] (-416.529) (-413.305) (-413.447) * (-412.588) (-416.150) (-414.381) [-412.386] -- 0:00:47
      129000 -- (-413.883) (-412.778) (-414.259) [-414.085] * (-413.999) (-416.466) (-412.927) [-412.655] -- 0:00:47
      129500 -- (-415.579) (-413.542) (-414.031) [-413.866] * [-416.600] (-413.479) (-412.665) (-412.827) -- 0:00:53
      130000 -- (-416.339) (-412.198) [-413.821] (-413.687) * (-414.400) (-414.611) (-413.328) [-415.666] -- 0:00:53

      Average standard deviation of split frequencies: 0.019041

      130500 -- (-413.995) [-413.201] (-417.601) (-414.624) * (-412.610) [-415.531] (-413.389) (-414.527) -- 0:00:53
      131000 -- (-414.858) [-413.520] (-414.622) (-412.728) * [-412.228] (-414.534) (-414.133) (-415.253) -- 0:00:53
      131500 -- (-414.608) (-417.863) [-414.147] (-412.382) * (-414.590) (-412.179) (-413.825) [-416.119] -- 0:00:52
      132000 -- (-413.926) (-413.301) [-413.849] (-414.189) * [-415.484] (-413.226) (-415.844) (-417.455) -- 0:00:52
      132500 -- (-412.360) [-413.443] (-414.768) (-412.929) * (-412.322) (-415.416) [-412.521] (-413.165) -- 0:00:52
      133000 -- (-415.254) (-416.348) (-412.706) [-413.037] * [-414.826] (-412.916) (-414.971) (-414.893) -- 0:00:52
      133500 -- (-413.468) (-414.244) [-412.933] (-416.449) * (-417.292) (-415.221) [-412.956] (-412.015) -- 0:00:51
      134000 -- [-412.138] (-412.440) (-411.906) (-415.624) * [-415.924] (-414.433) (-414.517) (-419.874) -- 0:00:51
      134500 -- (-415.269) (-416.465) (-413.028) [-413.814] * (-413.398) (-413.077) (-412.784) [-412.275] -- 0:00:51
      135000 -- (-413.511) (-413.972) (-415.998) [-412.917] * [-412.651] (-412.462) (-412.893) (-413.154) -- 0:00:51

      Average standard deviation of split frequencies: 0.019574

      135500 -- (-418.092) [-413.286] (-415.223) (-413.081) * (-412.422) (-413.647) [-415.980] (-413.725) -- 0:00:51
      136000 -- (-415.398) (-417.498) (-415.194) [-413.177] * (-414.734) [-413.755] (-414.579) (-415.438) -- 0:00:50
      136500 -- [-412.937] (-413.349) (-415.870) (-420.756) * (-412.604) [-412.842] (-413.775) (-413.839) -- 0:00:50
      137000 -- [-413.768] (-413.602) (-413.124) (-415.902) * (-415.206) (-413.830) [-415.640] (-414.932) -- 0:00:50
      137500 -- (-417.044) (-411.999) (-415.345) [-413.156] * [-416.595] (-413.851) (-419.749) (-413.915) -- 0:00:50
      138000 -- (-411.817) (-414.454) [-414.498] (-412.497) * (-413.455) (-413.070) (-412.602) [-412.049] -- 0:00:49
      138500 -- [-411.970] (-412.073) (-413.201) (-415.880) * (-412.902) (-417.711) (-412.258) [-414.636] -- 0:00:49
      139000 -- (-413.547) (-411.915) (-418.339) [-413.465] * (-412.174) [-413.288] (-413.166) (-415.314) -- 0:00:49
      139500 -- (-414.471) (-412.607) [-414.458] (-415.437) * [-413.197] (-412.836) (-417.387) (-413.598) -- 0:00:49
      140000 -- [-413.177] (-414.685) (-413.011) (-413.089) * (-412.475) [-415.302] (-415.108) (-415.299) -- 0:00:49

      Average standard deviation of split frequencies: 0.019549

      140500 -- (-413.030) (-412.729) [-413.880] (-418.841) * (-413.446) [-414.362] (-413.710) (-411.976) -- 0:00:48
      141000 -- [-412.870] (-413.457) (-419.605) (-413.809) * [-413.906] (-414.128) (-413.653) (-411.770) -- 0:00:48
      141500 -- (-414.002) [-413.980] (-416.881) (-412.770) * [-413.273] (-414.958) (-417.491) (-412.726) -- 0:00:48
      142000 -- (-413.311) (-412.994) [-414.572] (-412.754) * (-414.776) (-412.138) (-414.844) [-418.873] -- 0:00:48
      142500 -- [-414.675] (-414.922) (-413.913) (-417.161) * (-415.563) (-414.672) [-416.532] (-414.492) -- 0:00:48
      143000 -- (-413.570) (-412.832) (-416.601) [-418.305] * [-415.079] (-413.820) (-414.638) (-417.724) -- 0:00:47
      143500 -- (-414.801) (-412.167) [-416.612] (-414.675) * (-413.820) (-415.089) (-415.563) [-413.259] -- 0:00:47
      144000 -- (-425.609) [-413.095] (-417.858) (-412.853) * [-414.557] (-412.666) (-415.873) (-414.824) -- 0:00:47
      144500 -- (-414.867) (-413.936) (-413.916) [-414.648] * (-413.670) (-412.873) (-412.500) [-412.265] -- 0:00:47
      145000 -- (-416.334) (-412.602) [-415.348] (-413.848) * (-412.443) (-414.356) (-412.999) [-413.655] -- 0:00:47

      Average standard deviation of split frequencies: 0.017758

      145500 -- [-411.973] (-415.109) (-418.204) (-412.368) * [-413.347] (-412.545) (-414.565) (-414.877) -- 0:00:46
      146000 -- (-413.379) (-418.393) (-419.341) [-412.038] * [-412.617] (-412.440) (-413.403) (-412.971) -- 0:00:46
      146500 -- [-413.673] (-415.224) (-413.180) (-416.822) * [-412.955] (-417.193) (-416.026) (-412.454) -- 0:00:52
      147000 -- (-416.517) (-414.263) [-412.493] (-415.031) * [-413.231] (-412.748) (-413.418) (-416.465) -- 0:00:52
      147500 -- (-415.574) (-417.950) (-414.870) [-412.998] * (-413.243) [-411.764] (-414.434) (-418.459) -- 0:00:52
      148000 -- [-415.640] (-412.353) (-413.614) (-413.692) * [-413.698] (-417.909) (-413.150) (-414.179) -- 0:00:51
      148500 -- (-414.416) (-412.933) (-414.628) [-413.320] * (-413.965) (-415.051) [-413.050] (-412.568) -- 0:00:51
      149000 -- [-413.323] (-413.807) (-415.438) (-414.024) * (-412.499) [-412.903] (-414.854) (-419.516) -- 0:00:51
      149500 -- (-413.027) [-413.701] (-417.111) (-415.260) * [-414.131] (-412.463) (-417.872) (-412.812) -- 0:00:51
      150000 -- (-415.839) [-413.379] (-416.392) (-415.518) * (-411.722) (-412.903) (-413.838) [-412.787] -- 0:00:51

      Average standard deviation of split frequencies: 0.019596

      150500 -- (-412.258) (-415.399) (-414.041) [-412.849] * (-413.515) (-414.405) [-412.401] (-415.357) -- 0:00:50
      151000 -- (-414.826) (-418.315) [-416.559] (-415.497) * (-414.074) [-413.992] (-413.412) (-413.538) -- 0:00:50
      151500 -- (-414.093) [-413.135] (-413.104) (-415.160) * (-422.891) (-417.560) [-412.254] (-411.929) -- 0:00:50
      152000 -- [-415.389] (-414.266) (-412.671) (-413.362) * (-416.688) [-414.606] (-413.995) (-415.549) -- 0:00:50
      152500 -- (-413.717) (-415.212) [-415.193] (-413.012) * [-413.439] (-412.058) (-412.295) (-413.921) -- 0:00:50
      153000 -- (-412.617) (-416.824) [-415.655] (-413.955) * (-413.556) [-416.191] (-413.099) (-419.191) -- 0:00:49
      153500 -- [-414.465] (-415.810) (-415.917) (-411.857) * (-414.904) (-412.899) (-418.761) [-414.996] -- 0:00:49
      154000 -- [-412.609] (-417.790) (-418.697) (-415.009) * (-414.601) (-413.815) [-413.716] (-412.543) -- 0:00:49
      154500 -- (-415.367) [-415.017] (-413.421) (-412.543) * (-416.783) [-414.568] (-414.889) (-415.480) -- 0:00:49
      155000 -- (-412.590) (-413.045) [-413.705] (-414.011) * (-414.674) (-414.372) [-413.151] (-412.716) -- 0:00:49

      Average standard deviation of split frequencies: 0.019721

      155500 -- (-413.449) [-416.101] (-418.905) (-415.119) * (-412.402) [-413.244] (-415.267) (-413.074) -- 0:00:48
      156000 -- (-413.397) (-415.109) [-416.725] (-413.300) * [-412.312] (-412.822) (-413.410) (-411.679) -- 0:00:48
      156500 -- (-415.080) (-414.904) (-414.076) [-413.552] * (-413.832) (-413.111) (-413.499) [-412.428] -- 0:00:48
      157000 -- (-413.798) [-413.915] (-412.267) (-415.120) * (-413.594) (-412.832) [-412.024] (-416.923) -- 0:00:48
      157500 -- [-415.011] (-414.654) (-413.258) (-412.812) * [-418.300] (-413.060) (-413.482) (-416.654) -- 0:00:48
      158000 -- (-414.784) (-414.305) [-412.451] (-413.411) * [-413.109] (-414.459) (-412.946) (-418.791) -- 0:00:47
      158500 -- [-412.566] (-416.249) (-415.080) (-412.457) * (-413.010) (-415.273) [-414.720] (-415.560) -- 0:00:47
      159000 -- (-413.826) (-413.889) (-413.362) [-412.182] * (-415.508) (-413.590) [-414.819] (-415.054) -- 0:00:47
      159500 -- (-420.356) (-413.999) [-414.299] (-415.445) * [-413.062] (-413.653) (-417.135) (-413.369) -- 0:00:47
      160000 -- (-412.768) [-417.275] (-414.298) (-415.989) * (-413.167) (-415.403) (-415.543) [-412.440] -- 0:00:47

      Average standard deviation of split frequencies: 0.019397

      160500 -- [-416.368] (-412.268) (-412.510) (-412.726) * (-412.628) (-416.612) (-412.746) [-415.823] -- 0:00:47
      161000 -- [-414.249] (-412.526) (-415.178) (-413.491) * [-414.797] (-412.917) (-413.081) (-416.606) -- 0:00:46
      161500 -- (-418.584) (-414.477) (-413.235) [-416.803] * [-413.551] (-415.596) (-413.896) (-412.668) -- 0:00:46
      162000 -- [-412.846] (-412.532) (-414.229) (-419.482) * (-413.012) (-412.826) (-413.904) [-413.446] -- 0:00:46
      162500 -- (-412.559) (-414.182) (-413.117) [-417.377] * (-412.399) [-413.263] (-413.729) (-415.464) -- 0:00:46
      163000 -- (-413.437) (-415.896) [-413.239] (-414.236) * (-413.182) [-413.457] (-412.674) (-415.427) -- 0:00:46
      163500 -- [-413.810] (-413.475) (-411.982) (-414.664) * (-415.415) (-412.733) (-414.850) [-414.092] -- 0:00:46
      164000 -- [-412.453] (-412.992) (-412.674) (-414.592) * (-414.716) (-412.754) (-418.413) [-413.551] -- 0:00:50
      164500 -- [-412.856] (-412.692) (-413.004) (-416.214) * (-413.103) (-412.673) (-414.503) [-412.653] -- 0:00:50
      165000 -- [-416.429] (-412.971) (-415.143) (-417.167) * (-412.703) (-412.723) (-414.389) [-420.849] -- 0:00:50

      Average standard deviation of split frequencies: 0.020194

      165500 -- (-415.388) (-413.886) [-412.719] (-417.016) * (-414.330) [-411.840] (-416.947) (-413.778) -- 0:00:50
      166000 -- (-415.697) (-413.008) (-414.528) [-416.113] * (-417.394) [-411.604] (-416.102) (-416.156) -- 0:00:50
      166500 -- (-417.061) (-416.131) [-415.132] (-416.745) * (-416.013) (-411.790) [-416.037] (-412.483) -- 0:00:50
      167000 -- (-414.795) (-411.901) (-414.140) [-412.282] * (-414.760) [-412.250] (-413.818) (-413.443) -- 0:00:49
      167500 -- (-413.334) [-412.244] (-414.391) (-411.740) * [-417.341] (-412.893) (-413.831) (-417.171) -- 0:00:49
      168000 -- [-412.735] (-412.212) (-414.507) (-413.581) * (-416.498) (-414.156) [-413.312] (-414.929) -- 0:00:49
      168500 -- [-412.300] (-413.449) (-414.876) (-412.247) * [-414.503] (-413.580) (-413.801) (-415.288) -- 0:00:49
      169000 -- [-413.687] (-411.802) (-414.682) (-412.442) * (-412.058) (-413.737) (-414.548) [-414.419] -- 0:00:49
      169500 -- (-415.608) [-413.111] (-413.562) (-414.267) * (-414.769) (-411.624) (-417.307) [-413.351] -- 0:00:48
      170000 -- [-416.747] (-415.239) (-416.725) (-416.517) * (-414.597) (-412.374) (-417.405) [-412.676] -- 0:00:48

      Average standard deviation of split frequencies: 0.019028

      170500 -- (-412.291) [-416.305] (-412.164) (-417.530) * [-412.656] (-412.276) (-412.959) (-414.817) -- 0:00:48
      171000 -- (-415.862) (-414.810) [-413.687] (-413.664) * (-413.902) (-413.235) (-413.992) [-414.519] -- 0:00:48
      171500 -- (-418.121) (-417.097) (-413.466) [-414.550] * (-413.281) (-414.335) (-414.280) [-417.572] -- 0:00:48
      172000 -- (-414.587) [-414.364] (-417.188) (-415.454) * (-413.394) [-412.861] (-412.807) (-414.081) -- 0:00:48
      172500 -- (-413.034) (-413.246) [-414.936] (-419.140) * [-412.634] (-415.436) (-411.908) (-418.084) -- 0:00:47
      173000 -- [-413.276] (-413.638) (-413.025) (-416.422) * (-414.102) (-412.243) [-413.871] (-414.999) -- 0:00:47
      173500 -- (-413.278) (-415.395) [-415.277] (-416.595) * (-415.978) (-412.310) [-416.562] (-413.297) -- 0:00:47
      174000 -- (-412.823) (-413.573) [-418.482] (-411.985) * (-415.715) (-412.817) (-416.244) [-415.028] -- 0:00:47
      174500 -- [-412.845] (-412.841) (-414.641) (-412.933) * (-414.686) [-413.838] (-413.199) (-414.849) -- 0:00:47
      175000 -- (-413.224) [-412.771] (-416.030) (-416.794) * (-413.797) [-412.351] (-413.100) (-413.784) -- 0:00:47

      Average standard deviation of split frequencies: 0.018005

      175500 -- (-414.837) [-413.541] (-413.160) (-416.201) * (-414.060) [-412.759] (-413.917) (-415.873) -- 0:00:46
      176000 -- (-419.497) (-412.900) (-414.663) [-414.321] * (-413.609) (-412.770) (-416.048) [-413.206] -- 0:00:46
      176500 -- (-415.948) [-414.112] (-413.941) (-412.150) * (-413.324) (-412.372) [-413.231] (-413.998) -- 0:00:46
      177000 -- (-421.221) (-411.900) [-413.400] (-415.877) * (-412.740) (-413.696) [-411.847] (-412.837) -- 0:00:46
      177500 -- (-420.289) [-412.857] (-412.634) (-412.411) * (-413.637) (-415.287) (-415.592) [-413.105] -- 0:00:46
      178000 -- [-415.313] (-415.725) (-412.892) (-414.176) * (-417.372) (-413.026) (-414.381) [-415.580] -- 0:00:46
      178500 -- [-414.639] (-415.875) (-416.251) (-414.267) * (-414.399) (-412.060) (-414.085) [-413.752] -- 0:00:46
      179000 -- (-417.258) [-413.105] (-418.925) (-412.175) * (-413.441) (-412.284) [-414.333] (-412.956) -- 0:00:45
      179500 -- (-414.657) (-416.455) [-412.103] (-412.874) * (-418.588) (-412.942) (-416.740) [-413.039] -- 0:00:45
      180000 -- [-415.650] (-415.268) (-412.897) (-413.486) * (-413.958) (-412.468) (-414.371) [-412.240] -- 0:00:45

      Average standard deviation of split frequencies: 0.016754

      180500 -- (-414.258) [-412.310] (-416.909) (-414.127) * (-413.350) (-413.860) (-412.108) [-413.273] -- 0:00:45
      181000 -- [-416.002] (-415.941) (-414.775) (-416.530) * (-414.108) (-415.424) [-413.948] (-413.338) -- 0:00:49
      181500 -- (-419.392) (-413.335) (-413.900) [-417.453] * (-414.301) (-413.829) (-414.953) [-412.303] -- 0:00:49
      182000 -- [-414.142] (-413.130) (-413.304) (-418.729) * (-416.600) [-415.607] (-413.377) (-414.465) -- 0:00:49
      182500 -- (-414.076) (-414.152) [-414.699] (-415.196) * (-417.588) (-415.605) [-416.937] (-417.653) -- 0:00:49
      183000 -- [-418.486] (-412.701) (-412.554) (-417.775) * [-412.955] (-412.225) (-418.730) (-414.562) -- 0:00:49
      183500 -- (-413.679) (-413.113) [-413.151] (-415.377) * (-412.226) [-411.717] (-417.397) (-412.235) -- 0:00:48
      184000 -- (-413.483) [-416.354] (-415.140) (-416.057) * (-414.240) [-412.664] (-417.873) (-416.224) -- 0:00:48
      184500 -- (-412.670) (-414.321) [-415.697] (-413.477) * (-413.166) (-413.078) (-412.795) [-413.203] -- 0:00:48
      185000 -- (-414.673) [-418.362] (-418.414) (-412.121) * (-414.346) [-417.995] (-413.692) (-418.490) -- 0:00:48

      Average standard deviation of split frequencies: 0.018008

      185500 -- (-414.190) [-414.225] (-415.959) (-413.224) * (-413.983) (-412.488) [-413.351] (-414.207) -- 0:00:48
      186000 -- [-414.688] (-417.232) (-412.986) (-414.979) * (-412.600) (-416.894) (-413.420) [-415.324] -- 0:00:48
      186500 -- (-418.309) [-412.672] (-412.043) (-414.470) * (-415.646) (-414.296) (-413.587) [-415.110] -- 0:00:47
      187000 -- (-417.615) (-417.382) [-412.063] (-415.218) * (-414.611) (-414.090) [-413.000] (-415.804) -- 0:00:47
      187500 -- [-417.118] (-414.367) (-414.726) (-413.003) * [-415.104] (-416.163) (-415.305) (-412.453) -- 0:00:47
      188000 -- (-415.250) (-414.861) [-412.118] (-413.763) * [-412.801] (-414.372) (-414.510) (-418.472) -- 0:00:47
      188500 -- (-413.737) (-413.349) [-413.881] (-417.445) * (-412.873) [-412.820] (-412.895) (-413.346) -- 0:00:47
      189000 -- (-412.062) (-413.882) (-416.054) [-413.421] * (-413.996) [-414.166] (-416.652) (-413.436) -- 0:00:47
      189500 -- (-415.073) [-412.141] (-412.850) (-413.796) * [-414.571] (-413.047) (-416.087) (-421.001) -- 0:00:47
      190000 -- (-413.859) (-412.639) (-417.848) [-412.815] * (-414.352) (-412.785) [-414.932] (-419.892) -- 0:00:46

      Average standard deviation of split frequencies: 0.018131

      190500 -- (-412.635) (-413.658) [-418.207] (-413.971) * [-413.149] (-414.376) (-416.968) (-418.049) -- 0:00:46
      191000 -- (-413.488) (-413.526) [-412.715] (-414.144) * (-417.240) (-419.965) (-413.678) [-419.810] -- 0:00:46
      191500 -- (-412.433) (-413.092) (-419.740) [-413.702] * (-418.401) (-412.920) (-412.891) [-413.711] -- 0:00:46
      192000 -- (-412.701) [-413.297] (-416.595) (-412.226) * (-414.822) (-418.733) (-413.716) [-413.289] -- 0:00:46
      192500 -- (-413.827) [-412.869] (-412.879) (-414.849) * [-413.528] (-413.172) (-416.921) (-416.008) -- 0:00:46
      193000 -- [-412.437] (-413.562) (-412.562) (-416.493) * [-414.842] (-422.281) (-414.341) (-420.318) -- 0:00:45
      193500 -- (-413.999) [-414.555] (-412.219) (-418.466) * (-413.130) (-416.058) (-417.086) [-413.993] -- 0:00:45
      194000 -- (-418.636) (-413.758) [-415.854] (-413.051) * [-413.173] (-416.130) (-411.658) (-413.792) -- 0:00:45
      194500 -- (-417.076) [-412.647] (-414.001) (-416.085) * (-412.499) [-413.766] (-412.346) (-412.647) -- 0:00:45
      195000 -- (-414.694) [-412.019] (-412.992) (-421.078) * (-414.138) (-417.115) (-413.421) [-415.142] -- 0:00:45

      Average standard deviation of split frequencies: 0.017216

      195500 -- (-413.089) (-414.433) (-414.898) [-414.322] * [-412.647] (-416.990) (-413.894) (-416.332) -- 0:00:45
      196000 -- [-412.390] (-412.179) (-414.849) (-417.101) * (-412.181) (-413.647) (-414.651) [-413.831] -- 0:00:45
      196500 -- (-413.736) (-414.777) (-413.088) [-416.411] * (-413.382) (-413.527) (-415.774) [-415.228] -- 0:00:44
      197000 -- [-412.778] (-416.068) (-412.267) (-417.478) * [-413.651] (-413.240) (-415.058) (-413.851) -- 0:00:44
      197500 -- [-415.312] (-416.479) (-412.096) (-419.470) * [-412.664] (-416.559) (-413.680) (-413.747) -- 0:00:44
      198000 -- (-417.733) [-418.462] (-415.293) (-415.157) * [-413.230] (-412.188) (-414.553) (-413.950) -- 0:00:48
      198500 -- (-415.986) (-416.919) [-419.228] (-414.719) * (-412.131) (-412.265) (-414.302) [-412.600] -- 0:00:48
      199000 -- (-413.314) [-413.377] (-415.821) (-412.486) * (-412.850) (-411.767) (-412.364) [-412.282] -- 0:00:48
      199500 -- (-414.282) (-415.504) [-416.953] (-413.255) * (-412.633) (-412.174) [-414.150] (-413.249) -- 0:00:48
      200000 -- [-417.037] (-415.506) (-413.640) (-413.937) * (-412.995) [-412.061] (-412.686) (-414.045) -- 0:00:48

      Average standard deviation of split frequencies: 0.018924

      200500 -- [-413.740] (-412.459) (-415.590) (-416.901) * (-412.392) (-413.555) (-412.185) [-413.725] -- 0:00:47
      201000 -- (-412.705) [-412.542] (-417.401) (-413.955) * (-416.597) [-413.170] (-421.491) (-416.987) -- 0:00:47
      201500 -- (-412.855) [-414.334] (-414.141) (-413.123) * [-417.658] (-413.350) (-415.022) (-415.545) -- 0:00:47
      202000 -- (-414.081) [-414.558] (-413.050) (-413.732) * (-413.025) (-412.458) [-412.207] (-415.198) -- 0:00:47
      202500 -- (-415.003) (-414.715) (-414.499) [-413.567] * (-412.622) [-412.760] (-414.663) (-415.449) -- 0:00:47
      203000 -- (-412.352) [-413.057] (-414.636) (-418.630) * (-414.331) [-414.465] (-418.003) (-417.065) -- 0:00:47
      203500 -- (-415.412) [-412.262] (-417.272) (-413.279) * (-413.226) [-412.627] (-412.454) (-414.225) -- 0:00:46
      204000 -- (-414.085) [-412.326] (-416.458) (-412.292) * [-415.826] (-414.220) (-413.793) (-416.052) -- 0:00:46
      204500 -- (-413.861) [-414.859] (-414.333) (-413.219) * [-414.104] (-413.054) (-413.233) (-411.921) -- 0:00:46
      205000 -- (-417.352) (-416.790) [-413.206] (-412.055) * [-414.022] (-412.037) (-417.256) (-417.236) -- 0:00:46

      Average standard deviation of split frequencies: 0.018765

      205500 -- (-413.158) (-413.570) (-414.052) [-414.214] * [-412.036] (-412.638) (-417.792) (-416.572) -- 0:00:46
      206000 -- (-416.021) (-413.152) (-413.851) [-413.679] * (-414.965) (-415.329) (-411.871) [-412.753] -- 0:00:46
      206500 -- (-416.081) (-414.100) [-416.325] (-412.924) * (-415.676) [-414.560] (-416.454) (-412.164) -- 0:00:46
      207000 -- [-413.806] (-412.426) (-416.296) (-412.730) * (-414.678) [-412.261] (-413.248) (-416.115) -- 0:00:45
      207500 -- [-415.570] (-414.729) (-413.917) (-413.395) * [-413.719] (-413.162) (-414.995) (-413.265) -- 0:00:45
      208000 -- (-416.253) [-417.203] (-416.453) (-414.562) * (-413.867) [-413.233] (-413.361) (-416.098) -- 0:00:45
      208500 -- (-413.431) (-415.685) [-412.902] (-416.269) * [-411.720] (-412.745) (-413.925) (-412.731) -- 0:00:45
      209000 -- (-413.290) (-415.222) (-412.967) [-421.345] * (-412.984) (-415.582) (-414.836) [-413.902] -- 0:00:45
      209500 -- (-414.017) [-418.014] (-412.503) (-412.748) * [-411.751] (-414.119) (-414.370) (-417.328) -- 0:00:45
      210000 -- (-415.382) [-418.303] (-413.432) (-414.295) * (-413.050) (-412.940) [-416.269] (-413.992) -- 0:00:45

      Average standard deviation of split frequencies: 0.020139

      210500 -- (-417.800) (-412.152) (-417.100) [-415.275] * [-414.488] (-417.374) (-418.314) (-414.378) -- 0:00:45
      211000 -- (-414.336) [-414.446] (-414.175) (-415.917) * (-414.210) [-412.813] (-414.886) (-412.522) -- 0:00:44
      211500 -- (-415.136) (-412.620) (-413.973) [-413.009] * (-415.079) (-415.552) [-417.335] (-412.309) -- 0:00:44
      212000 -- (-415.465) [-413.275] (-414.572) (-412.402) * (-422.735) (-415.262) (-412.755) [-412.512] -- 0:00:44
      212500 -- (-417.765) (-413.730) (-415.057) [-413.883] * (-419.717) [-413.952] (-413.901) (-414.255) -- 0:00:44
      213000 -- (-416.270) (-414.376) [-412.605] (-414.164) * (-415.827) (-413.239) (-412.986) [-415.300] -- 0:00:44
      213500 -- (-417.856) (-415.380) (-414.138) [-413.980] * [-415.464] (-412.077) (-414.242) (-413.794) -- 0:00:44
      214000 -- (-415.604) (-413.901) (-414.320) [-413.628] * [-413.088] (-413.035) (-414.839) (-412.774) -- 0:00:44
      214500 -- [-413.731] (-413.328) (-414.430) (-413.049) * [-413.464] (-415.620) (-419.014) (-412.555) -- 0:00:43
      215000 -- (-416.130) [-412.575] (-412.626) (-413.148) * (-414.263) (-413.431) (-422.598) [-414.618] -- 0:00:47

      Average standard deviation of split frequencies: 0.020248

      215500 -- (-414.455) (-412.454) (-412.244) [-413.817] * (-416.505) (-412.494) (-421.386) [-414.642] -- 0:00:47
      216000 -- (-414.772) (-417.981) [-411.919] (-412.154) * [-411.784] (-414.165) (-412.874) (-419.634) -- 0:00:47
      216500 -- (-414.864) (-419.612) [-415.045] (-412.697) * (-412.321) (-414.761) [-412.844] (-413.130) -- 0:00:47
      217000 -- [-414.354] (-412.638) (-416.042) (-415.660) * (-414.490) (-412.920) (-413.808) [-416.620] -- 0:00:46
      217500 -- (-415.875) [-413.045] (-413.361) (-412.173) * (-413.039) (-416.031) (-414.030) [-413.289] -- 0:00:46
      218000 -- [-416.034] (-412.577) (-413.349) (-411.678) * (-413.682) (-414.379) [-414.255] (-413.338) -- 0:00:46
      218500 -- (-416.782) (-413.867) (-413.069) [-412.724] * (-416.410) (-420.319) [-415.893] (-415.123) -- 0:00:46
      219000 -- (-418.507) (-413.832) (-412.181) [-412.207] * [-414.622] (-416.055) (-414.222) (-412.929) -- 0:00:46
      219500 -- (-413.614) (-412.714) (-413.007) [-415.463] * (-415.239) (-414.214) (-414.124) [-415.606] -- 0:00:46
      220000 -- (-413.897) (-412.749) (-418.894) [-412.844] * (-413.086) (-413.323) (-414.958) [-412.148] -- 0:00:46

      Average standard deviation of split frequencies: 0.019603

      220500 -- (-415.037) (-412.737) (-416.510) [-414.770] * (-417.300) (-415.147) (-412.518) [-412.354] -- 0:00:45
      221000 -- (-413.151) (-413.658) (-413.860) [-412.904] * [-414.309] (-414.814) (-415.106) (-411.773) -- 0:00:45
      221500 -- (-412.004) (-412.396) (-413.523) [-414.768] * (-415.072) (-413.172) (-412.951) [-414.504] -- 0:00:45
      222000 -- (-412.801) (-413.932) [-413.059] (-412.433) * (-414.589) [-412.430] (-413.666) (-416.042) -- 0:00:45
      222500 -- (-412.734) (-413.480) [-417.454] (-411.826) * (-414.138) [-413.329] (-413.708) (-413.111) -- 0:00:45
      223000 -- (-413.622) (-416.994) (-412.974) [-413.600] * (-412.424) (-413.316) (-412.384) [-413.722] -- 0:00:45
      223500 -- (-414.622) [-416.144] (-418.215) (-414.301) * (-413.445) (-417.985) [-413.147] (-415.373) -- 0:00:45
      224000 -- [-412.848] (-417.892) (-414.171) (-413.850) * [-413.029] (-416.299) (-412.591) (-415.275) -- 0:00:45
      224500 -- (-416.242) (-415.846) [-413.418] (-417.106) * [-415.657] (-413.543) (-413.623) (-414.051) -- 0:00:44
      225000 -- [-411.640] (-416.990) (-416.482) (-418.203) * [-413.319] (-413.317) (-414.901) (-413.997) -- 0:00:44

      Average standard deviation of split frequencies: 0.019352

      225500 -- [-411.815] (-414.285) (-415.207) (-413.452) * (-412.964) (-413.237) (-413.490) [-415.483] -- 0:00:44
      226000 -- (-413.951) [-416.075] (-412.236) (-417.858) * (-414.799) (-414.616) [-412.347] (-416.954) -- 0:00:44
      226500 -- (-412.269) (-414.480) (-415.240) [-413.919] * (-411.990) [-413.299] (-412.489) (-420.782) -- 0:00:44
      227000 -- (-415.408) [-412.271] (-412.718) (-415.200) * [-415.268] (-412.420) (-415.078) (-417.734) -- 0:00:44
      227500 -- [-413.213] (-414.682) (-412.458) (-417.427) * (-413.204) (-413.724) [-411.840] (-414.257) -- 0:00:44
      228000 -- (-415.974) [-412.986] (-414.380) (-414.209) * (-413.230) (-414.857) (-413.740) [-413.221] -- 0:00:44
      228500 -- (-417.209) (-413.652) (-413.870) [-413.318] * (-415.879) (-414.528) [-415.287] (-417.353) -- 0:00:43
      229000 -- [-416.166] (-412.173) (-412.433) (-418.805) * (-418.250) (-413.297) (-412.248) [-417.224] -- 0:00:43
      229500 -- [-412.494] (-411.943) (-412.742) (-413.137) * (-415.277) (-413.527) (-411.893) [-413.036] -- 0:00:43
      230000 -- [-414.728] (-413.712) (-412.485) (-413.406) * (-412.267) (-416.003) [-412.097] (-414.720) -- 0:00:43

      Average standard deviation of split frequencies: 0.019188

      230500 -- [-414.012] (-413.317) (-415.334) (-414.505) * [-414.173] (-417.045) (-412.819) (-412.675) -- 0:00:43
      231000 -- (-412.016) [-414.751] (-415.329) (-412.306) * [-413.121] (-413.771) (-412.866) (-413.954) -- 0:00:43
      231500 -- (-413.458) (-415.368) [-413.741] (-416.153) * (-413.424) (-412.006) [-416.362] (-419.128) -- 0:00:43
      232000 -- [-418.271] (-415.804) (-412.752) (-413.417) * (-413.106) (-413.179) [-412.038] (-425.171) -- 0:00:43
      232500 -- [-412.799] (-414.084) (-412.460) (-413.903) * (-418.276) (-418.630) (-413.484) [-415.336] -- 0:00:46
      233000 -- (-413.915) (-413.091) [-413.784] (-418.133) * [-414.768] (-412.770) (-416.928) (-414.639) -- 0:00:46
      233500 -- (-411.870) [-413.063] (-413.132) (-419.671) * (-415.362) (-419.470) (-416.244) [-412.620] -- 0:00:45
      234000 -- (-413.913) (-417.217) [-414.574] (-415.137) * (-413.797) (-415.417) (-416.251) [-414.834] -- 0:00:45
      234500 -- (-415.372) (-414.697) (-415.113) [-413.352] * (-413.065) (-415.162) [-421.192] (-414.441) -- 0:00:45
      235000 -- (-416.882) (-412.440) (-414.277) [-414.589] * [-412.808] (-412.361) (-414.414) (-413.273) -- 0:00:45

      Average standard deviation of split frequencies: 0.018199

      235500 -- (-413.507) [-416.864] (-416.214) (-415.437) * (-413.161) (-413.256) (-413.264) [-413.343] -- 0:00:45
      236000 -- (-415.436) (-414.814) [-416.663] (-419.452) * [-414.298] (-414.288) (-411.898) (-413.865) -- 0:00:45
      236500 -- (-415.442) (-413.661) [-413.566] (-416.113) * (-414.294) [-413.367] (-415.667) (-414.774) -- 0:00:45
      237000 -- (-418.476) [-412.942] (-415.364) (-416.583) * (-416.485) [-411.822] (-418.008) (-413.787) -- 0:00:45
      237500 -- [-415.408] (-414.617) (-413.716) (-415.850) * (-417.748) (-414.648) [-414.889] (-416.720) -- 0:00:44
      238000 -- (-413.798) (-415.744) [-416.389] (-416.226) * (-418.673) [-414.226] (-415.571) (-413.431) -- 0:00:44
      238500 -- (-411.871) [-413.968] (-414.144) (-416.634) * (-415.139) (-418.102) [-413.266] (-412.348) -- 0:00:44
      239000 -- (-415.916) [-413.138] (-418.773) (-415.677) * [-413.966] (-417.014) (-413.153) (-412.099) -- 0:00:44
      239500 -- (-414.617) (-414.813) (-415.781) [-415.894] * (-412.730) [-412.091] (-412.408) (-414.406) -- 0:00:44
      240000 -- (-413.828) (-415.270) (-415.926) [-414.030] * (-413.607) (-412.898) (-415.524) [-413.967] -- 0:00:44

      Average standard deviation of split frequencies: 0.017010

      240500 -- (-415.778) [-414.064] (-416.194) (-412.598) * (-412.688) (-414.107) (-414.607) [-414.498] -- 0:00:44
      241000 -- (-415.173) (-413.831) [-414.425] (-414.239) * (-412.464) (-413.580) (-414.979) [-413.307] -- 0:00:44
      241500 -- (-412.754) (-413.005) (-412.570) [-415.631] * (-416.523) (-416.315) (-413.916) [-412.863] -- 0:00:43
      242000 -- (-412.290) (-413.367) (-413.923) [-413.460] * [-414.740] (-413.559) (-415.222) (-414.981) -- 0:00:43
      242500 -- [-414.728] (-417.941) (-414.284) (-415.853) * [-413.302] (-413.714) (-412.082) (-417.231) -- 0:00:43
      243000 -- (-415.394) [-413.927] (-414.232) (-417.153) * (-414.155) [-414.979] (-412.072) (-415.375) -- 0:00:43
      243500 -- (-414.013) [-415.019] (-415.016) (-414.336) * [-413.632] (-413.580) (-411.684) (-413.259) -- 0:00:43
      244000 -- [-411.982] (-418.067) (-412.955) (-412.260) * [-414.353] (-412.287) (-412.009) (-413.041) -- 0:00:43
      244500 -- (-412.520) (-415.575) (-413.518) [-412.447] * (-413.455) (-415.272) (-413.102) [-417.821] -- 0:00:43
      245000 -- (-415.145) (-413.484) (-413.935) [-416.770] * [-412.265] (-414.503) (-414.596) (-415.117) -- 0:00:43

      Average standard deviation of split frequencies: 0.016944

      245500 -- (-416.817) (-414.106) [-413.679] (-413.223) * (-411.725) (-413.428) (-415.640) [-415.314] -- 0:00:43
      246000 -- (-414.642) [-415.260] (-417.225) (-414.263) * (-415.987) [-411.889] (-413.994) (-414.054) -- 0:00:42
      246500 -- (-413.922) (-412.562) [-412.303] (-412.652) * (-417.458) [-412.076] (-412.574) (-415.001) -- 0:00:42
      247000 -- (-412.727) (-413.983) [-412.316] (-412.164) * (-412.718) (-413.223) [-413.179] (-414.897) -- 0:00:42
      247500 -- (-413.329) (-413.070) (-418.079) [-412.970] * (-414.812) [-413.692] (-412.478) (-412.971) -- 0:00:42
      248000 -- (-413.586) [-412.684] (-413.185) (-412.974) * (-412.173) (-415.051) (-415.097) [-413.453] -- 0:00:42
      248500 -- (-413.408) (-413.044) [-412.748] (-417.013) * [-412.980] (-413.503) (-412.543) (-413.584) -- 0:00:42
      249000 -- (-412.827) [-413.999] (-411.605) (-412.561) * (-414.686) [-414.796] (-412.015) (-414.393) -- 0:00:42
      249500 -- (-414.374) [-415.365] (-412.713) (-419.267) * [-413.294] (-412.448) (-413.081) (-413.563) -- 0:00:42
      250000 -- [-412.401] (-416.137) (-413.915) (-412.572) * [-415.153] (-412.124) (-413.616) (-414.952) -- 0:00:45

      Average standard deviation of split frequencies: 0.016821

      250500 -- [-416.774] (-414.245) (-412.494) (-423.021) * [-415.621] (-414.365) (-417.619) (-415.503) -- 0:00:44
      251000 -- [-411.968] (-413.381) (-414.369) (-412.502) * (-414.459) (-415.788) [-417.058] (-417.942) -- 0:00:44
      251500 -- (-411.643) (-414.101) (-412.148) [-413.323] * (-414.417) (-416.555) [-416.934] (-417.958) -- 0:00:44
      252000 -- (-411.757) (-412.384) (-414.949) [-413.144] * (-413.698) (-417.678) [-413.404] (-412.790) -- 0:00:44
      252500 -- (-412.899) (-414.441) (-414.495) [-414.447] * [-413.565] (-415.823) (-414.854) (-412.363) -- 0:00:44
      253000 -- [-412.832] (-413.900) (-417.288) (-411.985) * (-413.430) (-415.382) [-412.907] (-413.021) -- 0:00:44
      253500 -- (-412.597) [-415.146] (-416.922) (-412.525) * (-412.696) (-414.870) [-412.760] (-411.857) -- 0:00:44
      254000 -- [-415.037] (-412.882) (-414.566) (-413.546) * [-412.619] (-415.318) (-413.660) (-412.656) -- 0:00:44
      254500 -- [-414.256] (-416.028) (-411.917) (-411.934) * (-412.386) [-412.306] (-412.133) (-412.384) -- 0:00:43
      255000 -- (-416.331) (-413.117) [-413.381] (-411.733) * [-413.043] (-413.721) (-412.875) (-418.723) -- 0:00:43

      Average standard deviation of split frequencies: 0.016464

      255500 -- (-412.920) (-414.268) (-414.580) [-412.546] * (-412.440) (-413.524) (-414.943) [-413.766] -- 0:00:43
      256000 -- (-414.982) (-415.742) (-412.842) [-414.003] * (-412.411) (-412.605) [-413.300] (-413.220) -- 0:00:43
      256500 -- (-417.692) [-414.191] (-413.434) (-414.702) * (-412.399) (-413.134) [-415.035] (-412.748) -- 0:00:43
      257000 -- (-413.036) [-413.350] (-415.764) (-413.882) * (-414.656) (-416.713) (-414.947) [-416.242] -- 0:00:43
      257500 -- (-413.955) (-413.529) [-414.347] (-414.935) * [-413.582] (-411.804) (-413.426) (-416.106) -- 0:00:43
      258000 -- (-414.475) (-414.359) [-412.026] (-415.418) * [-412.571] (-412.250) (-414.900) (-416.912) -- 0:00:43
      258500 -- [-412.915] (-413.286) (-412.948) (-415.389) * (-417.615) (-416.957) (-413.629) [-416.270] -- 0:00:43
      259000 -- (-412.525) (-412.403) [-413.000] (-413.060) * [-413.798] (-414.809) (-413.946) (-413.488) -- 0:00:42
      259500 -- (-413.838) [-412.078] (-413.189) (-413.007) * (-411.921) (-416.836) (-414.020) [-418.494] -- 0:00:42
      260000 -- [-411.918] (-412.228) (-413.872) (-414.339) * (-411.976) (-415.490) [-414.067] (-413.797) -- 0:00:42

      Average standard deviation of split frequencies: 0.015319

      260500 -- (-414.594) (-413.864) (-413.988) [-413.339] * (-413.374) [-414.007] (-414.739) (-417.027) -- 0:00:42
      261000 -- (-416.010) [-412.956] (-413.980) (-416.159) * (-414.756) [-413.547] (-413.982) (-415.414) -- 0:00:42
      261500 -- (-416.247) [-412.938] (-412.086) (-416.731) * (-413.200) [-414.984] (-415.171) (-415.129) -- 0:00:42
      262000 -- (-413.824) (-413.923) (-414.366) [-417.047] * (-413.693) [-412.506] (-413.770) (-417.797) -- 0:00:42
      262500 -- [-414.443] (-414.633) (-412.750) (-413.822) * (-415.652) (-412.898) (-412.932) [-413.100] -- 0:00:42
      263000 -- (-413.976) (-416.193) [-412.367] (-413.251) * (-412.532) (-414.431) [-413.569] (-413.962) -- 0:00:42
      263500 -- (-414.252) [-414.106] (-412.413) (-415.582) * [-413.830] (-415.459) (-413.367) (-414.319) -- 0:00:41
      264000 -- (-412.278) (-414.302) [-413.201] (-415.751) * [-412.892] (-414.030) (-417.226) (-412.400) -- 0:00:41
      264500 -- (-412.256) (-415.932) (-415.933) [-412.221] * (-412.650) (-413.746) (-413.380) [-412.958] -- 0:00:41
      265000 -- [-414.358] (-412.976) (-412.512) (-413.522) * [-412.902] (-415.686) (-416.961) (-413.234) -- 0:00:41

      Average standard deviation of split frequencies: 0.014079

      265500 -- (-413.315) [-414.142] (-417.370) (-411.981) * (-413.149) (-411.700) (-412.598) [-414.944] -- 0:00:41
      266000 -- (-416.014) [-412.410] (-414.127) (-413.059) * (-413.447) (-414.468) [-412.819] (-412.240) -- 0:00:41
      266500 -- (-412.393) [-413.460] (-417.985) (-412.716) * (-412.714) (-413.282) [-412.670] (-414.444) -- 0:00:41
      267000 -- (-413.885) (-415.059) (-413.542) [-412.446] * (-412.297) (-413.614) [-413.866] (-414.277) -- 0:00:43
      267500 -- (-417.327) (-413.883) [-412.512] (-411.995) * (-417.050) [-411.920] (-421.262) (-413.373) -- 0:00:43
      268000 -- (-415.197) (-415.593) (-415.128) [-415.156] * (-414.912) [-413.315] (-415.223) (-413.180) -- 0:00:43
      268500 -- (-414.114) [-413.714] (-411.739) (-417.265) * (-413.189) (-414.566) (-412.452) [-414.354] -- 0:00:43
      269000 -- [-415.316] (-414.615) (-412.125) (-422.090) * (-413.556) (-412.667) [-414.626] (-413.960) -- 0:00:43
      269500 -- (-413.333) (-415.727) [-415.118] (-416.890) * (-413.627) (-413.314) (-412.188) [-413.251] -- 0:00:43
      270000 -- (-415.174) (-415.911) [-412.326] (-413.654) * [-413.602] (-416.155) (-414.837) (-412.518) -- 0:00:43

      Average standard deviation of split frequencies: 0.014343

      270500 -- (-414.648) (-413.856) [-412.305] (-417.150) * [-413.850] (-414.829) (-415.118) (-413.371) -- 0:00:43
      271000 -- (-418.084) [-411.838] (-414.991) (-414.793) * (-412.412) [-418.580] (-416.552) (-413.325) -- 0:00:43
      271500 -- (-414.089) [-415.531] (-414.626) (-415.152) * (-415.777) (-414.254) [-419.757] (-412.871) -- 0:00:42
      272000 -- [-413.548] (-412.313) (-416.193) (-413.722) * (-415.146) [-414.176] (-414.868) (-413.869) -- 0:00:42
      272500 -- (-413.133) (-412.526) (-413.278) [-414.318] * [-415.776] (-413.652) (-418.775) (-414.247) -- 0:00:42
      273000 -- (-411.760) [-412.293] (-414.487) (-414.400) * (-418.132) [-411.849] (-414.658) (-412.031) -- 0:00:42
      273500 -- (-414.011) (-415.918) (-414.185) [-413.590] * (-413.307) (-412.916) (-414.556) [-414.521] -- 0:00:42
      274000 -- (-412.748) (-413.897) (-412.797) [-412.528] * [-416.057] (-415.515) (-415.120) (-417.390) -- 0:00:42
      274500 -- (-412.630) (-412.557) (-413.245) [-414.743] * (-417.678) (-416.669) [-413.745] (-413.168) -- 0:00:42
      275000 -- [-413.416] (-413.269) (-414.236) (-419.201) * [-419.536] (-415.509) (-414.102) (-415.101) -- 0:00:42

      Average standard deviation of split frequencies: 0.014568

      275500 -- (-416.588) [-412.657] (-415.722) (-414.488) * (-419.596) (-415.209) (-413.382) [-415.525] -- 0:00:42
      276000 -- (-414.504) [-412.207] (-412.268) (-414.495) * (-415.137) [-414.936] (-412.760) (-415.766) -- 0:00:41
      276500 -- (-417.586) (-415.204) (-413.328) [-411.809] * (-413.245) (-414.457) (-415.382) [-412.059] -- 0:00:41
      277000 -- (-416.375) (-413.037) [-416.130] (-414.971) * [-413.933] (-414.321) (-414.501) (-415.353) -- 0:00:41
      277500 -- [-412.049] (-415.541) (-412.526) (-414.235) * (-411.841) (-416.690) (-413.490) [-413.460] -- 0:00:41
      278000 -- [-412.184] (-413.613) (-413.923) (-417.273) * (-412.435) (-415.094) [-412.742] (-415.681) -- 0:00:41
      278500 -- [-413.632] (-414.639) (-412.903) (-412.821) * (-412.779) [-413.938] (-412.371) (-412.379) -- 0:00:41
      279000 -- (-414.083) (-413.032) (-415.101) [-412.954] * (-413.170) [-412.741] (-413.920) (-415.241) -- 0:00:41
      279500 -- (-413.613) (-414.080) (-416.367) [-416.205] * (-412.978) (-415.067) [-412.911] (-413.779) -- 0:00:41
      280000 -- [-415.107] (-414.012) (-417.102) (-414.467) * (-412.446) [-413.101] (-416.167) (-413.049) -- 0:00:41

      Average standard deviation of split frequencies: 0.014919

      280500 -- (-412.948) (-414.571) (-412.500) [-420.747] * (-414.959) [-416.027] (-414.233) (-413.521) -- 0:00:41
      281000 -- (-413.343) (-419.656) (-411.957) [-415.186] * (-413.803) (-412.020) [-416.018] (-416.115) -- 0:00:40
      281500 -- (-417.905) (-415.791) (-413.279) [-414.466] * (-414.803) (-414.832) [-411.847] (-412.004) -- 0:00:40
      282000 -- (-414.063) [-413.801] (-413.518) (-411.909) * (-414.460) (-413.451) (-416.518) [-412.905] -- 0:00:40
      282500 -- (-413.593) [-411.835] (-414.199) (-417.627) * (-413.629) (-415.358) [-415.433] (-414.832) -- 0:00:40
      283000 -- (-414.089) (-416.520) [-414.346] (-420.495) * (-412.253) (-414.119) (-415.306) [-415.464] -- 0:00:40
      283500 -- [-416.412] (-412.679) (-420.663) (-413.680) * (-414.612) (-414.136) (-411.635) [-412.444] -- 0:00:40
      284000 -- (-414.563) (-412.371) [-412.700] (-413.615) * (-413.499) [-417.232] (-418.693) (-412.865) -- 0:00:42
      284500 -- (-413.620) (-412.691) [-412.933] (-413.535) * (-413.625) (-416.487) [-418.009] (-413.103) -- 0:00:42
      285000 -- (-413.776) [-413.435] (-413.359) (-415.476) * (-413.648) [-412.241] (-415.084) (-413.903) -- 0:00:42

      Average standard deviation of split frequencies: 0.013962

      285500 -- [-412.527] (-412.832) (-413.328) (-413.994) * (-414.417) (-414.166) (-418.832) [-413.145] -- 0:00:42
      286000 -- (-416.452) (-416.897) [-414.433] (-415.807) * (-415.617) [-415.962] (-418.275) (-414.899) -- 0:00:42
      286500 -- (-414.541) [-414.588] (-414.297) (-414.003) * (-415.504) (-414.828) (-416.299) [-414.308] -- 0:00:42
      287000 -- (-412.295) (-415.678) (-413.955) [-412.732] * (-412.663) [-413.897] (-414.473) (-413.712) -- 0:00:42
      287500 -- (-413.916) (-413.566) [-416.695] (-412.485) * [-414.240] (-416.507) (-412.925) (-415.681) -- 0:00:42
      288000 -- (-415.502) (-416.758) (-413.299) [-413.429] * (-417.497) [-414.177] (-413.662) (-414.853) -- 0:00:42
      288500 -- (-413.324) (-415.754) (-412.967) [-412.955] * (-412.932) (-413.805) (-413.809) [-412.114] -- 0:00:41
      289000 -- [-414.511] (-414.857) (-413.374) (-412.294) * [-414.014] (-414.094) (-413.454) (-412.826) -- 0:00:41
      289500 -- (-412.307) (-414.938) [-414.042] (-419.669) * (-413.428) (-413.000) (-413.678) [-414.342] -- 0:00:41
      290000 -- (-414.730) [-415.841] (-413.200) (-417.291) * [-417.080] (-414.082) (-413.381) (-416.043) -- 0:00:41

      Average standard deviation of split frequencies: 0.013695

      290500 -- (-416.010) (-416.246) (-412.917) [-416.776] * (-412.220) (-413.166) (-417.509) [-413.081] -- 0:00:41
      291000 -- (-413.427) [-415.838] (-416.557) (-415.099) * [-412.578] (-415.877) (-415.793) (-415.512) -- 0:00:41
      291500 -- (-415.347) (-414.599) (-418.927) [-414.434] * (-412.863) (-412.836) [-414.643] (-414.339) -- 0:00:41
      292000 -- [-416.072] (-419.965) (-412.486) (-415.075) * (-415.629) (-413.012) [-411.895] (-414.976) -- 0:00:41
      292500 -- [-414.129] (-416.056) (-412.201) (-415.480) * (-414.162) (-413.437) (-412.807) [-414.853] -- 0:00:41
      293000 -- (-415.953) (-414.793) (-413.275) [-414.029] * [-414.725] (-415.283) (-413.430) (-414.133) -- 0:00:41
      293500 -- (-413.683) (-415.140) (-412.470) [-412.706] * (-412.534) [-415.061] (-413.328) (-413.327) -- 0:00:40
      294000 -- [-414.134] (-413.458) (-414.782) (-412.346) * (-413.126) (-415.838) [-413.555] (-413.482) -- 0:00:40
      294500 -- (-414.423) [-414.441] (-413.941) (-412.102) * [-411.827] (-416.428) (-413.665) (-415.103) -- 0:00:40
      295000 -- [-414.489] (-414.343) (-416.462) (-415.465) * (-412.042) [-413.689] (-413.881) (-413.503) -- 0:00:40

      Average standard deviation of split frequencies: 0.012553

      295500 -- [-413.014] (-412.891) (-417.562) (-415.860) * (-412.349) [-414.935] (-415.311) (-413.790) -- 0:00:40
      296000 -- [-412.661] (-412.226) (-414.529) (-419.895) * (-412.362) (-412.959) [-415.405] (-416.476) -- 0:00:40
      296500 -- (-419.745) [-411.925] (-412.655) (-414.059) * [-415.941] (-415.310) (-414.005) (-412.233) -- 0:00:40
      297000 -- [-416.125] (-416.831) (-412.317) (-413.073) * [-413.001] (-413.232) (-416.702) (-413.340) -- 0:00:40
      297500 -- (-416.973) [-413.956] (-412.240) (-414.312) * (-411.867) (-412.952) [-412.088] (-414.752) -- 0:00:40
      298000 -- (-417.907) (-416.339) [-414.541] (-412.573) * (-418.626) [-414.506] (-412.258) (-414.430) -- 0:00:40
      298500 -- [-416.050] (-412.387) (-415.827) (-414.804) * [-413.264] (-416.881) (-416.249) (-413.291) -- 0:00:39
      299000 -- (-414.148) [-414.117] (-416.319) (-417.493) * (-414.337) (-413.818) [-414.133] (-413.449) -- 0:00:39
      299500 -- (-413.962) (-414.874) [-413.285] (-412.711) * (-412.899) (-412.214) [-413.891] (-414.078) -- 0:00:39
      300000 -- (-414.210) (-415.929) [-414.081] (-412.935) * (-412.712) (-414.090) (-413.526) [-414.075] -- 0:00:39

      Average standard deviation of split frequencies: 0.012358

      300500 -- (-416.089) (-413.834) (-415.879) [-415.643] * [-413.775] (-413.585) (-411.567) (-414.670) -- 0:00:39
      301000 -- [-415.834] (-413.669) (-415.097) (-414.425) * [-413.951] (-413.837) (-412.509) (-414.295) -- 0:00:41
      301500 -- (-416.862) (-417.155) [-414.357] (-415.071) * [-412.651] (-415.370) (-418.039) (-412.011) -- 0:00:41
      302000 -- (-415.229) (-416.592) [-413.019] (-416.374) * [-414.219] (-415.119) (-413.254) (-415.757) -- 0:00:41
      302500 -- (-417.021) [-416.741] (-412.506) (-415.021) * (-413.248) (-414.676) [-416.775] (-414.932) -- 0:00:41
      303000 -- (-414.614) [-414.923] (-414.337) (-415.819) * (-413.071) (-412.760) [-417.411] (-412.760) -- 0:00:41
      303500 -- (-413.708) [-413.881] (-412.951) (-415.529) * (-412.658) (-413.584) [-413.938] (-412.109) -- 0:00:41
      304000 -- (-416.367) (-415.774) [-415.155] (-413.201) * (-413.979) (-412.959) (-414.046) [-412.807] -- 0:00:41
      304500 -- (-415.017) (-413.569) (-414.064) [-414.149] * (-413.813) (-413.499) (-412.401) [-414.716] -- 0:00:41
      305000 -- (-417.204) [-412.686] (-413.160) (-414.825) * (-415.586) (-413.883) (-413.461) [-413.752] -- 0:00:41

      Average standard deviation of split frequencies: 0.012153

      305500 -- (-414.966) (-413.653) [-413.850] (-414.045) * (-415.055) [-413.514] (-413.130) (-413.667) -- 0:00:40
      306000 -- [-414.418] (-413.492) (-414.648) (-417.602) * (-413.592) (-413.360) (-414.165) [-413.751] -- 0:00:40
      306500 -- (-424.086) (-415.228) [-414.848] (-413.849) * (-415.658) [-412.696] (-413.176) (-416.041) -- 0:00:40
      307000 -- (-415.829) (-413.396) [-412.170] (-417.207) * (-413.589) (-415.257) [-412.358] (-413.963) -- 0:00:40
      307500 -- (-416.538) [-412.250] (-414.358) (-412.879) * (-413.946) (-420.165) (-412.863) [-412.064] -- 0:00:40
      308000 -- (-416.229) (-414.216) [-416.857] (-413.019) * (-419.198) (-414.045) [-415.134] (-416.393) -- 0:00:40
      308500 -- [-413.554] (-419.051) (-413.565) (-414.981) * (-417.307) (-417.135) [-415.508] (-413.755) -- 0:00:40
      309000 -- (-413.906) [-413.201] (-414.215) (-414.302) * (-415.378) [-413.115] (-412.984) (-415.304) -- 0:00:40
      309500 -- [-412.990] (-414.013) (-415.853) (-413.740) * [-416.548] (-414.761) (-419.650) (-413.467) -- 0:00:40
      310000 -- (-413.893) (-415.332) [-418.774] (-414.988) * (-413.325) (-411.671) [-413.736] (-412.770) -- 0:00:40

      Average standard deviation of split frequencies: 0.011157

      310500 -- (-413.734) [-415.459] (-417.714) (-413.347) * (-412.442) (-412.982) (-415.152) [-412.611] -- 0:00:39
      311000 -- (-415.136) (-415.359) [-414.632] (-414.737) * (-415.783) (-412.250) (-412.943) [-412.946] -- 0:00:39
      311500 -- (-416.177) (-416.030) (-414.215) [-415.232] * [-414.608] (-411.785) (-418.224) (-413.879) -- 0:00:39
      312000 -- (-413.643) (-417.001) [-413.063] (-411.874) * (-412.087) [-415.174] (-413.324) (-413.870) -- 0:00:39
      312500 -- (-412.004) [-415.181] (-417.531) (-415.677) * (-412.355) (-413.186) [-413.481] (-413.866) -- 0:00:39
      313000 -- (-415.514) (-415.174) (-413.424) [-413.515] * (-412.912) (-411.851) (-413.728) [-415.931] -- 0:00:39
      313500 -- (-413.961) (-414.530) [-413.158] (-413.030) * (-415.977) (-414.135) (-412.977) [-418.002] -- 0:00:39
      314000 -- (-413.649) (-414.748) (-414.563) [-412.999] * (-416.716) (-413.926) (-415.658) [-414.384] -- 0:00:39
      314500 -- (-412.509) (-415.234) (-414.526) [-414.126] * (-416.866) (-415.700) [-413.334] (-416.562) -- 0:00:39
      315000 -- (-414.215) [-413.703] (-412.485) (-414.004) * [-416.453] (-415.140) (-412.903) (-414.247) -- 0:00:39

      Average standard deviation of split frequencies: 0.010881

      315500 -- (-416.246) [-416.829] (-412.290) (-412.754) * (-412.956) (-413.075) [-413.868] (-413.258) -- 0:00:39
      316000 -- (-416.050) [-414.237] (-413.061) (-414.466) * (-412.610) (-414.734) [-415.751] (-413.325) -- 0:00:38
      316500 -- [-414.982] (-415.454) (-413.874) (-414.383) * [-413.506] (-413.306) (-414.698) (-416.613) -- 0:00:38
      317000 -- [-414.636] (-412.498) (-412.462) (-412.688) * [-417.443] (-413.244) (-413.734) (-415.066) -- 0:00:38
      317500 -- (-413.618) (-416.578) (-412.014) [-413.134] * (-412.999) (-413.360) [-412.869] (-412.514) -- 0:00:38
      318000 -- [-414.152] (-414.496) (-413.836) (-414.305) * (-413.477) (-415.184) (-412.764) [-413.115] -- 0:00:40
      318500 -- (-415.902) (-413.278) [-412.509] (-416.278) * (-413.821) [-412.806] (-414.179) (-413.414) -- 0:00:40
      319000 -- [-414.302] (-413.003) (-412.999) (-414.050) * (-416.202) (-415.588) [-415.256] (-412.805) -- 0:00:40
      319500 -- (-415.036) (-415.796) [-412.282] (-417.001) * (-415.969) (-411.868) [-414.133] (-416.181) -- 0:00:40
      320000 -- (-413.273) (-416.451) (-415.034) [-414.627] * (-415.591) (-415.524) (-413.471) [-415.361] -- 0:00:40

      Average standard deviation of split frequencies: 0.011577

      320500 -- (-415.658) (-414.493) (-412.631) [-412.422] * (-414.306) (-415.507) (-415.087) [-416.916] -- 0:00:40
      321000 -- [-415.159] (-417.173) (-415.832) (-413.602) * [-412.171] (-413.817) (-414.486) (-412.988) -- 0:00:40
      321500 -- (-412.931) [-414.355] (-414.887) (-414.070) * (-413.847) (-421.401) [-412.536] (-419.264) -- 0:00:40
      322000 -- [-412.680] (-414.099) (-414.278) (-414.114) * (-412.196) (-414.829) [-412.563] (-413.779) -- 0:00:40
      322500 -- (-413.699) (-413.988) (-412.777) [-413.122] * (-414.402) (-414.497) (-412.329) [-415.744] -- 0:00:39
      323000 -- [-418.073] (-413.542) (-413.249) (-422.270) * [-413.672] (-413.968) (-414.735) (-416.198) -- 0:00:39
      323500 -- (-417.089) [-415.494] (-413.345) (-419.106) * (-412.619) (-412.718) (-413.743) [-411.915] -- 0:00:39
      324000 -- (-415.223) [-413.016] (-415.240) (-418.373) * (-413.242) (-412.367) [-413.182] (-412.255) -- 0:00:39
      324500 -- (-414.387) (-415.161) (-411.853) [-412.020] * [-413.618] (-415.407) (-412.077) (-412.595) -- 0:00:39
      325000 -- (-414.589) (-417.395) (-414.831) [-414.902] * (-416.058) [-412.954] (-416.820) (-414.663) -- 0:00:39

      Average standard deviation of split frequencies: 0.011729

      325500 -- (-419.727) (-412.724) (-416.161) [-413.123] * (-415.866) [-411.898] (-418.002) (-413.449) -- 0:00:39
      326000 -- [-411.882] (-414.332) (-413.290) (-413.065) * (-413.722) [-415.280] (-422.435) (-415.606) -- 0:00:39
      326500 -- (-413.879) [-412.250] (-412.642) (-415.515) * (-420.480) [-415.471] (-415.914) (-416.255) -- 0:00:39
      327000 -- (-414.215) [-416.511] (-419.851) (-413.977) * (-414.275) [-413.671] (-414.852) (-414.371) -- 0:00:39
      327500 -- (-415.021) (-412.869) (-416.995) [-413.798] * (-416.992) (-417.045) (-412.120) [-411.825] -- 0:00:39
      328000 -- [-415.451] (-415.997) (-418.721) (-418.855) * (-417.739) [-415.651] (-412.904) (-418.619) -- 0:00:38
      328500 -- (-413.112) (-414.767) (-411.736) [-413.033] * (-419.792) [-412.981] (-412.359) (-412.901) -- 0:00:38
      329000 -- (-413.990) (-414.780) [-414.127] (-412.443) * (-413.396) (-417.696) (-413.444) [-413.922] -- 0:00:38
      329500 -- [-413.175] (-414.649) (-413.892) (-412.835) * (-417.843) (-412.802) (-415.078) [-412.835] -- 0:00:38
      330000 -- (-413.735) (-413.844) (-417.185) [-413.015] * (-414.158) [-412.883] (-414.753) (-413.030) -- 0:00:38

      Average standard deviation of split frequencies: 0.009712

      330500 -- (-414.919) (-414.099) [-414.905] (-416.157) * (-413.654) (-415.129) [-413.457] (-415.127) -- 0:00:38
      331000 -- [-413.653] (-413.464) (-414.842) (-413.657) * (-420.236) (-416.641) [-413.867] (-415.285) -- 0:00:38
      331500 -- (-416.516) (-418.720) [-414.009] (-414.415) * (-412.794) (-413.927) [-418.180] (-417.714) -- 0:00:38
      332000 -- [-413.713] (-414.629) (-414.440) (-417.538) * (-414.008) (-412.529) [-413.194] (-415.267) -- 0:00:38
      332500 -- (-413.281) [-413.184] (-415.090) (-415.329) * (-414.006) (-414.530) (-414.819) [-412.548] -- 0:00:38
      333000 -- (-413.823) [-417.941] (-419.719) (-414.526) * (-416.672) (-413.993) (-412.940) [-412.626] -- 0:00:38
      333500 -- [-415.130] (-414.474) (-415.165) (-413.042) * (-417.616) [-415.698] (-413.208) (-413.278) -- 0:00:37
      334000 -- (-415.127) [-412.361] (-417.289) (-414.887) * (-413.070) (-413.558) (-414.545) [-412.663] -- 0:00:37
      334500 -- (-414.319) (-415.591) (-415.277) [-414.375] * (-414.310) (-413.251) (-413.429) [-415.637] -- 0:00:37
      335000 -- [-413.428] (-414.398) (-414.574) (-414.529) * (-413.913) [-414.819] (-413.533) (-416.101) -- 0:00:39

      Average standard deviation of split frequencies: 0.009382

      335500 -- (-412.440) (-413.373) (-412.906) [-412.917] * (-413.706) (-415.436) [-413.725] (-416.014) -- 0:00:39
      336000 -- (-413.442) (-414.651) [-415.150] (-415.307) * [-415.193] (-418.273) (-414.122) (-420.160) -- 0:00:39
      336500 -- (-413.897) (-414.535) [-415.122] (-417.933) * (-415.200) (-413.707) [-413.651] (-416.119) -- 0:00:39
      337000 -- [-413.143] (-413.951) (-412.848) (-414.954) * (-415.290) (-412.577) (-412.342) [-413.473] -- 0:00:39
      337500 -- (-413.656) (-412.920) [-411.908] (-414.155) * (-414.241) [-412.767] (-413.174) (-413.469) -- 0:00:39
      338000 -- (-415.694) [-414.614] (-413.636) (-412.406) * (-413.830) (-417.604) (-412.073) [-417.608] -- 0:00:39
      338500 -- (-413.660) (-413.602) [-415.090] (-414.985) * (-413.437) [-412.319] (-414.414) (-413.410) -- 0:00:39
      339000 -- (-414.481) (-413.434) (-416.139) [-418.609] * (-413.006) (-412.814) [-413.019] (-416.498) -- 0:00:38
      339500 -- [-413.008] (-420.504) (-416.215) (-414.480) * (-412.771) (-412.855) (-414.758) [-414.765] -- 0:00:38
      340000 -- (-416.961) [-412.713] (-418.059) (-414.099) * (-414.493) (-412.701) [-414.667] (-412.467) -- 0:00:38

      Average standard deviation of split frequencies: 0.008389

      340500 -- (-414.378) (-416.534) (-414.861) [-416.130] * (-414.575) (-412.647) (-412.856) [-417.607] -- 0:00:38
      341000 -- (-417.934) (-413.559) (-412.543) [-412.496] * (-411.769) [-412.199] (-413.657) (-415.350) -- 0:00:38
      341500 -- [-414.991] (-415.104) (-416.726) (-413.676) * (-413.226) [-412.754] (-412.777) (-414.907) -- 0:00:38
      342000 -- (-412.960) [-414.826] (-414.975) (-414.784) * (-411.910) (-415.058) (-411.710) [-412.504] -- 0:00:38
      342500 -- (-413.072) (-412.822) [-413.130] (-417.445) * (-412.846) [-413.721] (-413.427) (-415.125) -- 0:00:38
      343000 -- (-415.970) (-413.630) [-413.460] (-416.203) * (-412.933) [-413.376] (-414.483) (-413.056) -- 0:00:38
      343500 -- (-416.346) (-414.258) [-413.591] (-416.089) * (-413.177) (-412.372) [-414.286] (-412.233) -- 0:00:38
      344000 -- (-414.876) (-412.968) (-415.047) [-418.823] * (-415.889) (-414.731) (-414.460) [-412.431] -- 0:00:38
      344500 -- (-414.804) (-417.129) [-419.520] (-413.056) * [-414.406] (-416.870) (-412.791) (-417.447) -- 0:00:38
      345000 -- (-415.308) [-415.489] (-413.390) (-414.273) * (-412.526) (-412.222) (-413.279) [-413.752] -- 0:00:37

      Average standard deviation of split frequencies: 0.008260

      345500 -- (-415.663) (-417.605) (-413.277) [-415.866] * [-415.186] (-415.351) (-414.457) (-412.337) -- 0:00:37
      346000 -- (-414.321) (-412.518) (-414.844) [-414.745] * (-411.897) [-414.647] (-414.840) (-413.388) -- 0:00:37
      346500 -- (-417.781) [-414.446] (-414.140) (-414.813) * (-414.324) (-416.114) [-419.618] (-412.996) -- 0:00:37
      347000 -- (-414.122) [-413.325] (-413.682) (-413.617) * (-414.272) (-413.877) (-416.603) [-415.732] -- 0:00:37
      347500 -- (-416.307) [-413.540] (-414.740) (-413.798) * (-418.617) (-417.365) (-412.109) [-415.415] -- 0:00:37
      348000 -- (-412.520) [-412.834] (-417.177) (-412.564) * (-414.255) (-416.963) (-412.477) [-412.292] -- 0:00:37
      348500 -- [-412.622] (-411.810) (-413.903) (-412.240) * (-412.574) (-416.621) (-416.312) [-412.482] -- 0:00:37
      349000 -- (-422.115) (-414.355) [-415.359] (-414.564) * (-414.269) (-418.358) [-413.556] (-413.956) -- 0:00:37
      349500 -- (-417.279) [-413.177] (-413.124) (-416.848) * (-413.047) [-413.917] (-422.014) (-415.764) -- 0:00:37
      350000 -- (-412.900) (-416.096) [-414.112] (-413.858) * (-412.438) (-412.283) (-418.160) [-412.219] -- 0:00:37

      Average standard deviation of split frequencies: 0.009410

      350500 -- (-412.145) (-414.236) (-413.632) [-414.794] * (-411.619) (-414.731) (-414.591) [-415.263] -- 0:00:37
      351000 -- (-414.437) (-413.845) [-411.953] (-413.283) * (-412.272) (-412.965) (-416.744) [-412.526] -- 0:00:36
      351500 -- (-414.530) [-417.975] (-418.129) (-414.444) * [-412.002] (-418.424) (-415.273) (-412.557) -- 0:00:36
      352000 -- (-413.833) [-413.513] (-418.051) (-415.528) * (-412.967) [-415.186] (-417.922) (-413.616) -- 0:00:38
      352500 -- [-417.104] (-414.468) (-413.052) (-416.837) * [-414.242] (-414.819) (-416.696) (-413.097) -- 0:00:38
      353000 -- (-413.577) [-414.534] (-413.821) (-413.223) * (-417.131) (-419.179) [-415.016] (-413.237) -- 0:00:38
      353500 -- (-412.995) (-415.259) (-413.483) [-413.009] * [-414.138] (-412.420) (-412.283) (-414.487) -- 0:00:38
      354000 -- (-412.551) (-414.420) (-413.799) [-415.878] * (-415.218) [-415.300] (-415.854) (-417.269) -- 0:00:38
      354500 -- [-411.759] (-416.440) (-413.950) (-415.498) * [-412.444] (-416.644) (-412.288) (-411.817) -- 0:00:38
      355000 -- (-412.480) [-413.977] (-413.155) (-412.752) * (-413.053) (-417.608) [-413.019] (-414.683) -- 0:00:38

      Average standard deviation of split frequencies: 0.010671

      355500 -- (-413.231) (-415.505) (-412.110) [-417.201] * (-414.648) (-413.161) [-412.287] (-416.506) -- 0:00:38
      356000 -- (-412.049) (-412.023) (-413.780) [-413.582] * (-416.909) (-414.761) (-414.861) [-414.904] -- 0:00:37
      356500 -- (-412.522) (-413.211) (-412.383) [-413.810] * [-414.779] (-414.152) (-413.511) (-413.519) -- 0:00:37
      357000 -- (-414.760) [-413.290] (-412.764) (-414.735) * (-414.413) (-418.532) (-413.540) [-415.339] -- 0:00:37
      357500 -- (-414.484) (-417.843) (-414.848) [-414.523] * (-413.461) [-414.299] (-413.333) (-415.969) -- 0:00:37
      358000 -- [-411.931] (-413.131) (-413.139) (-414.117) * (-418.396) (-413.476) [-413.518] (-413.604) -- 0:00:37
      358500 -- [-412.242] (-413.753) (-416.209) (-413.082) * (-413.917) [-416.739] (-416.316) (-414.267) -- 0:00:37
      359000 -- (-412.931) [-413.096] (-414.359) (-412.606) * (-412.759) [-413.712] (-415.057) (-417.124) -- 0:00:37
      359500 -- (-412.960) (-415.810) [-413.091] (-412.849) * [-412.954] (-412.468) (-414.135) (-412.311) -- 0:00:37
      360000 -- (-419.091) (-415.907) [-414.034] (-413.082) * (-414.517) (-412.437) (-417.313) [-412.491] -- 0:00:37

      Average standard deviation of split frequencies: 0.011110

      360500 -- (-415.276) (-413.608) [-419.124] (-416.832) * (-413.768) [-413.592] (-412.986) (-416.682) -- 0:00:37
      361000 -- (-413.595) (-415.877) (-413.835) [-415.107] * (-415.125) (-413.463) [-413.960] (-419.223) -- 0:00:37
      361500 -- (-414.224) [-418.458] (-412.457) (-414.724) * (-412.497) (-413.865) (-418.086) [-413.093] -- 0:00:37
      362000 -- (-413.414) (-415.286) [-414.178] (-415.173) * (-413.794) [-413.131] (-414.311) (-412.282) -- 0:00:37
      362500 -- [-412.389] (-412.488) (-417.930) (-414.231) * (-412.144) [-416.317] (-412.420) (-414.574) -- 0:00:36
      363000 -- (-414.775) (-414.740) (-414.444) [-412.604] * (-412.229) (-414.708) [-413.616] (-414.221) -- 0:00:36
      363500 -- [-416.060] (-412.675) (-413.249) (-414.227) * [-415.175] (-413.435) (-413.437) (-412.833) -- 0:00:36
      364000 -- (-415.693) (-415.815) (-412.354) [-414.143] * (-416.800) (-417.292) (-413.837) [-415.547] -- 0:00:36
      364500 -- (-416.462) (-414.137) [-412.024] (-415.050) * (-412.329) (-417.463) [-412.515] (-413.980) -- 0:00:36
      365000 -- (-419.118) (-416.778) (-411.703) [-413.924] * (-413.709) (-416.047) (-417.112) [-414.815] -- 0:00:36

      Average standard deviation of split frequencies: 0.011449

      365500 -- [-413.271] (-415.390) (-416.203) (-414.281) * (-414.039) [-416.308] (-413.468) (-414.659) -- 0:00:36
      366000 -- (-411.986) (-419.719) [-411.933] (-412.960) * (-415.754) (-415.061) [-415.144] (-417.052) -- 0:00:36
      366500 -- (-412.538) (-415.821) (-416.243) [-413.329] * (-413.252) [-413.258] (-415.449) (-415.004) -- 0:00:36
      367000 -- (-413.979) (-416.141) (-413.197) [-412.980] * (-412.427) [-412.432] (-416.639) (-412.724) -- 0:00:36
      367500 -- (-418.034) [-414.291] (-412.666) (-413.362) * (-416.016) (-412.158) (-413.099) [-413.303] -- 0:00:36
      368000 -- (-418.441) (-412.229) [-415.575] (-412.885) * (-413.898) [-414.157] (-416.107) (-417.057) -- 0:00:36
      368500 -- (-415.163) [-412.546] (-414.810) (-413.218) * (-415.877) (-412.857) [-416.908] (-418.488) -- 0:00:35
      369000 -- (-413.047) [-415.028] (-414.900) (-414.618) * [-412.265] (-416.573) (-416.333) (-413.244) -- 0:00:35
      369500 -- (-414.443) [-415.118] (-415.662) (-418.409) * (-411.617) [-416.337] (-413.890) (-415.650) -- 0:00:37
      370000 -- (-418.570) (-413.039) [-413.051] (-415.814) * (-414.421) (-420.203) [-416.051] (-416.815) -- 0:00:37

      Average standard deviation of split frequencies: 0.011296

      370500 -- (-412.690) [-412.435] (-413.807) (-415.687) * (-412.265) (-417.742) (-412.088) [-415.462] -- 0:00:37
      371000 -- (-418.117) [-412.358] (-416.212) (-412.206) * (-413.291) (-412.552) [-411.742] (-414.816) -- 0:00:37
      371500 -- (-416.644) (-414.555) [-415.155] (-411.635) * [-411.718] (-412.469) (-416.120) (-416.475) -- 0:00:37
      372000 -- (-417.800) [-412.532] (-413.366) (-412.266) * (-412.233) (-415.293) (-414.383) [-413.413] -- 0:00:37
      372500 -- (-412.818) (-414.318) (-413.123) [-414.806] * [-412.525] (-412.387) (-417.157) (-411.796) -- 0:00:37
      373000 -- (-415.449) (-413.426) (-413.972) [-412.975] * (-413.922) (-413.740) [-415.798] (-415.317) -- 0:00:36
      373500 -- (-412.089) (-414.659) [-412.131] (-415.505) * [-412.805] (-414.126) (-414.516) (-412.149) -- 0:00:36
      374000 -- [-413.315] (-414.576) (-413.559) (-412.821) * (-414.980) [-414.865] (-414.095) (-412.697) -- 0:00:36
      374500 -- (-414.011) (-416.484) (-413.903) [-412.287] * (-413.116) (-413.029) (-412.595) [-414.564] -- 0:00:36
      375000 -- (-412.169) (-415.898) [-412.846] (-414.373) * (-413.175) [-413.344] (-412.720) (-412.768) -- 0:00:36

      Average standard deviation of split frequencies: 0.011357

      375500 -- (-412.641) [-414.402] (-412.225) (-413.374) * [-415.246] (-413.149) (-415.822) (-412.309) -- 0:00:36
      376000 -- (-412.546) (-413.471) (-413.389) [-414.085] * (-413.754) (-413.807) (-412.556) [-411.743] -- 0:00:36
      376500 -- (-412.162) [-412.636] (-412.773) (-416.048) * (-417.171) (-413.191) (-414.527) [-412.246] -- 0:00:36
      377000 -- (-412.755) (-412.300) (-413.583) [-415.430] * [-415.884] (-416.063) (-412.211) (-411.760) -- 0:00:36
      377500 -- (-415.834) [-412.373] (-412.632) (-413.143) * [-412.111] (-415.380) (-415.231) (-414.878) -- 0:00:36
      378000 -- (-414.298) (-416.910) [-413.123] (-412.607) * [-412.428] (-414.074) (-414.928) (-412.351) -- 0:00:36
      378500 -- [-416.135] (-416.257) (-414.412) (-415.857) * (-412.165) [-419.547] (-414.132) (-414.149) -- 0:00:36
      379000 -- [-413.311] (-413.330) (-415.614) (-413.944) * (-416.260) (-413.472) [-414.143] (-414.073) -- 0:00:36
      379500 -- (-414.662) (-412.685) (-413.438) [-413.036] * (-412.147) [-412.740] (-414.382) (-414.178) -- 0:00:35
      380000 -- (-413.832) [-412.281] (-415.993) (-414.915) * [-414.161] (-413.240) (-414.051) (-415.642) -- 0:00:35

      Average standard deviation of split frequencies: 0.010526

      380500 -- (-414.801) (-412.421) [-413.051] (-413.679) * (-414.289) [-414.266] (-414.687) (-415.987) -- 0:00:35
      381000 -- [-415.574] (-417.447) (-412.687) (-413.154) * (-413.859) (-420.105) [-414.411] (-415.737) -- 0:00:35
      381500 -- [-413.991] (-414.199) (-415.734) (-413.282) * (-413.505) (-413.273) (-413.007) [-414.788] -- 0:00:35
      382000 -- [-418.095] (-412.123) (-413.441) (-413.814) * (-414.718) (-415.933) (-416.818) [-415.257] -- 0:00:35
      382500 -- (-413.658) (-416.441) (-416.624) [-414.793] * (-414.998) (-412.525) [-415.246] (-412.669) -- 0:00:35
      383000 -- (-414.400) (-412.291) (-413.697) [-414.201] * (-413.597) (-416.201) [-413.907] (-413.338) -- 0:00:35
      383500 -- (-417.183) (-414.378) [-413.921] (-418.583) * (-415.459) (-415.119) [-415.320] (-413.418) -- 0:00:35
      384000 -- [-416.477] (-416.393) (-417.277) (-414.393) * (-419.232) (-415.993) (-414.991) [-413.051] -- 0:00:35
      384500 -- [-412.446] (-417.741) (-412.307) (-414.010) * [-417.981] (-413.681) (-413.068) (-413.112) -- 0:00:35
      385000 -- (-414.564) (-417.144) [-412.945] (-416.463) * (-412.876) (-413.836) (-418.155) [-413.020] -- 0:00:35

      Average standard deviation of split frequencies: 0.010457

      385500 -- (-412.913) [-413.681] (-411.774) (-412.269) * [-413.223] (-412.028) (-414.056) (-413.273) -- 0:00:35
      386000 -- (-415.048) [-415.234] (-414.344) (-414.771) * [-414.422] (-415.367) (-413.998) (-412.817) -- 0:00:34
      386500 -- (-412.764) (-417.815) (-416.548) [-413.116] * (-416.975) [-413.763] (-414.185) (-413.336) -- 0:00:36
      387000 -- (-417.897) (-412.291) [-413.421] (-415.051) * (-412.133) [-413.873] (-413.865) (-424.662) -- 0:00:36
      387500 -- [-417.481] (-412.826) (-414.125) (-413.597) * (-413.083) (-412.623) (-414.265) [-418.781] -- 0:00:36
      388000 -- (-413.456) (-412.889) (-417.416) [-415.492] * [-412.868] (-414.243) (-412.616) (-415.774) -- 0:00:36
      388500 -- (-413.617) [-414.783] (-415.328) (-415.633) * (-412.868) [-411.983] (-418.555) (-412.946) -- 0:00:36
      389000 -- [-414.292] (-413.563) (-419.019) (-415.405) * (-415.966) (-415.876) (-413.150) [-416.207] -- 0:00:36
      389500 -- [-412.688] (-413.050) (-413.422) (-413.872) * (-415.825) [-416.366] (-412.086) (-414.409) -- 0:00:36
      390000 -- (-414.332) (-415.015) (-414.643) [-412.162] * (-413.507) (-412.476) (-412.602) [-411.752] -- 0:00:35

      Average standard deviation of split frequencies: 0.010332

      390500 -- (-414.631) (-412.248) [-412.881] (-415.189) * (-412.704) [-411.663] (-412.612) (-411.841) -- 0:00:35
      391000 -- (-413.396) [-414.235] (-415.452) (-416.983) * (-414.769) (-414.018) (-412.461) [-411.722] -- 0:00:35
      391500 -- (-414.025) (-415.630) [-415.191] (-412.477) * (-413.828) [-416.466] (-411.790) (-413.618) -- 0:00:35
      392000 -- [-412.502] (-415.737) (-414.983) (-415.064) * [-415.288] (-413.492) (-411.943) (-412.153) -- 0:00:35
      392500 -- [-413.081] (-413.064) (-414.380) (-414.751) * (-414.973) (-416.262) [-413.420] (-413.781) -- 0:00:35
      393000 -- [-417.893] (-414.768) (-414.496) (-416.976) * [-413.356] (-412.617) (-412.514) (-414.135) -- 0:00:35
      393500 -- [-413.908] (-413.394) (-413.010) (-420.545) * (-414.021) [-412.559] (-413.720) (-412.578) -- 0:00:35
      394000 -- (-419.842) [-413.311] (-417.447) (-414.342) * (-413.586) (-412.011) (-414.335) [-415.940] -- 0:00:35
      394500 -- (-417.146) [-414.708] (-413.821) (-417.477) * (-413.329) (-414.694) (-412.975) [-414.416] -- 0:00:35
      395000 -- (-412.166) (-412.625) (-421.134) [-415.041] * (-413.589) [-412.396] (-413.351) (-415.695) -- 0:00:35

      Average standard deviation of split frequencies: 0.009970

      395500 -- [-413.987] (-414.572) (-414.366) (-416.498) * (-413.001) (-412.420) (-412.934) [-414.276] -- 0:00:35
      396000 -- [-412.860] (-413.948) (-411.759) (-414.055) * (-413.501) (-414.952) (-412.929) [-416.185] -- 0:00:35
      396500 -- (-412.353) (-412.327) (-412.488) [-412.389] * (-413.479) (-414.701) (-413.442) [-414.637] -- 0:00:35
      397000 -- (-412.530) (-415.694) (-414.632) [-412.791] * (-412.272) [-417.141] (-413.103) (-413.057) -- 0:00:34
      397500 -- (-414.464) (-412.817) [-414.702] (-412.494) * [-412.558] (-417.227) (-415.407) (-415.960) -- 0:00:34
      398000 -- (-418.473) (-413.397) (-412.465) [-413.126] * (-412.499) (-415.167) (-413.821) [-414.232] -- 0:00:34
      398500 -- (-416.079) (-414.567) [-414.869] (-413.780) * (-411.858) [-414.314] (-411.829) (-415.299) -- 0:00:34
      399000 -- (-415.498) (-413.122) (-415.800) [-415.138] * [-413.047] (-412.935) (-414.672) (-415.395) -- 0:00:34
      399500 -- (-415.067) (-417.320) [-416.524] (-416.073) * (-414.424) (-413.952) (-412.650) [-414.349] -- 0:00:34
      400000 -- (-414.411) [-413.991] (-412.598) (-412.825) * (-414.146) [-412.510] (-413.084) (-416.628) -- 0:00:34

      Average standard deviation of split frequencies: 0.010001

      400500 -- (-413.414) (-413.949) (-413.509) [-412.679] * [-415.368] (-412.579) (-415.270) (-413.447) -- 0:00:34
      401000 -- (-414.272) [-415.382] (-412.706) (-412.392) * [-414.249] (-413.806) (-413.278) (-413.985) -- 0:00:34
      401500 -- (-415.527) [-413.081] (-415.560) (-413.334) * (-414.822) [-415.430] (-417.342) (-413.836) -- 0:00:34
      402000 -- (-416.814) [-412.490] (-413.882) (-415.507) * [-413.960] (-414.698) (-413.000) (-413.005) -- 0:00:34
      402500 -- [-414.808] (-412.536) (-414.186) (-416.060) * (-414.064) (-416.976) [-417.098] (-414.039) -- 0:00:34
      403000 -- [-415.040] (-412.624) (-416.299) (-412.755) * (-414.647) (-414.922) [-413.565] (-412.897) -- 0:00:34
      403500 -- (-413.581) (-415.518) (-415.007) [-413.464] * (-415.991) (-413.822) [-413.607] (-412.882) -- 0:00:35
      404000 -- (-415.194) [-414.017] (-412.006) (-419.289) * (-413.002) (-414.160) [-412.858] (-415.250) -- 0:00:35
      404500 -- (-414.205) [-416.391] (-414.868) (-416.326) * [-413.148] (-416.187) (-414.216) (-415.329) -- 0:00:35
      405000 -- (-412.831) [-414.852] (-415.174) (-414.888) * [-413.820] (-413.120) (-412.943) (-414.025) -- 0:00:35

      Average standard deviation of split frequencies: 0.009579

      405500 -- (-414.048) [-415.649] (-414.002) (-418.130) * (-416.421) (-411.626) [-413.381] (-412.573) -- 0:00:35
      406000 -- (-413.634) [-412.987] (-412.306) (-411.753) * [-412.782] (-414.537) (-416.858) (-411.918) -- 0:00:35
      406500 -- (-414.523) (-412.681) (-413.181) [-414.195] * (-413.085) (-414.181) (-416.859) [-413.141] -- 0:00:35
      407000 -- (-414.973) [-413.299] (-413.084) (-414.024) * (-413.825) [-413.820] (-417.245) (-414.069) -- 0:00:34
      407500 -- (-413.436) [-412.579] (-412.216) (-413.640) * (-413.875) (-415.465) [-412.242] (-412.788) -- 0:00:34
      408000 -- (-412.118) [-412.010] (-413.617) (-413.479) * (-412.284) [-414.634] (-412.542) (-412.768) -- 0:00:34
      408500 -- (-412.859) (-412.243) [-412.567] (-417.114) * (-413.519) (-412.011) (-412.294) [-414.992] -- 0:00:34
      409000 -- [-415.333] (-414.847) (-412.902) (-412.004) * (-418.910) (-416.976) [-411.753] (-413.081) -- 0:00:34
      409500 -- (-414.942) (-416.217) (-412.801) [-412.963] * (-413.241) (-412.842) [-413.934] (-412.678) -- 0:00:34
      410000 -- (-412.698) (-413.376) (-413.815) [-412.753] * (-413.484) [-414.395] (-412.918) (-415.065) -- 0:00:34

      Average standard deviation of split frequencies: 0.009111

      410500 -- (-413.705) (-412.589) (-413.397) [-416.383] * (-414.461) (-422.807) [-414.074] (-417.291) -- 0:00:34
      411000 -- (-413.220) (-413.214) [-415.090] (-414.103) * (-416.671) (-416.100) [-413.127] (-415.824) -- 0:00:34
      411500 -- (-413.594) [-414.436] (-414.269) (-419.580) * (-416.473) (-413.568) (-412.000) [-415.016] -- 0:00:34
      412000 -- (-415.032) [-413.697] (-414.371) (-415.255) * (-416.008) [-412.651] (-417.103) (-418.440) -- 0:00:34
      412500 -- [-414.408] (-414.376) (-415.463) (-416.417) * [-414.793] (-412.935) (-413.940) (-418.111) -- 0:00:34
      413000 -- (-412.280) [-413.020] (-416.558) (-411.555) * [-413.347] (-416.111) (-415.901) (-413.952) -- 0:00:34
      413500 -- [-412.810] (-412.202) (-415.118) (-416.034) * [-412.059] (-416.068) (-419.965) (-415.385) -- 0:00:34
      414000 -- [-412.176] (-415.251) (-412.442) (-413.912) * [-412.993] (-415.461) (-413.641) (-413.828) -- 0:00:33
      414500 -- [-412.296] (-412.739) (-414.866) (-415.258) * (-413.010) (-415.352) [-413.895] (-417.271) -- 0:00:33
      415000 -- (-412.969) (-413.673) (-416.985) [-412.719] * [-415.910] (-415.122) (-413.622) (-420.179) -- 0:00:33

      Average standard deviation of split frequencies: 0.009420

      415500 -- [-412.007] (-414.613) (-412.945) (-412.311) * (-413.734) (-418.557) (-412.297) [-413.521] -- 0:00:33
      416000 -- (-413.366) (-421.984) (-415.791) [-411.973] * [-412.626] (-416.571) (-416.404) (-416.028) -- 0:00:33
      416500 -- [-413.395] (-415.962) (-411.890) (-413.719) * (-415.573) (-414.207) (-412.012) [-413.844] -- 0:00:33
      417000 -- (-415.480) [-415.502] (-413.425) (-412.610) * [-412.249] (-415.539) (-414.975) (-416.975) -- 0:00:33
      417500 -- (-419.543) (-413.674) [-413.184] (-416.590) * [-413.190] (-413.808) (-412.061) (-413.428) -- 0:00:33
      418000 -- (-416.126) (-413.444) (-415.216) [-413.830] * (-412.259) (-413.884) [-412.686] (-412.142) -- 0:00:33
      418500 -- (-413.658) (-415.681) [-416.566] (-412.312) * (-414.755) (-416.165) [-411.743] (-413.624) -- 0:00:33
      419000 -- (-416.483) (-421.781) [-413.412] (-412.364) * (-413.927) (-413.119) [-415.647] (-415.021) -- 0:00:33
      419500 -- (-413.377) (-413.840) [-415.061] (-413.369) * (-413.653) [-413.650] (-414.909) (-418.677) -- 0:00:33
      420000 -- [-414.222] (-413.825) (-412.499) (-413.940) * (-411.941) [-411.625] (-416.194) (-415.185) -- 0:00:33

      Average standard deviation of split frequencies: 0.009315

      420500 -- (-413.012) (-415.308) [-417.329] (-412.013) * (-414.628) [-412.608] (-416.430) (-417.110) -- 0:00:34
      421000 -- (-415.324) (-416.326) (-414.253) [-415.109] * (-414.386) (-413.707) (-417.519) [-413.558] -- 0:00:34
      421500 -- (-413.594) (-414.137) [-413.143] (-415.647) * (-414.038) [-412.116] (-415.800) (-413.501) -- 0:00:34
      422000 -- (-412.797) (-414.019) [-412.915] (-414.857) * (-412.135) (-412.603) (-413.108) [-412.990] -- 0:00:34
      422500 -- (-411.772) [-412.831] (-418.544) (-414.856) * [-411.671] (-412.540) (-412.766) (-415.970) -- 0:00:34
      423000 -- (-418.001) [-415.463] (-415.046) (-412.025) * [-412.718] (-413.986) (-412.934) (-414.785) -- 0:00:34
      423500 -- (-417.709) (-411.758) (-415.383) [-412.521] * [-413.458] (-413.648) (-412.653) (-412.434) -- 0:00:34
      424000 -- (-417.656) [-412.758] (-413.828) (-413.440) * (-414.343) (-416.239) (-414.815) [-412.155] -- 0:00:33
      424500 -- [-420.321] (-415.581) (-411.906) (-414.838) * (-414.814) [-417.289] (-415.503) (-412.801) -- 0:00:33
      425000 -- (-413.285) (-413.249) (-412.455) [-412.467] * [-414.479] (-415.951) (-416.437) (-415.209) -- 0:00:33

      Average standard deviation of split frequencies: 0.011001

      425500 -- (-414.178) (-412.882) [-413.927] (-412.115) * (-414.144) (-416.108) (-424.587) [-414.573] -- 0:00:33
      426000 -- (-414.872) [-413.009] (-412.931) (-412.213) * [-411.967] (-413.923) (-413.211) (-411.968) -- 0:00:33
      426500 -- (-411.792) (-412.609) (-413.518) [-414.749] * (-411.861) (-413.579) [-413.007] (-416.871) -- 0:00:33
      427000 -- (-412.670) [-415.927] (-412.216) (-416.247) * [-411.771] (-414.307) (-417.086) (-414.775) -- 0:00:33
      427500 -- (-418.378) [-412.905] (-415.626) (-414.683) * (-413.069) [-414.720] (-414.374) (-415.939) -- 0:00:33
      428000 -- (-413.373) [-415.072] (-413.754) (-413.583) * (-412.304) (-412.377) [-413.845] (-414.980) -- 0:00:33
      428500 -- [-413.969] (-414.214) (-415.476) (-412.308) * (-415.849) (-413.549) (-413.725) [-413.620] -- 0:00:33
      429000 -- [-413.090] (-414.522) (-417.223) (-417.171) * (-414.263) [-416.154] (-412.788) (-412.117) -- 0:00:33
      429500 -- (-413.213) [-413.915] (-416.559) (-412.194) * [-415.546] (-415.031) (-418.735) (-412.997) -- 0:00:33
      430000 -- (-412.175) [-414.532] (-419.485) (-415.810) * (-415.677) (-415.183) [-414.529] (-412.554) -- 0:00:33

      Average standard deviation of split frequencies: 0.011332

      430500 -- (-415.091) (-414.640) [-418.760] (-412.671) * (-412.918) [-413.032] (-415.185) (-415.181) -- 0:00:33
      431000 -- (-414.261) [-413.438] (-419.799) (-414.013) * (-412.776) (-412.932) [-413.781] (-415.125) -- 0:00:33
      431500 -- [-412.037] (-414.879) (-418.474) (-414.087) * (-413.223) (-413.734) [-413.371] (-412.084) -- 0:00:32
      432000 -- [-413.312] (-416.486) (-420.804) (-415.926) * (-412.390) [-414.915] (-412.354) (-415.657) -- 0:00:32
      432500 -- (-413.649) (-416.600) (-415.456) [-416.993] * (-411.971) (-415.330) [-414.898] (-417.138) -- 0:00:32
      433000 -- [-412.980] (-412.925) (-413.612) (-413.881) * [-415.254] (-415.050) (-415.972) (-422.231) -- 0:00:32
      433500 -- (-413.823) (-415.449) [-413.295] (-413.492) * (-417.169) (-414.830) [-412.384] (-419.310) -- 0:00:32
      434000 -- (-414.626) (-411.916) (-412.226) [-414.516] * (-415.454) [-413.823] (-412.663) (-411.973) -- 0:00:32
      434500 -- (-413.793) (-412.536) [-413.355] (-417.063) * [-412.043] (-415.926) (-416.317) (-413.041) -- 0:00:32
      435000 -- [-414.186] (-413.563) (-416.222) (-420.634) * (-415.923) (-416.383) (-416.392) [-413.647] -- 0:00:32

      Average standard deviation of split frequencies: 0.011257

      435500 -- (-419.871) [-414.631] (-414.853) (-415.953) * (-414.826) [-416.566] (-413.610) (-413.479) -- 0:00:32
      436000 -- (-413.353) [-412.498] (-414.072) (-412.467) * [-413.636] (-415.114) (-412.648) (-416.928) -- 0:00:32
      436500 -- (-412.920) (-413.111) (-414.274) [-412.493] * (-415.013) (-418.868) [-412.360] (-413.501) -- 0:00:32
      437000 -- (-413.189) (-413.732) [-413.743] (-415.260) * (-414.806) (-412.855) [-413.382] (-413.888) -- 0:00:32
      437500 -- (-412.319) (-414.833) (-414.895) [-413.803] * (-411.682) (-413.046) [-412.483] (-412.276) -- 0:00:32
      438000 -- (-412.445) [-415.304] (-411.948) (-414.877) * (-413.130) [-412.269] (-413.740) (-414.234) -- 0:00:33
      438500 -- (-414.091) (-416.504) [-416.567] (-416.028) * (-414.788) (-413.743) (-414.266) [-415.454] -- 0:00:33
      439000 -- [-412.986] (-414.954) (-413.525) (-415.422) * [-414.392] (-412.312) (-413.586) (-412.447) -- 0:00:33
      439500 -- (-414.253) [-412.673] (-414.611) (-413.044) * (-412.307) (-413.078) [-415.494] (-416.014) -- 0:00:33
      440000 -- (-417.643) (-413.026) [-415.354] (-412.873) * (-411.966) (-414.542) (-412.407) [-413.067] -- 0:00:33

      Average standard deviation of split frequencies: 0.011012

      440500 -- [-415.582] (-412.277) (-414.220) (-413.150) * [-412.086] (-412.838) (-412.324) (-413.468) -- 0:00:33
      441000 -- (-413.778) [-413.046] (-417.339) (-413.368) * (-414.371) (-414.347) [-412.414] (-415.738) -- 0:00:32
      441500 -- (-412.659) (-413.035) (-418.818) [-412.884] * (-413.836) (-413.203) [-413.856] (-413.356) -- 0:00:32
      442000 -- (-416.178) (-413.744) (-417.989) [-414.847] * (-414.570) [-412.516] (-412.320) (-417.745) -- 0:00:32
      442500 -- (-413.261) (-414.977) (-416.579) [-414.493] * [-412.798] (-412.879) (-412.112) (-418.111) -- 0:00:32
      443000 -- (-413.229) [-413.993] (-415.133) (-417.044) * [-416.145] (-412.949) (-414.835) (-412.655) -- 0:00:32
      443500 -- [-415.805] (-415.747) (-412.909) (-412.530) * [-412.824] (-414.443) (-414.864) (-416.548) -- 0:00:32
      444000 -- (-413.920) (-414.358) [-412.036] (-412.449) * [-412.896] (-414.618) (-414.762) (-413.264) -- 0:00:32
      444500 -- (-412.344) [-417.145] (-412.416) (-414.644) * (-413.987) (-414.414) (-413.795) [-412.562] -- 0:00:32
      445000 -- (-412.476) (-412.452) [-412.697] (-413.250) * (-411.565) (-412.720) [-417.952] (-412.485) -- 0:00:32

      Average standard deviation of split frequencies: 0.011392

      445500 -- (-416.088) (-412.790) (-413.508) [-413.446] * [-412.981] (-412.189) (-422.224) (-413.911) -- 0:00:32
      446000 -- [-414.101] (-413.233) (-415.349) (-413.547) * (-414.131) [-412.762] (-414.431) (-412.534) -- 0:00:32
      446500 -- [-413.515] (-414.796) (-412.000) (-417.778) * (-414.818) (-413.882) (-413.587) [-412.891] -- 0:00:32
      447000 -- (-413.843) (-415.257) [-414.070] (-412.372) * (-414.328) [-415.178] (-415.463) (-414.029) -- 0:00:32
      447500 -- (-413.567) [-413.637] (-413.877) (-416.378) * (-414.850) [-413.638] (-414.148) (-412.314) -- 0:00:32
      448000 -- (-412.555) (-417.751) [-413.267] (-417.750) * (-415.843) [-412.552] (-413.172) (-414.876) -- 0:00:32
      448500 -- [-412.620] (-413.556) (-414.491) (-419.279) * (-416.973) [-412.341] (-412.570) (-412.867) -- 0:00:31
      449000 -- [-417.662] (-414.793) (-414.107) (-414.503) * (-417.594) (-413.459) [-414.107] (-412.781) -- 0:00:31
      449500 -- (-418.107) (-414.420) (-415.076) [-413.899] * [-415.674] (-417.104) (-416.932) (-416.773) -- 0:00:31
      450000 -- [-412.632] (-413.447) (-414.711) (-416.310) * (-414.403) [-412.332] (-414.656) (-413.228) -- 0:00:31

      Average standard deviation of split frequencies: 0.011622

      450500 -- (-414.790) [-414.258] (-412.157) (-415.485) * (-414.005) (-413.011) (-413.701) [-413.889] -- 0:00:31
      451000 -- [-414.156] (-417.451) (-412.508) (-415.443) * (-412.462) [-415.261] (-415.356) (-413.142) -- 0:00:31
      451500 -- (-414.407) [-412.834] (-413.372) (-415.082) * (-413.713) (-413.685) (-413.420) [-412.577] -- 0:00:31
      452000 -- (-414.574) (-413.816) [-412.869] (-415.680) * (-413.013) (-415.811) (-414.063) [-414.875] -- 0:00:31
      452500 -- (-417.269) (-413.559) (-416.283) [-414.508] * (-412.344) [-412.808] (-413.097) (-412.682) -- 0:00:31
      453000 -- (-412.774) (-414.227) [-414.689] (-415.700) * [-411.865] (-412.932) (-412.498) (-416.607) -- 0:00:31
      453500 -- (-417.514) (-413.217) [-414.510] (-416.122) * (-412.132) (-415.941) [-412.422] (-417.225) -- 0:00:31
      454000 -- [-417.486] (-415.498) (-412.035) (-416.665) * (-414.382) (-413.948) (-413.724) [-413.989] -- 0:00:31
      454500 -- (-413.981) [-418.462] (-412.706) (-414.544) * (-415.849) (-413.685) [-416.329] (-412.565) -- 0:00:31
      455000 -- (-413.993) (-412.910) [-416.601] (-417.404) * (-413.620) (-416.333) [-414.568] (-415.268) -- 0:00:32

      Average standard deviation of split frequencies: 0.011774

      455500 -- (-413.728) (-411.898) [-413.673] (-412.377) * [-413.947] (-413.612) (-413.444) (-417.581) -- 0:00:32
      456000 -- (-413.514) [-413.193] (-415.403) (-415.179) * (-413.626) (-415.563) [-414.219] (-413.691) -- 0:00:32
      456500 -- (-412.109) (-413.996) (-413.025) [-413.250] * (-412.573) [-412.204] (-414.559) (-415.085) -- 0:00:32
      457000 -- (-415.185) (-415.267) (-413.119) [-414.333] * (-414.477) (-412.769) (-414.125) [-415.830] -- 0:00:32
      457500 -- [-415.555] (-418.255) (-411.984) (-414.429) * [-412.608] (-413.181) (-413.773) (-414.230) -- 0:00:32
      458000 -- (-413.230) (-415.117) [-412.591] (-415.296) * [-411.823] (-420.670) (-412.189) (-412.825) -- 0:00:31
      458500 -- (-412.182) [-416.903] (-416.057) (-412.163) * (-412.552) (-413.723) (-413.499) [-412.410] -- 0:00:31
      459000 -- (-414.236) (-416.123) (-416.248) [-412.641] * [-416.003] (-413.465) (-417.133) (-412.614) -- 0:00:31
      459500 -- (-415.286) [-412.741] (-414.085) (-413.477) * (-415.421) [-413.671] (-414.717) (-414.573) -- 0:00:31
      460000 -- [-419.798] (-418.053) (-413.247) (-412.585) * (-412.887) (-415.773) (-413.171) [-414.758] -- 0:00:31

      Average standard deviation of split frequencies: 0.012052

      460500 -- (-414.915) (-414.067) [-414.637] (-413.636) * (-415.114) [-414.140] (-414.643) (-412.876) -- 0:00:31
      461000 -- (-413.826) (-413.112) [-416.656] (-417.393) * (-419.050) [-413.005] (-414.038) (-412.021) -- 0:00:31
      461500 -- (-413.020) (-413.055) [-414.035] (-411.930) * (-417.571) (-413.240) (-412.887) [-415.058] -- 0:00:31
      462000 -- (-413.038) [-412.483] (-413.171) (-412.699) * (-412.227) [-412.055] (-415.691) (-412.790) -- 0:00:31
      462500 -- [-413.277] (-416.707) (-412.531) (-414.261) * (-413.552) (-415.428) (-413.277) [-413.316] -- 0:00:31
      463000 -- (-411.855) (-411.925) [-412.148] (-412.129) * [-417.153] (-415.620) (-412.994) (-412.882) -- 0:00:31
      463500 -- (-418.768) (-412.786) (-412.230) [-414.005] * (-412.029) [-413.162] (-415.188) (-416.923) -- 0:00:31
      464000 -- [-414.197] (-414.832) (-415.256) (-415.363) * (-415.365) [-414.404] (-414.584) (-414.641) -- 0:00:31
      464500 -- (-412.761) (-413.853) (-413.841) [-414.330] * (-413.272) [-414.562] (-418.459) (-413.461) -- 0:00:31
      465000 -- [-412.432] (-414.370) (-413.527) (-413.228) * (-413.141) [-413.293] (-415.168) (-414.956) -- 0:00:31

      Average standard deviation of split frequencies: 0.011858

      465500 -- [-412.113] (-417.304) (-413.619) (-413.625) * (-413.108) [-414.093] (-413.443) (-417.618) -- 0:00:31
      466000 -- [-413.625] (-414.279) (-415.076) (-413.259) * (-413.275) [-413.475] (-414.553) (-415.429) -- 0:00:30
      466500 -- [-412.230] (-415.658) (-413.882) (-416.199) * (-413.659) (-412.614) [-412.758] (-416.919) -- 0:00:30
      467000 -- (-411.818) (-413.878) (-415.637) [-415.586] * (-415.180) [-412.532] (-417.183) (-416.001) -- 0:00:30
      467500 -- [-414.324] (-418.540) (-412.617) (-413.883) * (-416.769) (-415.582) (-419.633) [-414.801] -- 0:00:30
      468000 -- (-411.831) (-418.056) [-412.666] (-413.269) * [-414.686] (-416.652) (-416.432) (-416.987) -- 0:00:30
      468500 -- (-413.263) (-412.389) (-413.742) [-412.264] * (-414.652) [-416.856] (-414.022) (-416.754) -- 0:00:30
      469000 -- (-412.085) (-414.726) [-412.262] (-414.311) * (-413.760) [-413.419] (-412.510) (-416.773) -- 0:00:30
      469500 -- (-413.179) (-417.617) [-411.766] (-412.941) * (-417.063) [-412.312] (-413.873) (-415.860) -- 0:00:30
      470000 -- (-412.320) [-413.017] (-413.870) (-415.260) * [-415.864] (-414.494) (-415.097) (-413.577) -- 0:00:30

      Average standard deviation of split frequencies: 0.011665

      470500 -- [-414.415] (-413.074) (-419.807) (-414.552) * [-414.093] (-419.184) (-418.253) (-411.731) -- 0:00:30
      471000 -- (-412.709) (-412.764) (-414.828) [-413.732] * (-418.493) (-414.601) (-413.096) [-413.037] -- 0:00:30
      471500 -- [-413.475] (-412.739) (-414.425) (-412.623) * [-416.243] (-414.779) (-412.870) (-412.802) -- 0:00:30
      472000 -- (-412.853) [-414.891] (-418.611) (-413.784) * (-414.166) (-413.293) (-413.904) [-412.709] -- 0:00:31
      472500 -- [-415.000] (-413.260) (-414.784) (-412.383) * (-413.747) (-412.937) [-416.834] (-413.221) -- 0:00:31
      473000 -- (-413.589) (-413.621) (-414.396) [-416.082] * (-412.525) (-415.830) (-414.158) [-413.946] -- 0:00:31
      473500 -- (-414.334) (-412.665) (-411.975) [-411.816] * (-417.269) [-411.756] (-412.590) (-411.891) -- 0:00:31
      474000 -- [-415.090] (-416.336) (-413.295) (-413.645) * (-412.619) [-412.958] (-412.773) (-414.170) -- 0:00:31
      474500 -- (-417.576) (-417.974) [-412.879] (-416.401) * (-412.535) (-413.295) (-416.155) [-416.886] -- 0:00:31
      475000 -- (-412.290) (-412.455) [-412.587] (-413.763) * (-416.841) (-415.184) [-414.024] (-414.473) -- 0:00:30

      Average standard deviation of split frequencies: 0.011476

      475500 -- (-414.481) [-413.159] (-414.193) (-416.528) * (-412.703) [-415.575] (-415.308) (-414.819) -- 0:00:30
      476000 -- [-412.411] (-413.977) (-415.159) (-416.353) * [-412.609] (-412.810) (-415.354) (-413.119) -- 0:00:30
      476500 -- (-414.419) (-418.490) (-412.494) [-414.265] * (-412.843) [-415.273] (-413.815) (-415.113) -- 0:00:30
      477000 -- (-414.748) (-413.946) (-412.694) [-414.245] * (-412.747) [-412.515] (-412.055) (-413.848) -- 0:00:30
      477500 -- (-413.530) (-414.143) (-412.877) [-414.772] * (-412.692) (-418.542) [-413.055] (-418.469) -- 0:00:30
      478000 -- (-414.429) (-414.297) (-411.995) [-412.674] * (-413.830) [-414.325] (-412.610) (-413.761) -- 0:00:30
      478500 -- (-415.448) (-413.408) [-413.621] (-415.501) * (-414.465) (-414.558) (-413.628) [-412.044] -- 0:00:30
      479000 -- [-414.529] (-412.602) (-414.449) (-414.322) * [-412.013] (-413.938) (-414.505) (-411.855) -- 0:00:30
      479500 -- (-415.670) (-413.609) (-413.847) [-416.760] * (-411.926) (-413.621) [-413.230] (-412.596) -- 0:00:30
      480000 -- (-412.467) (-414.847) (-418.704) [-414.181] * (-412.319) [-414.837] (-414.015) (-412.123) -- 0:00:30

      Average standard deviation of split frequencies: 0.011646

      480500 -- (-412.940) (-414.710) [-417.563] (-413.547) * [-415.488] (-416.355) (-414.769) (-411.657) -- 0:00:30
      481000 -- (-412.641) (-413.366) (-416.505) [-416.031] * (-413.534) [-418.359] (-413.892) (-412.631) -- 0:00:30
      481500 -- (-412.476) (-415.854) [-413.540] (-413.401) * (-414.510) (-413.220) (-419.124) [-415.664] -- 0:00:30
      482000 -- (-412.224) (-415.456) [-416.404] (-413.966) * [-412.941] (-417.802) (-415.737) (-413.147) -- 0:00:30
      482500 -- (-412.838) (-416.279) (-416.127) [-415.520] * (-412.131) (-413.368) (-413.866) [-415.271] -- 0:00:30
      483000 -- (-413.177) [-412.126] (-415.228) (-412.538) * [-414.264] (-413.035) (-417.519) (-413.015) -- 0:00:29
      483500 -- (-418.309) [-413.062] (-413.637) (-412.402) * (-415.658) [-413.526] (-413.995) (-415.524) -- 0:00:29
      484000 -- (-412.077) (-416.752) (-414.403) [-414.921] * (-412.478) (-415.155) (-415.139) [-413.555] -- 0:00:29
      484500 -- (-412.843) (-414.025) [-413.336] (-413.775) * [-413.426] (-413.219) (-413.358) (-414.208) -- 0:00:29
      485000 -- (-413.528) (-412.774) (-414.404) [-414.585] * (-413.801) (-414.743) (-416.673) [-415.754] -- 0:00:29

      Average standard deviation of split frequencies: 0.011811

      485500 -- (-414.333) [-414.025] (-414.461) (-412.014) * (-412.614) [-411.545] (-416.866) (-413.605) -- 0:00:29
      486000 -- [-414.344] (-417.443) (-413.812) (-411.959) * (-416.694) (-413.589) [-412.558] (-413.463) -- 0:00:29
      486500 -- [-413.486] (-414.521) (-415.149) (-415.659) * [-414.525] (-416.270) (-412.295) (-413.757) -- 0:00:29
      487000 -- (-417.423) (-416.601) (-412.873) [-413.506] * (-414.808) (-415.692) (-413.905) [-415.094] -- 0:00:29
      487500 -- (-416.242) [-413.038] (-412.573) (-413.116) * (-416.084) [-412.655] (-414.652) (-420.276) -- 0:00:29
      488000 -- (-414.247) (-412.566) [-411.886] (-412.125) * (-412.984) (-415.770) (-414.192) [-415.952] -- 0:00:29
      488500 -- [-413.352] (-415.220) (-414.427) (-412.844) * (-418.212) [-413.459] (-415.178) (-414.487) -- 0:00:29
      489000 -- (-415.444) (-413.902) [-413.828] (-412.327) * (-417.282) [-412.470] (-413.815) (-414.210) -- 0:00:29
      489500 -- (-415.077) (-414.674) [-417.352] (-414.834) * [-416.357] (-413.530) (-413.727) (-413.587) -- 0:00:30
      490000 -- (-411.839) (-413.894) (-418.130) [-413.289] * (-415.378) [-413.641] (-412.535) (-414.715) -- 0:00:30

      Average standard deviation of split frequencies: 0.011472

      490500 -- (-412.168) [-412.522] (-416.280) (-412.383) * (-414.990) [-412.601] (-413.976) (-412.520) -- 0:00:30
      491000 -- [-412.677] (-414.813) (-412.687) (-417.451) * (-412.576) (-416.375) [-412.710] (-414.625) -- 0:00:30
      491500 -- (-414.947) (-414.024) (-412.611) [-412.826] * (-414.020) (-416.190) (-414.968) [-414.723] -- 0:00:30
      492000 -- [-414.321] (-413.022) (-415.898) (-413.161) * (-413.966) (-413.035) [-413.227] (-413.756) -- 0:00:29
      492500 -- [-415.662] (-417.049) (-412.709) (-414.454) * (-413.587) [-414.121] (-413.662) (-412.459) -- 0:00:29
      493000 -- [-413.413] (-416.448) (-414.121) (-413.550) * [-413.534] (-415.875) (-412.881) (-411.679) -- 0:00:29
      493500 -- [-414.546] (-414.327) (-412.268) (-415.309) * (-414.176) (-416.304) [-413.793] (-414.886) -- 0:00:29
      494000 -- (-414.687) (-413.477) [-414.326] (-414.569) * (-415.208) (-414.364) [-413.366] (-412.584) -- 0:00:29
      494500 -- [-412.963] (-413.563) (-412.897) (-415.357) * (-412.673) [-413.097] (-413.760) (-411.872) -- 0:00:29
      495000 -- (-412.764) (-412.867) (-412.927) [-412.112] * (-413.325) [-414.692] (-413.826) (-413.753) -- 0:00:29

      Average standard deviation of split frequencies: 0.011852

      495500 -- (-413.777) (-413.840) (-414.554) [-412.938] * (-412.630) [-413.843] (-414.418) (-414.864) -- 0:00:29
      496000 -- (-413.496) [-415.961] (-418.451) (-411.992) * [-413.363] (-417.182) (-419.003) (-414.440) -- 0:00:29
      496500 -- (-417.849) [-414.981] (-415.945) (-412.994) * (-412.207) (-412.590) [-413.409] (-413.572) -- 0:00:29
      497000 -- (-414.291) (-415.985) [-413.688] (-412.194) * [-413.807] (-413.284) (-412.394) (-412.149) -- 0:00:29
      497500 -- (-413.640) (-414.783) [-413.598] (-412.972) * (-418.531) (-413.288) [-416.721] (-411.998) -- 0:00:29
      498000 -- (-415.286) (-416.151) (-413.163) [-414.727] * (-413.258) [-413.280] (-413.426) (-412.336) -- 0:00:29
      498500 -- (-415.375) [-415.432] (-412.149) (-416.358) * (-413.327) [-412.208] (-414.603) (-415.857) -- 0:00:29
      499000 -- [-412.150] (-413.535) (-412.167) (-413.197) * (-413.997) (-414.879) [-412.896] (-414.822) -- 0:00:29
      499500 -- (-413.784) [-413.181] (-414.785) (-414.370) * [-413.191] (-413.958) (-414.511) (-413.366) -- 0:00:29
      500000 -- (-413.341) (-415.970) [-413.515] (-416.965) * (-417.794) (-412.688) (-412.262) [-412.062] -- 0:00:29

      Average standard deviation of split frequencies: 0.011908

      500500 -- (-415.954) (-414.179) (-412.670) [-413.839] * [-413.378] (-416.584) (-413.435) (-414.707) -- 0:00:28
      501000 -- (-412.345) [-412.406] (-414.632) (-415.721) * (-414.131) (-417.312) [-413.572] (-414.008) -- 0:00:28
      501500 -- [-414.006] (-414.871) (-416.768) (-416.637) * (-416.304) (-413.821) (-416.455) [-416.376] -- 0:00:28
      502000 -- [-415.716] (-413.084) (-414.540) (-419.472) * [-417.190] (-411.817) (-414.362) (-417.393) -- 0:00:28
      502500 -- (-414.524) [-416.767] (-413.607) (-414.433) * (-413.518) (-412.384) [-416.219] (-413.956) -- 0:00:28
      503000 -- [-412.937] (-412.265) (-413.257) (-416.742) * (-412.054) (-413.317) (-414.814) [-413.860] -- 0:00:28
      503500 -- (-412.130) [-415.110] (-418.539) (-413.492) * (-413.096) (-417.558) (-412.008) [-413.080] -- 0:00:28
      504000 -- [-414.216] (-414.283) (-413.401) (-412.434) * (-414.453) [-413.397] (-412.806) (-416.102) -- 0:00:28
      504500 -- (-412.256) [-412.405] (-414.189) (-413.285) * (-415.638) (-417.199) [-414.446] (-413.396) -- 0:00:28
      505000 -- (-413.077) (-413.388) (-415.218) [-417.991] * (-413.533) (-413.996) [-416.176] (-412.717) -- 0:00:28

      Average standard deviation of split frequencies: 0.011399

      505500 -- (-413.006) (-413.289) (-413.507) [-412.814] * (-412.284) (-415.125) [-414.921] (-414.937) -- 0:00:28
      506000 -- (-415.423) [-411.633] (-412.205) (-415.295) * (-412.386) (-414.695) (-413.612) [-416.022] -- 0:00:29
      506500 -- (-415.979) (-413.509) (-414.308) [-414.001] * (-412.998) [-412.959] (-416.848) (-413.128) -- 0:00:29
      507000 -- (-417.556) (-415.698) [-413.412] (-414.441) * (-414.656) [-414.539] (-414.970) (-413.640) -- 0:00:29
      507500 -- (-414.072) (-414.920) (-413.118) [-412.518] * (-414.461) (-412.994) [-414.686] (-413.145) -- 0:00:29
      508000 -- (-414.759) (-414.256) (-414.076) [-412.914] * [-413.449] (-413.495) (-417.986) (-413.776) -- 0:00:29
      508500 -- [-413.899] (-413.392) (-413.180) (-413.032) * (-419.588) [-411.680] (-414.787) (-412.539) -- 0:00:28
      509000 -- (-416.244) (-414.686) (-412.952) [-414.033] * (-413.041) (-411.898) [-412.597] (-412.555) -- 0:00:28
      509500 -- [-413.281] (-417.239) (-413.972) (-413.830) * (-413.647) (-413.596) [-414.418] (-414.342) -- 0:00:28
      510000 -- (-415.379) (-423.701) [-412.364] (-418.578) * (-413.302) [-413.524] (-413.942) (-414.571) -- 0:00:28

      Average standard deviation of split frequencies: 0.011457

      510500 -- (-412.697) (-418.282) (-416.638) [-412.337] * (-415.304) [-414.207] (-413.994) (-413.310) -- 0:00:28
      511000 -- [-412.610] (-415.685) (-414.355) (-412.883) * (-413.582) (-413.439) [-415.177] (-415.892) -- 0:00:28
      511500 -- [-412.544] (-416.698) (-415.782) (-413.008) * [-412.246] (-414.892) (-414.120) (-414.706) -- 0:00:28
      512000 -- [-414.399] (-413.684) (-414.588) (-415.492) * (-412.760) (-418.981) [-412.852] (-412.976) -- 0:00:28
      512500 -- (-418.799) (-413.594) [-414.421] (-416.063) * (-413.864) (-412.402) [-413.081] (-412.055) -- 0:00:28
      513000 -- (-416.921) [-413.104] (-421.651) (-414.926) * (-414.590) (-412.611) [-413.065] (-415.194) -- 0:00:28
      513500 -- [-412.194] (-414.045) (-419.494) (-413.266) * (-413.662) (-414.225) [-412.736] (-416.591) -- 0:00:28
      514000 -- [-416.342] (-414.990) (-416.704) (-413.834) * [-416.901] (-413.047) (-415.793) (-414.300) -- 0:00:28
      514500 -- [-415.626] (-415.007) (-419.899) (-414.096) * (-412.412) (-413.221) (-413.359) [-414.562] -- 0:00:28
      515000 -- (-413.690) (-415.597) (-413.473) [-415.099] * [-411.789] (-413.690) (-417.265) (-414.737) -- 0:00:28

      Average standard deviation of split frequencies: 0.012447

      515500 -- (-418.244) (-415.131) [-413.160] (-415.774) * (-414.748) [-413.234] (-414.973) (-412.931) -- 0:00:28
      516000 -- (-413.377) (-415.767) [-413.604] (-412.451) * (-414.341) (-416.014) [-411.838] (-413.436) -- 0:00:28
      516500 -- (-414.667) [-413.228] (-413.931) (-414.080) * (-415.699) [-413.592] (-415.173) (-415.896) -- 0:00:28
      517000 -- (-415.229) (-413.827) (-413.496) [-415.884] * (-416.798) (-415.227) [-414.145] (-413.880) -- 0:00:28
      517500 -- (-412.728) [-412.698] (-412.676) (-414.902) * (-413.968) [-415.689] (-412.742) (-414.400) -- 0:00:27
      518000 -- (-413.887) (-413.966) [-412.373] (-414.696) * [-413.268] (-414.453) (-413.301) (-414.381) -- 0:00:27
      518500 -- (-412.517) [-412.357] (-414.090) (-416.568) * [-414.054] (-412.110) (-414.327) (-420.937) -- 0:00:27
      519000 -- [-412.465] (-414.806) (-414.388) (-412.831) * [-415.800] (-412.719) (-413.140) (-423.904) -- 0:00:27
      519500 -- (-413.525) [-413.645] (-411.995) (-413.921) * [-415.741] (-415.452) (-415.267) (-413.397) -- 0:00:27
      520000 -- (-414.220) (-414.142) [-416.235] (-412.850) * (-415.502) [-414.040] (-413.292) (-415.135) -- 0:00:27

      Average standard deviation of split frequencies: 0.013524

      520500 -- (-413.553) (-413.928) (-413.949) [-411.829] * [-414.881] (-414.987) (-414.075) (-412.797) -- 0:00:27
      521000 -- (-418.171) (-414.474) (-413.265) [-414.006] * (-416.046) (-414.619) (-413.263) [-419.274] -- 0:00:27
      521500 -- (-415.887) (-414.566) (-413.731) [-412.998] * (-414.118) (-413.871) [-417.092] (-412.760) -- 0:00:27
      522000 -- [-414.866] (-413.361) (-415.138) (-412.986) * (-417.041) (-414.256) (-415.853) [-413.692] -- 0:00:27
      522500 -- [-416.662] (-414.957) (-413.551) (-412.950) * [-417.053] (-416.399) (-413.231) (-413.115) -- 0:00:27
      523000 -- [-412.496] (-412.947) (-412.732) (-413.519) * [-413.780] (-418.139) (-414.437) (-413.224) -- 0:00:27
      523500 -- (-412.329) [-416.797] (-416.072) (-415.282) * (-414.520) [-416.065] (-414.927) (-415.861) -- 0:00:28
      524000 -- (-412.541) (-415.529) [-412.647] (-419.910) * (-417.783) [-412.759] (-413.604) (-417.781) -- 0:00:28
      524500 -- (-413.026) [-416.895] (-411.685) (-413.140) * (-414.964) (-418.483) (-417.459) [-414.428] -- 0:00:28
      525000 -- (-412.714) (-413.889) [-413.409] (-415.426) * (-414.185) (-413.166) [-413.839] (-413.129) -- 0:00:28

      Average standard deviation of split frequencies: 0.013095

      525500 -- [-412.478] (-413.325) (-411.885) (-418.487) * (-414.552) (-411.671) (-415.530) [-414.069] -- 0:00:27
      526000 -- (-412.931) (-415.424) [-411.761] (-422.629) * (-415.023) (-412.789) [-418.016] (-411.954) -- 0:00:27
      526500 -- (-412.135) [-413.978] (-414.085) (-421.626) * [-413.523] (-414.167) (-413.642) (-413.201) -- 0:00:27
      527000 -- [-413.943] (-415.783) (-415.113) (-413.833) * (-417.397) (-414.779) (-416.210) [-413.040] -- 0:00:27
      527500 -- (-414.659) (-415.021) [-413.612] (-412.198) * (-415.997) (-415.188) [-413.401] (-413.552) -- 0:00:27
      528000 -- (-415.626) (-415.640) (-413.795) [-412.330] * (-412.659) (-414.528) [-415.371] (-417.543) -- 0:00:27
      528500 -- [-411.991] (-414.949) (-411.685) (-412.294) * [-412.156] (-412.700) (-413.890) (-413.407) -- 0:00:27
      529000 -- [-412.024] (-413.658) (-412.098) (-412.886) * (-413.524) [-412.871] (-419.219) (-415.530) -- 0:00:27
      529500 -- (-415.872) (-413.306) [-412.791] (-413.068) * [-414.145] (-414.048) (-418.668) (-414.182) -- 0:00:27
      530000 -- [-413.383] (-415.460) (-413.459) (-412.740) * [-411.981] (-414.759) (-415.169) (-412.290) -- 0:00:27

      Average standard deviation of split frequencies: 0.014161

      530500 -- [-414.801] (-414.892) (-416.703) (-414.469) * [-413.400] (-413.697) (-414.516) (-417.617) -- 0:00:27
      531000 -- (-413.143) (-416.735) (-416.861) [-413.604] * (-412.948) (-412.793) [-413.098] (-411.734) -- 0:00:27
      531500 -- (-416.743) (-412.841) (-413.483) [-412.805] * (-414.233) (-418.555) (-414.639) [-413.484] -- 0:00:27
      532000 -- (-412.387) (-413.402) (-412.777) [-412.702] * [-412.802] (-414.271) (-414.551) (-418.044) -- 0:00:27
      532500 -- (-416.225) (-413.749) [-413.448] (-412.913) * (-413.178) [-415.009] (-412.101) (-413.297) -- 0:00:27
      533000 -- [-413.923] (-415.243) (-413.863) (-413.980) * (-414.582) (-414.376) (-413.622) [-416.555] -- 0:00:27
      533500 -- (-413.070) [-413.019] (-416.635) (-417.374) * (-413.228) [-412.998] (-416.319) (-414.697) -- 0:00:27
      534000 -- (-416.918) [-413.211] (-416.298) (-413.123) * [-414.422] (-415.999) (-412.916) (-418.765) -- 0:00:27
      534500 -- [-413.473] (-415.289) (-414.641) (-414.109) * [-413.011] (-414.965) (-413.863) (-415.720) -- 0:00:26
      535000 -- [-413.832] (-412.861) (-413.423) (-414.087) * (-417.877) [-415.852] (-412.146) (-414.645) -- 0:00:26

      Average standard deviation of split frequencies: 0.013813

      535500 -- [-415.819] (-413.085) (-417.310) (-413.605) * [-411.792] (-413.801) (-416.518) (-413.840) -- 0:00:26
      536000 -- (-415.787) [-415.437] (-415.128) (-411.903) * (-412.091) (-413.342) [-413.866] (-413.166) -- 0:00:26
      536500 -- (-413.017) [-412.858] (-413.359) (-414.056) * (-412.358) (-414.542) (-412.106) [-414.682] -- 0:00:26
      537000 -- [-413.051] (-414.895) (-414.165) (-413.670) * [-412.089] (-414.371) (-413.729) (-415.334) -- 0:00:26
      537500 -- (-416.770) (-414.500) (-413.931) [-413.163] * (-413.084) [-412.746] (-413.730) (-422.317) -- 0:00:26
      538000 -- (-415.785) [-416.438] (-413.330) (-412.179) * [-414.049] (-413.756) (-416.431) (-417.845) -- 0:00:26
      538500 -- [-414.094] (-416.458) (-417.138) (-414.793) * (-414.601) (-416.521) (-418.425) [-415.459] -- 0:00:26
      539000 -- (-412.813) (-412.400) (-417.891) [-414.931] * (-412.384) [-412.910] (-413.981) (-416.844) -- 0:00:26
      539500 -- (-412.936) (-413.533) [-414.465] (-413.091) * [-412.637] (-413.722) (-417.617) (-416.049) -- 0:00:26
      540000 -- [-412.556] (-415.388) (-412.761) (-415.618) * [-411.947] (-414.085) (-416.182) (-412.191) -- 0:00:26

      Average standard deviation of split frequencies: 0.013899

      540500 -- (-416.979) (-413.036) (-412.894) [-414.801] * (-413.516) [-417.466] (-412.805) (-418.610) -- 0:00:27
      541000 -- (-416.264) [-413.950] (-412.155) (-412.525) * (-415.332) (-412.448) (-414.129) [-415.256] -- 0:00:27
      541500 -- (-416.856) [-413.707] (-413.453) (-413.696) * (-414.517) (-414.282) [-414.275] (-415.769) -- 0:00:27
      542000 -- (-412.746) (-414.102) [-414.165] (-417.890) * (-412.561) [-418.213] (-412.032) (-413.681) -- 0:00:27
      542500 -- (-414.610) [-413.616] (-415.190) (-412.737) * (-414.714) (-414.396) [-414.940] (-413.138) -- 0:00:26
      543000 -- [-412.145] (-418.116) (-413.004) (-413.212) * (-414.657) (-413.040) (-415.514) [-417.283] -- 0:00:26
      543500 -- (-418.697) (-417.073) [-414.113] (-412.663) * (-413.837) [-412.789] (-419.596) (-412.527) -- 0:00:26
      544000 -- (-423.017) [-417.292] (-414.930) (-412.593) * (-415.794) [-412.371] (-414.319) (-413.765) -- 0:00:26
      544500 -- (-415.851) [-412.361] (-413.956) (-413.646) * (-416.035) (-413.981) [-413.208] (-413.216) -- 0:00:26
      545000 -- (-412.996) [-415.349] (-415.574) (-411.879) * (-415.357) [-414.526] (-415.683) (-412.932) -- 0:00:26

      Average standard deviation of split frequencies: 0.013509

      545500 -- (-413.634) [-412.551] (-415.328) (-411.864) * [-412.360] (-417.982) (-413.549) (-414.028) -- 0:00:26
      546000 -- (-414.312) [-412.792] (-415.375) (-415.198) * (-412.022) [-413.188] (-414.914) (-412.609) -- 0:00:26
      546500 -- (-413.887) (-414.328) [-412.631] (-415.831) * [-413.952] (-416.344) (-415.276) (-414.067) -- 0:00:26
      547000 -- (-412.964) (-415.684) [-413.062] (-415.853) * (-413.503) (-418.360) [-413.629] (-416.455) -- 0:00:26
      547500 -- (-417.970) (-412.545) (-413.393) [-413.370] * (-412.496) (-414.614) [-418.016] (-415.469) -- 0:00:26
      548000 -- (-413.699) (-415.074) (-413.695) [-414.137] * (-413.163) (-413.361) [-412.717] (-415.285) -- 0:00:26
      548500 -- (-413.538) (-412.129) [-414.841] (-414.187) * (-414.829) [-412.884] (-412.692) (-414.082) -- 0:00:26
      549000 -- (-413.334) [-415.343] (-413.560) (-414.141) * (-415.135) (-412.148) [-414.192] (-414.191) -- 0:00:26
      549500 -- (-416.854) (-415.424) (-415.665) [-412.438] * (-413.592) [-414.224] (-414.949) (-416.858) -- 0:00:26
      550000 -- [-412.610] (-411.706) (-420.346) (-414.425) * (-417.029) [-412.413] (-413.819) (-417.306) -- 0:00:26

      Average standard deviation of split frequencies: 0.013001

      550500 -- (-415.649) (-413.481) (-412.829) [-415.328] * (-414.352) [-414.954] (-412.886) (-415.326) -- 0:00:26
      551000 -- (-413.245) [-413.053] (-413.769) (-413.749) * [-414.500] (-415.302) (-416.316) (-414.697) -- 0:00:26
      551500 -- (-412.851) [-414.826] (-414.739) (-415.015) * (-413.335) [-413.595] (-415.841) (-414.497) -- 0:00:26
      552000 -- (-413.072) (-412.994) [-416.258] (-414.104) * (-413.861) (-413.191) [-414.712] (-413.568) -- 0:00:25
      552500 -- [-414.821] (-413.888) (-413.202) (-415.032) * (-418.790) (-415.051) (-414.046) [-414.059] -- 0:00:25
      553000 -- [-414.829] (-412.083) (-416.047) (-419.025) * (-415.092) (-413.177) (-413.877) [-412.474] -- 0:00:25
      553500 -- [-415.827] (-413.654) (-415.693) (-413.321) * (-416.985) (-414.496) [-420.195] (-414.740) -- 0:00:25
      554000 -- (-416.838) [-415.810] (-416.957) (-412.725) * [-415.653] (-414.513) (-413.988) (-414.611) -- 0:00:25
      554500 -- (-417.073) (-417.012) (-413.522) [-413.175] * (-413.494) (-417.111) [-414.532] (-413.269) -- 0:00:25
      555000 -- (-420.118) (-415.710) [-412.232] (-416.288) * (-417.883) (-416.638) [-413.335] (-415.733) -- 0:00:25

      Average standard deviation of split frequencies: 0.013619

      555500 -- [-413.866] (-412.236) (-413.156) (-412.661) * (-413.296) (-412.498) (-417.540) [-412.492] -- 0:00:25
      556000 -- (-417.801) (-413.212) (-412.975) [-415.194] * (-414.507) (-415.424) (-417.982) [-413.351] -- 0:00:25
      556500 -- (-414.394) [-415.563] (-412.447) (-414.406) * (-414.657) (-417.284) [-412.790] (-413.525) -- 0:00:25
      557000 -- (-411.953) [-416.207] (-414.840) (-415.525) * [-413.217] (-416.412) (-414.622) (-415.536) -- 0:00:25
      557500 -- (-416.044) (-413.835) (-413.861) [-416.206] * (-414.728) (-412.292) [-413.986] (-416.782) -- 0:00:25
      558000 -- (-412.667) (-416.303) (-413.402) [-412.831] * (-414.790) (-411.882) [-415.376] (-413.932) -- 0:00:26
      558500 -- [-412.725] (-413.417) (-413.588) (-414.094) * (-413.331) [-417.611] (-414.547) (-414.896) -- 0:00:26
      559000 -- (-412.567) (-411.993) (-414.032) [-413.427] * (-414.332) (-414.389) (-414.431) [-413.500] -- 0:00:26
      559500 -- (-413.149) (-417.057) [-414.977] (-413.763) * (-413.363) [-412.272] (-412.654) (-413.067) -- 0:00:25
      560000 -- (-415.445) (-414.266) (-413.317) [-411.956] * (-412.685) [-412.293] (-416.996) (-415.054) -- 0:00:25

      Average standard deviation of split frequencies: 0.013700

      560500 -- (-414.962) [-412.013] (-412.506) (-411.854) * (-413.200) (-412.784) [-411.716] (-413.205) -- 0:00:25
      561000 -- (-413.343) (-412.706) (-412.833) [-413.439] * (-416.394) [-415.106] (-415.808) (-415.949) -- 0:00:25
      561500 -- [-411.913] (-417.487) (-414.234) (-415.972) * (-413.573) (-414.186) (-412.700) [-413.485] -- 0:00:25
      562000 -- (-412.606) (-414.999) [-418.122] (-414.677) * (-413.935) (-418.534) (-414.527) [-414.688] -- 0:00:25
      562500 -- [-414.106] (-414.063) (-415.110) (-413.430) * [-414.079] (-417.443) (-417.252) (-413.165) -- 0:00:25
      563000 -- (-416.692) (-416.050) (-417.408) [-417.015] * (-414.957) [-413.911] (-412.651) (-412.391) -- 0:00:25
      563500 -- (-412.920) (-414.083) [-415.380] (-414.384) * [-412.812] (-416.612) (-416.744) (-412.155) -- 0:00:25
      564000 -- [-414.606] (-412.097) (-413.931) (-415.443) * (-415.666) (-413.569) [-416.878] (-414.375) -- 0:00:25
      564500 -- (-413.721) [-415.030] (-414.936) (-413.058) * [-413.241] (-416.029) (-412.626) (-412.848) -- 0:00:25
      565000 -- (-416.353) [-416.744] (-413.753) (-414.697) * (-414.251) [-414.577] (-416.530) (-412.838) -- 0:00:25

      Average standard deviation of split frequencies: 0.014159

      565500 -- (-418.606) (-416.220) [-414.235] (-412.727) * (-415.357) [-417.045] (-414.674) (-417.622) -- 0:00:25
      566000 -- (-419.053) (-414.430) [-414.800] (-412.522) * (-413.709) (-414.502) (-414.432) [-413.323] -- 0:00:25
      566500 -- (-414.435) (-414.119) [-413.890] (-414.161) * (-415.034) (-413.956) (-413.311) [-413.256] -- 0:00:25
      567000 -- (-415.294) (-415.224) [-414.993] (-414.921) * (-415.183) [-413.462] (-415.354) (-412.891) -- 0:00:25
      567500 -- (-412.590) [-412.886] (-416.376) (-417.447) * (-413.436) (-419.331) (-412.014) [-412.046] -- 0:00:25
      568000 -- (-414.785) [-412.597] (-415.931) (-413.872) * [-418.523] (-422.016) (-412.190) (-412.279) -- 0:00:25
      568500 -- (-412.390) (-413.290) [-415.333] (-414.722) * [-416.804] (-427.316) (-411.717) (-412.838) -- 0:00:25
      569000 -- [-411.793] (-411.822) (-414.065) (-412.337) * [-414.145] (-418.532) (-413.200) (-414.709) -- 0:00:24
      569500 -- (-412.352) (-416.277) (-413.761) [-411.890] * (-415.524) (-413.853) (-415.987) [-414.612] -- 0:00:24
      570000 -- [-412.794] (-416.674) (-415.919) (-413.800) * (-413.766) [-414.674] (-413.930) (-414.093) -- 0:00:24

      Average standard deviation of split frequencies: 0.013888

      570500 -- (-412.214) (-412.405) (-412.681) [-416.457] * (-413.379) [-413.777] (-418.644) (-413.931) -- 0:00:24
      571000 -- (-417.840) [-412.425] (-413.194) (-413.549) * [-413.345] (-412.934) (-417.414) (-418.512) -- 0:00:24
      571500 -- (-414.625) (-412.997) [-416.701] (-414.559) * (-414.177) (-414.645) (-414.725) [-416.843] -- 0:00:24
      572000 -- (-414.591) (-412.633) [-415.032] (-414.162) * (-414.260) (-412.902) (-413.323) [-415.711] -- 0:00:24
      572500 -- [-414.004] (-414.032) (-412.448) (-414.511) * [-412.416] (-414.480) (-412.807) (-415.135) -- 0:00:24
      573000 -- (-412.638) (-412.833) [-415.356] (-412.889) * (-417.228) (-415.114) (-412.974) [-413.793] -- 0:00:24
      573500 -- (-413.547) (-414.010) (-412.388) [-413.228] * (-417.587) [-412.199] (-421.001) (-412.628) -- 0:00:24
      574000 -- (-414.060) (-412.932) (-412.753) [-413.310] * (-415.341) [-412.580] (-415.767) (-416.023) -- 0:00:24
      574500 -- (-412.470) (-416.186) (-413.299) [-412.443] * (-414.003) [-413.340] (-413.784) (-414.797) -- 0:00:24
      575000 -- (-412.778) (-413.731) (-417.367) [-414.730] * (-416.342) (-413.935) [-413.609] (-417.394) -- 0:00:25

      Average standard deviation of split frequencies: 0.013453

      575500 -- (-412.762) (-413.042) (-414.302) [-415.882] * (-416.393) (-413.650) [-415.965] (-417.854) -- 0:00:25
      576000 -- (-413.219) [-412.385] (-413.357) (-413.308) * (-414.883) [-413.430] (-413.522) (-412.687) -- 0:00:25
      576500 -- (-412.514) (-413.241) (-415.092) [-411.908] * (-413.414) [-416.499] (-414.982) (-414.828) -- 0:00:24
      577000 -- [-413.959] (-419.416) (-413.891) (-411.868) * (-413.986) (-413.771) (-412.897) [-412.780] -- 0:00:24
      577500 -- (-414.101) [-412.696] (-412.428) (-414.000) * (-413.990) (-417.775) (-412.470) [-414.464] -- 0:00:24
      578000 -- [-413.318] (-414.733) (-416.388) (-413.333) * (-418.118) (-413.327) (-415.188) [-413.011] -- 0:00:24
      578500 -- [-415.691] (-418.285) (-413.298) (-412.569) * [-415.206] (-412.904) (-411.897) (-418.052) -- 0:00:24
      579000 -- (-413.768) (-415.581) [-414.484] (-412.734) * (-415.520) [-413.717] (-411.837) (-423.092) -- 0:00:24
      579500 -- [-415.742] (-413.043) (-414.923) (-415.266) * [-413.524] (-414.956) (-417.552) (-413.364) -- 0:00:24
      580000 -- [-415.554] (-412.123) (-413.795) (-415.038) * (-413.195) [-415.151] (-413.074) (-414.789) -- 0:00:24

      Average standard deviation of split frequencies: 0.013192

      580500 -- (-412.887) [-411.790] (-414.619) (-414.963) * (-419.488) [-412.339] (-412.328) (-416.591) -- 0:00:24
      581000 -- (-414.105) (-411.760) [-417.266] (-414.824) * [-415.930] (-412.476) (-412.761) (-412.879) -- 0:00:24
      581500 -- (-412.023) (-413.258) [-414.278] (-416.521) * (-412.568) (-415.396) (-415.153) [-416.731] -- 0:00:24
      582000 -- [-413.408] (-414.606) (-417.279) (-412.386) * [-413.227] (-414.420) (-416.067) (-416.502) -- 0:00:24
      582500 -- (-412.977) (-414.946) (-416.110) [-417.484] * (-412.144) [-413.356] (-413.335) (-416.362) -- 0:00:24
      583000 -- (-415.364) (-412.607) [-417.032] (-413.809) * (-413.451) (-413.655) [-419.451] (-420.455) -- 0:00:24
      583500 -- [-417.177] (-413.042) (-414.728) (-413.196) * (-413.236) (-413.866) [-415.489] (-415.807) -- 0:00:24
      584000 -- (-412.646) [-417.184] (-413.074) (-413.167) * [-414.667] (-414.334) (-417.927) (-415.666) -- 0:00:24
      584500 -- (-412.506) (-416.685) (-412.590) [-414.973] * (-415.165) (-412.324) (-415.222) [-413.013] -- 0:00:24
      585000 -- [-412.964] (-412.357) (-411.876) (-416.580) * (-413.069) (-413.745) [-414.706] (-412.778) -- 0:00:24

      Average standard deviation of split frequencies: 0.012921

      585500 -- (-417.377) [-412.503] (-413.987) (-417.156) * (-414.572) [-414.875] (-414.287) (-413.958) -- 0:00:24
      586000 -- [-414.955] (-414.627) (-415.411) (-415.084) * [-413.032] (-412.772) (-413.205) (-417.217) -- 0:00:24
      586500 -- (-412.748) (-413.701) (-415.856) [-417.823] * (-418.126) (-415.325) [-415.144] (-413.153) -- 0:00:23
      587000 -- (-414.113) [-415.463] (-417.610) (-413.811) * (-415.161) [-413.369] (-416.209) (-416.165) -- 0:00:23
      587500 -- (-416.809) (-413.546) (-414.668) [-412.362] * (-420.173) (-416.109) (-415.486) [-412.998] -- 0:00:23
      588000 -- (-414.424) [-412.899] (-416.651) (-412.757) * [-419.433] (-416.279) (-412.882) (-412.625) -- 0:00:23
      588500 -- [-412.947] (-412.790) (-415.793) (-412.034) * [-413.558] (-417.407) (-412.704) (-413.302) -- 0:00:23
      589000 -- [-415.704] (-412.894) (-414.708) (-413.453) * (-413.239) [-413.603] (-413.312) (-415.633) -- 0:00:23
      589500 -- (-419.207) [-413.944] (-416.796) (-414.233) * (-412.473) (-414.877) (-411.734) [-413.063] -- 0:00:23
      590000 -- (-412.983) (-411.903) [-413.800] (-415.876) * (-412.376) (-416.910) [-412.342] (-414.203) -- 0:00:23

      Average standard deviation of split frequencies: 0.012570

      590500 -- (-413.995) (-412.602) [-413.465] (-414.422) * (-413.925) (-412.824) [-414.359] (-415.396) -- 0:00:23
      591000 -- [-411.759] (-413.475) (-413.102) (-413.785) * (-413.807) [-414.964] (-412.524) (-414.747) -- 0:00:23
      591500 -- (-413.363) (-414.451) [-415.602] (-413.735) * (-413.179) [-413.123] (-414.546) (-415.647) -- 0:00:23
      592000 -- [-413.713] (-412.883) (-414.082) (-412.605) * (-413.054) (-414.699) (-413.202) [-413.148] -- 0:00:24
      592500 -- (-412.928) [-413.081] (-416.141) (-412.675) * (-415.526) [-414.409] (-415.210) (-414.695) -- 0:00:24
      593000 -- (-412.788) (-413.483) [-412.605] (-414.179) * (-414.913) (-413.374) [-413.353] (-419.736) -- 0:00:24
      593500 -- (-416.375) (-413.083) [-413.878] (-413.808) * (-417.234) (-412.647) [-415.250] (-418.946) -- 0:00:23
      594000 -- (-416.286) (-413.490) (-411.773) [-415.545] * (-412.990) (-413.797) (-414.939) [-413.736] -- 0:00:23
      594500 -- (-414.062) (-414.614) [-413.441] (-412.801) * [-412.540] (-413.406) (-416.092) (-413.742) -- 0:00:23
      595000 -- [-413.574] (-415.651) (-415.634) (-412.285) * [-412.986] (-416.289) (-411.942) (-413.360) -- 0:00:23

      Average standard deviation of split frequencies: 0.012260

      595500 -- (-414.687) [-415.686] (-414.190) (-412.312) * (-420.753) [-412.130] (-415.281) (-412.603) -- 0:00:23
      596000 -- [-412.733] (-413.625) (-413.494) (-414.704) * [-415.001] (-416.849) (-413.994) (-413.427) -- 0:00:23
      596500 -- (-412.710) [-412.791] (-415.246) (-413.736) * (-417.722) (-416.067) (-413.805) [-412.717] -- 0:00:23
      597000 -- [-412.469] (-416.726) (-416.196) (-415.741) * (-418.145) (-416.086) [-414.104] (-412.560) -- 0:00:23
      597500 -- (-417.147) [-413.416] (-415.253) (-412.749) * (-416.395) (-414.295) (-415.077) [-412.627] -- 0:00:23
      598000 -- [-416.214] (-412.419) (-415.508) (-415.352) * (-415.430) (-414.802) (-413.720) [-412.870] -- 0:00:23
      598500 -- (-416.570) [-412.408] (-415.126) (-413.640) * (-415.338) [-414.782] (-415.648) (-413.518) -- 0:00:23
      599000 -- (-416.123) (-412.008) (-419.449) [-411.899] * (-413.251) [-415.772] (-415.178) (-418.120) -- 0:00:23
      599500 -- (-412.605) (-415.130) (-417.081) [-412.770] * (-414.079) (-412.990) [-412.587] (-416.340) -- 0:00:23
      600000 -- (-413.613) (-415.946) [-413.474] (-413.734) * (-412.824) (-415.596) [-413.634] (-415.889) -- 0:00:23

      Average standard deviation of split frequencies: 0.012606

      600500 -- (-413.672) [-412.667] (-414.339) (-414.436) * (-416.115) (-418.992) [-416.257] (-414.384) -- 0:00:23
      601000 -- [-413.623] (-417.797) (-416.312) (-413.604) * [-412.537] (-413.140) (-415.529) (-414.605) -- 0:00:23
      601500 -- [-415.934] (-413.735) (-419.005) (-412.112) * (-412.612) (-414.062) (-412.812) [-415.048] -- 0:00:23
      602000 -- (-414.233) (-412.908) [-414.959] (-413.717) * (-413.692) (-414.320) (-411.942) [-412.531] -- 0:00:23
      602500 -- [-414.777] (-412.879) (-414.191) (-411.729) * (-415.075) (-411.819) (-413.673) [-413.526] -- 0:00:23
      603000 -- (-414.618) (-412.354) [-412.833] (-416.384) * [-412.805] (-411.916) (-413.238) (-414.342) -- 0:00:23
      603500 -- [-412.385] (-412.158) (-414.105) (-412.519) * (-412.691) (-416.265) [-412.046] (-413.654) -- 0:00:22
      604000 -- [-413.292] (-416.123) (-413.269) (-413.137) * (-413.170) [-414.482] (-413.969) (-416.374) -- 0:00:22
      604500 -- (-414.039) (-414.190) [-413.904] (-412.487) * [-413.812] (-412.555) (-414.238) (-413.852) -- 0:00:22
      605000 -- [-412.502] (-415.574) (-414.290) (-417.043) * (-412.531) [-412.230] (-415.032) (-416.243) -- 0:00:22

      Average standard deviation of split frequencies: 0.012252

      605500 -- [-414.441] (-413.192) (-415.239) (-414.129) * (-416.721) (-415.284) [-412.841] (-416.686) -- 0:00:22
      606000 -- (-417.246) [-412.196] (-414.212) (-414.313) * (-415.839) [-415.550] (-414.111) (-414.934) -- 0:00:22
      606500 -- [-411.897] (-416.724) (-416.450) (-412.098) * (-415.766) (-411.964) (-412.212) [-414.002] -- 0:00:22
      607000 -- (-413.040) (-415.005) [-415.003] (-412.377) * (-413.920) [-413.038] (-413.259) (-414.163) -- 0:00:22
      607500 -- (-415.190) (-413.475) [-413.513] (-416.169) * (-414.476) (-414.602) (-418.376) [-418.145] -- 0:00:22
      608000 -- (-412.731) [-412.877] (-417.028) (-414.881) * [-414.363] (-414.367) (-415.281) (-414.756) -- 0:00:22
      608500 -- (-416.953) (-418.613) [-417.641] (-414.284) * (-414.982) [-416.951] (-416.901) (-412.237) -- 0:00:22
      609000 -- (-416.630) [-413.988] (-414.579) (-414.833) * (-417.226) (-412.162) [-420.171] (-413.066) -- 0:00:22
      609500 -- (-412.108) (-416.708) [-413.380] (-413.713) * [-415.788] (-412.331) (-415.162) (-412.961) -- 0:00:23
      610000 -- (-412.207) (-418.923) [-414.152] (-418.351) * (-414.766) (-415.377) (-415.454) [-411.807] -- 0:00:23

      Average standard deviation of split frequencies: 0.011628

      610500 -- [-412.844] (-416.194) (-413.242) (-417.517) * (-418.152) (-415.330) [-413.231] (-413.549) -- 0:00:22
      611000 -- (-412.784) (-416.441) [-412.948] (-417.238) * (-413.016) [-413.571] (-414.419) (-415.965) -- 0:00:22
      611500 -- (-414.435) [-412.365] (-412.973) (-417.018) * (-418.131) (-414.170) [-413.095] (-416.816) -- 0:00:22
      612000 -- (-415.427) (-414.781) (-413.878) [-412.722] * [-411.607] (-412.094) (-413.082) (-417.112) -- 0:00:22
      612500 -- [-415.574] (-413.648) (-414.172) (-417.395) * (-415.434) (-418.187) (-415.244) [-412.904] -- 0:00:22
      613000 -- [-412.189] (-416.328) (-417.520) (-416.441) * [-415.294] (-416.892) (-415.704) (-411.942) -- 0:00:22
      613500 -- (-416.308) (-415.944) [-418.322] (-415.818) * (-414.027) [-412.086] (-413.244) (-414.554) -- 0:00:22
      614000 -- (-416.695) (-412.705) (-417.373) [-412.814] * [-414.555] (-412.458) (-415.524) (-413.519) -- 0:00:22
      614500 -- (-415.114) [-415.798] (-418.782) (-413.530) * (-413.024) [-412.509] (-414.326) (-412.666) -- 0:00:22
      615000 -- [-413.237] (-414.916) (-415.600) (-412.968) * [-412.300] (-415.917) (-416.335) (-414.975) -- 0:00:22

      Average standard deviation of split frequencies: 0.011383

      615500 -- (-415.498) (-415.556) [-415.460] (-413.467) * (-414.092) (-412.377) [-413.921] (-415.724) -- 0:00:22
      616000 -- (-413.685) (-414.790) (-412.988) [-412.041] * (-414.343) (-413.899) (-414.976) [-413.706] -- 0:00:22
      616500 -- (-413.649) (-415.408) [-414.726] (-415.257) * (-413.987) (-414.493) (-415.715) [-417.494] -- 0:00:22
      617000 -- (-412.383) (-416.431) (-413.770) [-417.373] * (-414.619) (-416.045) (-416.570) [-416.082] -- 0:00:22
      617500 -- (-412.383) [-414.171] (-411.965) (-415.310) * (-413.247) (-415.627) [-412.310] (-414.175) -- 0:00:22
      618000 -- [-412.383] (-415.127) (-412.193) (-412.686) * [-412.162] (-412.475) (-413.141) (-414.153) -- 0:00:22
      618500 -- (-414.163) [-412.314] (-412.300) (-415.270) * [-412.934] (-418.213) (-414.743) (-413.494) -- 0:00:22
      619000 -- (-415.821) (-412.766) [-412.693] (-414.586) * (-416.405) [-415.310] (-414.246) (-414.370) -- 0:00:22
      619500 -- (-416.319) (-413.327) (-414.741) [-414.685] * [-412.433] (-415.118) (-413.794) (-412.745) -- 0:00:22
      620000 -- [-416.771] (-413.950) (-415.180) (-413.000) * (-416.706) (-413.091) [-414.915] (-417.035) -- 0:00:22

      Average standard deviation of split frequencies: 0.011630

      620500 -- (-412.549) [-413.640] (-414.221) (-413.583) * (-416.604) [-413.789] (-413.745) (-418.307) -- 0:00:22
      621000 -- (-414.435) (-412.916) (-413.208) [-413.912] * (-414.639) (-415.775) (-412.549) [-412.926] -- 0:00:21
      621500 -- (-413.339) (-412.212) (-413.116) [-412.246] * (-412.320) (-413.316) (-412.538) [-411.912] -- 0:00:21
      622000 -- (-415.246) (-412.239) (-412.565) [-414.402] * (-414.104) (-413.182) [-412.638] (-414.076) -- 0:00:21
      622500 -- [-415.583] (-411.632) (-412.205) (-414.438) * (-417.700) [-412.865] (-412.628) (-412.619) -- 0:00:21
      623000 -- (-414.260) [-414.429] (-417.837) (-414.310) * (-415.140) (-413.517) (-412.351) [-415.651] -- 0:00:21
      623500 -- [-414.532] (-413.562) (-412.927) (-413.772) * (-414.104) (-412.559) [-413.029] (-412.344) -- 0:00:21
      624000 -- (-412.828) [-414.322] (-422.141) (-417.377) * (-413.901) (-414.361) (-413.172) [-413.203] -- 0:00:21
      624500 -- (-412.054) [-413.989] (-413.995) (-416.938) * (-415.411) [-412.869] (-414.260) (-413.547) -- 0:00:21
      625000 -- [-413.075] (-414.900) (-413.059) (-414.732) * (-412.229) (-414.724) (-414.073) [-415.213] -- 0:00:21

      Average standard deviation of split frequencies: 0.011437

      625500 -- (-413.804) (-416.848) [-411.669] (-416.474) * [-412.049] (-416.409) (-412.865) (-412.686) -- 0:00:21
      626000 -- (-412.937) (-412.229) [-416.603] (-414.489) * [-412.561] (-415.026) (-414.256) (-412.155) -- 0:00:22
      626500 -- (-414.658) [-417.265] (-412.632) (-417.863) * (-413.619) [-413.264] (-413.841) (-415.310) -- 0:00:22
      627000 -- (-419.404) [-412.272] (-413.528) (-415.006) * (-413.394) (-412.171) (-415.852) [-416.191] -- 0:00:22
      627500 -- (-412.704) (-412.945) [-413.138] (-414.079) * (-412.750) (-413.203) (-414.029) [-415.436] -- 0:00:21
      628000 -- (-415.012) (-413.731) [-413.620] (-412.252) * (-414.625) [-412.574] (-413.976) (-415.228) -- 0:00:21
      628500 -- (-411.683) (-412.757) [-415.368] (-417.425) * (-413.645) [-413.818] (-412.472) (-413.632) -- 0:00:21
      629000 -- (-412.337) (-412.000) (-413.592) [-413.382] * [-414.705] (-413.878) (-412.562) (-414.126) -- 0:00:21
      629500 -- (-413.885) (-415.213) (-415.208) [-413.232] * (-415.886) (-415.043) (-414.813) [-413.898] -- 0:00:21
      630000 -- (-414.195) (-415.486) (-414.902) [-414.281] * (-413.250) (-413.245) (-417.295) [-412.749] -- 0:00:21

      Average standard deviation of split frequencies: 0.011679

      630500 -- (-418.498) [-416.000] (-414.548) (-413.712) * [-413.138] (-412.290) (-414.875) (-413.062) -- 0:00:21
      631000 -- (-414.725) [-412.966] (-415.153) (-411.732) * [-413.574] (-412.476) (-414.036) (-412.916) -- 0:00:21
      631500 -- [-413.803] (-413.903) (-413.506) (-414.290) * (-412.384) (-418.088) [-412.795] (-412.538) -- 0:00:21
      632000 -- (-414.917) [-412.885] (-416.872) (-415.245) * [-416.372] (-412.884) (-411.975) (-413.325) -- 0:00:21
      632500 -- [-415.979] (-412.248) (-413.921) (-414.801) * (-419.990) (-414.371) [-412.772] (-418.837) -- 0:00:21
      633000 -- [-414.506] (-412.929) (-414.561) (-414.866) * (-413.170) (-412.836) [-415.513] (-412.533) -- 0:00:21
      633500 -- [-414.502] (-413.786) (-414.727) (-415.055) * (-412.684) (-414.147) (-414.707) [-412.643] -- 0:00:21
      634000 -- (-413.265) [-412.475] (-411.929) (-416.282) * (-415.236) (-413.971) (-413.576) [-416.724] -- 0:00:21
      634500 -- (-415.129) [-412.977] (-412.079) (-415.661) * (-414.660) (-413.319) (-413.741) [-413.660] -- 0:00:21
      635000 -- [-412.667] (-415.369) (-412.327) (-413.455) * (-412.996) (-413.688) (-416.520) [-413.638] -- 0:00:21

      Average standard deviation of split frequencies: 0.011813

      635500 -- [-415.124] (-417.258) (-414.011) (-413.679) * (-414.466) (-416.241) (-412.959) [-416.210] -- 0:00:21
      636000 -- [-413.125] (-412.869) (-417.688) (-415.101) * (-413.907) (-415.941) [-415.882] (-415.483) -- 0:00:21
      636500 -- (-412.751) [-412.858] (-417.755) (-413.117) * (-414.491) [-411.983] (-418.421) (-417.638) -- 0:00:21
      637000 -- (-413.163) (-415.763) [-414.191] (-420.142) * [-414.107] (-413.147) (-411.842) (-413.781) -- 0:00:21
      637500 -- (-412.789) (-416.852) [-414.375] (-419.121) * (-412.676) (-417.021) (-412.157) [-417.310] -- 0:00:21
      638000 -- (-413.596) (-415.550) [-414.769] (-414.242) * [-412.022] (-416.064) (-415.580) (-414.433) -- 0:00:20
      638500 -- (-412.850) (-415.626) [-417.104] (-413.560) * [-413.239] (-416.162) (-413.932) (-414.827) -- 0:00:20
      639000 -- (-414.424) [-412.465] (-415.177) (-417.050) * (-413.631) (-416.208) [-412.533] (-418.440) -- 0:00:20
      639500 -- (-418.003) (-415.311) [-413.974] (-412.409) * [-414.054] (-417.929) (-415.623) (-416.106) -- 0:00:20
      640000 -- (-415.436) (-414.652) (-413.630) [-412.928] * (-413.602) [-414.024] (-415.991) (-413.320) -- 0:00:20

      Average standard deviation of split frequencies: 0.011175

      640500 -- (-415.476) [-412.823] (-413.567) (-413.071) * [-414.184] (-412.405) (-412.703) (-413.036) -- 0:00:20
      641000 -- (-412.827) (-413.984) (-417.289) [-414.294] * (-412.926) (-413.517) (-412.140) [-413.350] -- 0:00:20
      641500 -- [-415.822] (-414.743) (-413.715) (-413.049) * [-412.444] (-413.609) (-413.734) (-414.484) -- 0:00:20
      642000 -- [-412.335] (-415.634) (-417.580) (-413.766) * (-416.507) [-413.055] (-413.759) (-412.352) -- 0:00:20
      642500 -- [-412.212] (-413.801) (-412.463) (-415.704) * (-418.337) [-414.561] (-418.531) (-413.065) -- 0:00:20
      643000 -- [-412.617] (-412.352) (-412.271) (-414.871) * (-413.130) (-416.128) [-413.431] (-414.487) -- 0:00:20
      643500 -- [-412.104] (-412.380) (-413.720) (-412.685) * (-417.197) [-412.916] (-413.477) (-414.201) -- 0:00:21
      644000 -- (-413.615) [-411.932] (-413.140) (-412.749) * [-415.518] (-414.526) (-412.342) (-412.167) -- 0:00:21
      644500 -- (-412.477) (-418.235) [-414.657] (-413.943) * (-416.786) (-414.076) (-415.414) [-414.504] -- 0:00:20
      645000 -- [-411.823] (-412.896) (-413.042) (-413.425) * (-413.179) (-412.481) [-412.416] (-416.682) -- 0:00:20

      Average standard deviation of split frequencies: 0.011356

      645500 -- [-413.109] (-412.595) (-419.286) (-414.866) * (-412.566) (-414.091) [-413.383] (-413.557) -- 0:00:20
      646000 -- (-414.457) (-413.872) (-415.136) [-415.056] * [-412.960] (-414.778) (-413.377) (-415.118) -- 0:00:20
      646500 -- (-416.025) [-412.525] (-414.141) (-412.872) * (-417.258) [-413.497] (-412.496) (-412.075) -- 0:00:20
      647000 -- (-413.574) (-423.332) [-416.204] (-415.401) * (-412.042) (-413.404) [-415.262] (-413.860) -- 0:00:20
      647500 -- (-414.510) (-418.564) (-415.963) [-412.659] * (-412.028) [-412.871] (-414.401) (-418.849) -- 0:00:20
      648000 -- (-413.001) (-419.004) [-414.438] (-413.730) * (-412.709) [-413.788] (-415.509) (-414.409) -- 0:00:20
      648500 -- (-412.488) (-412.968) (-412.465) [-412.962] * (-413.047) (-415.601) [-412.308] (-412.190) -- 0:00:20
      649000 -- (-414.754) [-415.746] (-416.900) (-414.902) * [-413.421] (-421.280) (-419.561) (-413.160) -- 0:00:20
      649500 -- [-414.218] (-411.522) (-418.268) (-415.008) * (-413.381) (-418.537) [-413.873] (-413.629) -- 0:00:20
      650000 -- (-415.547) [-416.911] (-414.236) (-416.528) * [-412.868] (-414.109) (-413.248) (-412.581) -- 0:00:20

      Average standard deviation of split frequencies: 0.011320

      650500 -- (-413.577) [-415.757] (-414.088) (-414.772) * (-415.785) [-415.562] (-412.032) (-412.297) -- 0:00:20
      651000 -- (-413.900) [-413.545] (-418.024) (-413.808) * [-412.692] (-414.809) (-413.997) (-412.767) -- 0:00:20
      651500 -- (-415.874) (-413.341) [-414.165] (-413.234) * (-412.612) (-419.673) (-416.545) [-412.707] -- 0:00:20
      652000 -- (-414.412) (-416.353) [-413.449] (-413.135) * (-415.863) (-414.881) (-413.441) [-412.747] -- 0:00:20
      652500 -- (-412.565) [-415.125] (-412.784) (-412.093) * [-415.886] (-413.939) (-413.925) (-413.880) -- 0:00:20
      653000 -- [-413.991] (-413.440) (-413.853) (-412.444) * (-414.139) (-412.488) [-416.983] (-414.194) -- 0:00:20
      653500 -- (-416.136) (-413.860) [-414.892] (-414.230) * (-415.199) (-415.467) (-414.334) [-414.652] -- 0:00:20
      654000 -- (-412.054) (-417.958) [-419.492] (-415.562) * (-418.107) [-412.619] (-415.046) (-413.644) -- 0:00:20
      654500 -- (-413.737) (-415.295) [-415.166] (-412.912) * (-416.027) (-413.458) (-412.497) [-412.646] -- 0:00:20
      655000 -- (-413.989) [-413.105] (-414.728) (-416.151) * [-416.863] (-413.918) (-412.726) (-412.650) -- 0:00:20

      Average standard deviation of split frequencies: 0.011857

      655500 -- (-413.903) [-415.325] (-412.991) (-415.124) * (-412.670) [-414.405] (-415.800) (-416.818) -- 0:00:19
      656000 -- (-413.309) [-412.655] (-415.441) (-412.944) * [-415.840] (-412.601) (-413.781) (-413.825) -- 0:00:19
      656500 -- (-415.237) (-412.460) (-411.690) [-413.745] * [-413.710] (-413.454) (-415.573) (-412.864) -- 0:00:19
      657000 -- (-414.522) (-412.238) [-412.916] (-412.750) * [-413.333] (-413.363) (-413.833) (-412.355) -- 0:00:19
      657500 -- (-414.083) [-412.229] (-414.480) (-414.474) * (-419.074) (-413.854) [-413.361] (-414.034) -- 0:00:19
      658000 -- (-413.925) [-413.385] (-412.232) (-412.243) * (-415.299) (-413.868) (-412.721) [-414.835] -- 0:00:19
      658500 -- (-414.286) (-415.690) (-413.945) [-412.435] * (-419.432) (-415.841) (-413.661) [-414.608] -- 0:00:19
      659000 -- (-414.981) [-418.325] (-417.069) (-416.117) * (-411.969) (-415.220) [-413.118] (-412.989) -- 0:00:19
      659500 -- [-412.567] (-413.531) (-416.090) (-413.832) * (-413.868) (-414.452) [-412.370] (-413.759) -- 0:00:19
      660000 -- [-414.326] (-416.798) (-416.177) (-413.825) * (-413.778) (-413.743) (-413.477) [-411.778] -- 0:00:19

      Average standard deviation of split frequencies: 0.011595

      660500 -- (-417.336) (-413.869) (-412.792) [-413.252] * (-412.541) [-412.719] (-417.784) (-415.807) -- 0:00:20
      661000 -- (-414.639) (-413.744) (-414.425) [-416.682] * (-413.215) [-414.456] (-414.754) (-413.294) -- 0:00:20
      661500 -- (-414.865) (-414.273) [-413.278] (-416.116) * [-412.290] (-414.167) (-414.946) (-414.560) -- 0:00:19
      662000 -- (-415.004) (-415.292) [-413.405] (-421.215) * (-413.963) (-415.569) (-414.717) [-413.621] -- 0:00:19
      662500 -- (-414.726) (-416.540) [-414.502] (-414.842) * (-414.310) [-413.298] (-413.114) (-413.035) -- 0:00:19
      663000 -- (-415.827) (-413.406) [-412.724] (-414.624) * (-415.705) [-413.890] (-412.596) (-413.433) -- 0:00:19
      663500 -- (-414.522) [-412.967] (-416.095) (-412.122) * (-414.431) (-414.631) [-415.599] (-414.311) -- 0:00:19
      664000 -- (-412.983) (-412.365) (-414.700) [-413.616] * (-414.405) (-417.199) [-412.896] (-414.152) -- 0:00:19
      664500 -- (-412.743) (-415.554) (-416.676) [-412.044] * (-413.061) [-413.974] (-412.245) (-415.173) -- 0:00:19
      665000 -- (-412.343) (-416.488) (-414.411) [-411.896] * (-415.300) (-413.150) [-415.041] (-415.614) -- 0:00:19

      Average standard deviation of split frequencies: 0.011767

      665500 -- (-413.711) [-411.886] (-416.748) (-413.440) * (-415.860) (-414.878) [-412.316] (-412.401) -- 0:00:19
      666000 -- [-414.505] (-417.290) (-416.443) (-416.506) * (-413.360) [-414.247] (-415.084) (-412.553) -- 0:00:19
      666500 -- (-413.060) [-413.888] (-412.884) (-419.202) * (-413.072) (-414.074) (-412.062) [-413.012] -- 0:00:19
      667000 -- (-414.564) (-414.710) (-414.673) [-418.250] * (-417.137) (-413.781) (-413.446) [-412.406] -- 0:00:19
      667500 -- (-414.399) (-413.333) [-415.206] (-416.088) * (-415.899) (-413.797) [-412.394] (-413.316) -- 0:00:19
      668000 -- (-416.394) [-412.328] (-413.252) (-414.536) * (-414.866) (-415.346) [-414.867] (-415.356) -- 0:00:19
      668500 -- (-414.965) [-413.503] (-414.519) (-413.458) * (-413.695) (-413.453) (-414.959) [-412.889] -- 0:00:19
      669000 -- (-411.728) [-412.650] (-416.798) (-412.862) * (-416.243) [-416.765] (-412.395) (-413.254) -- 0:00:19
      669500 -- (-413.536) (-412.664) [-416.428] (-415.487) * (-413.456) (-414.904) (-414.731) [-412.182] -- 0:00:19
      670000 -- (-414.137) [-413.766] (-414.926) (-413.012) * (-412.842) (-415.946) (-414.461) [-412.175] -- 0:00:19

      Average standard deviation of split frequencies: 0.011949

      670500 -- (-415.958) (-415.775) (-413.739) [-413.090] * (-413.537) [-412.807] (-413.616) (-420.963) -- 0:00:19
      671000 -- (-413.799) (-412.839) [-412.771] (-414.037) * (-416.469) (-414.178) [-413.402] (-417.401) -- 0:00:19
      671500 -- [-413.207] (-413.584) (-412.309) (-412.164) * (-417.783) [-414.692] (-412.491) (-414.520) -- 0:00:19
      672000 -- [-414.187] (-412.438) (-415.853) (-412.700) * (-414.846) (-415.088) (-412.178) [-414.543] -- 0:00:19
      672500 -- (-412.453) [-415.439] (-415.009) (-414.601) * (-413.751) (-415.150) (-415.751) [-414.913] -- 0:00:18
      673000 -- (-412.175) [-413.557] (-413.380) (-412.401) * (-413.416) (-418.278) (-413.482) [-412.220] -- 0:00:18
      673500 -- (-414.774) (-414.464) (-416.707) [-413.562] * (-412.914) (-412.534) [-414.782] (-415.336) -- 0:00:18
      674000 -- (-414.280) [-415.719] (-413.580) (-418.950) * (-414.844) (-414.030) (-418.486) [-414.719] -- 0:00:18
      674500 -- (-414.306) [-413.225] (-415.483) (-414.003) * (-421.932) (-412.935) (-412.820) [-416.160] -- 0:00:18
      675000 -- [-413.885] (-414.177) (-417.681) (-414.398) * (-415.101) (-413.181) [-412.874] (-414.646) -- 0:00:18

      Average standard deviation of split frequencies: 0.011942

      675500 -- (-413.347) (-414.120) [-415.850] (-414.750) * [-416.566] (-414.829) (-413.452) (-417.287) -- 0:00:18
      676000 -- [-413.091] (-412.837) (-412.531) (-416.580) * (-413.176) (-416.552) [-416.644] (-421.553) -- 0:00:18
      676500 -- (-414.349) (-414.674) (-412.015) [-415.181] * (-414.230) [-411.689] (-413.795) (-413.390) -- 0:00:18
      677000 -- (-414.905) [-412.563] (-415.457) (-415.735) * (-413.769) [-412.302] (-413.399) (-413.557) -- 0:00:18
      677500 -- (-414.205) [-413.389] (-413.682) (-415.294) * (-413.527) [-416.831] (-413.683) (-414.450) -- 0:00:18
      678000 -- (-413.670) (-416.013) [-412.494] (-417.460) * (-413.947) (-414.156) (-415.155) [-412.755] -- 0:00:18
      678500 -- (-413.527) (-414.009) (-413.497) [-413.645] * (-414.645) (-414.282) [-415.649] (-415.922) -- 0:00:18
      679000 -- [-415.184] (-413.503) (-414.015) (-412.949) * (-412.460) [-413.228] (-414.272) (-416.304) -- 0:00:18
      679500 -- (-415.508) (-413.173) [-413.623] (-412.910) * (-413.771) [-414.201] (-415.407) (-414.722) -- 0:00:18
      680000 -- (-412.931) (-412.683) (-415.690) [-411.997] * (-414.003) [-415.484] (-414.614) (-415.432) -- 0:00:18

      Average standard deviation of split frequencies: 0.011817

      680500 -- [-413.431] (-413.709) (-413.215) (-412.899) * (-413.783) (-414.215) (-415.383) [-414.828] -- 0:00:18
      681000 -- (-412.542) (-412.932) (-412.976) [-412.151] * (-414.862) (-414.901) (-419.274) [-412.652] -- 0:00:18
      681500 -- [-413.377] (-413.532) (-416.925) (-417.940) * (-415.380) (-414.145) (-420.533) [-414.515] -- 0:00:18
      682000 -- (-413.591) (-413.206) [-418.363] (-411.957) * (-418.313) (-413.372) (-419.368) [-414.496] -- 0:00:18
      682500 -- (-415.983) [-415.358] (-414.487) (-419.575) * [-417.991] (-418.671) (-413.362) (-413.170) -- 0:00:18
      683000 -- (-415.839) (-419.072) [-412.725] (-414.901) * (-416.132) [-413.687] (-412.586) (-419.524) -- 0:00:18
      683500 -- [-413.373] (-413.519) (-413.123) (-415.478) * (-417.056) (-414.056) [-412.859] (-418.783) -- 0:00:18
      684000 -- [-413.217] (-412.524) (-414.101) (-415.644) * [-414.369] (-413.037) (-413.755) (-414.663) -- 0:00:18
      684500 -- [-414.099] (-413.084) (-413.114) (-414.085) * (-416.860) (-415.478) [-417.823] (-417.325) -- 0:00:18
      685000 -- (-414.711) [-414.047] (-415.734) (-416.760) * [-414.583] (-418.647) (-412.022) (-419.177) -- 0:00:18

      Average standard deviation of split frequencies: 0.011854

      685500 -- [-413.890] (-416.420) (-417.403) (-415.999) * (-413.994) [-411.918] (-412.177) (-416.829) -- 0:00:18
      686000 -- (-415.006) (-416.121) (-413.216) [-412.850] * (-415.068) (-411.857) [-412.807] (-417.490) -- 0:00:18
      686500 -- (-413.636) (-412.219) (-416.569) [-413.214] * [-411.733] (-414.505) (-413.957) (-414.932) -- 0:00:18
      687000 -- [-415.192] (-413.494) (-412.622) (-414.542) * (-412.213) [-413.292] (-413.220) (-415.777) -- 0:00:18
      687500 -- [-416.209] (-413.650) (-413.561) (-415.502) * [-414.028] (-414.612) (-416.307) (-416.894) -- 0:00:18
      688000 -- (-414.887) (-413.726) (-412.501) [-413.218] * (-414.139) (-412.583) (-415.586) [-413.075] -- 0:00:18
      688500 -- (-416.367) [-413.497] (-416.194) (-413.523) * [-414.881] (-414.816) (-419.355) (-412.362) -- 0:00:18
      689000 -- [-412.301] (-413.638) (-413.649) (-414.257) * (-411.924) (-414.500) (-413.393) [-414.009] -- 0:00:18
      689500 -- (-413.951) (-416.062) [-419.843] (-413.944) * (-413.889) [-415.550] (-413.345) (-417.699) -- 0:00:18
      690000 -- (-412.148) (-414.443) [-413.874] (-417.019) * (-415.695) (-412.521) [-412.265] (-414.893) -- 0:00:17

      Average standard deviation of split frequencies: 0.011390

      690500 -- (-412.805) (-414.626) [-417.156] (-413.851) * (-413.839) (-412.434) [-414.188] (-413.506) -- 0:00:17
      691000 -- (-415.905) (-415.288) [-411.942] (-414.297) * (-412.630) (-413.600) (-416.331) [-413.884] -- 0:00:17
      691500 -- (-413.550) (-412.547) (-413.429) [-414.321] * (-414.409) (-414.590) (-413.999) [-413.980] -- 0:00:17
      692000 -- (-414.834) (-412.998) (-415.961) [-415.022] * (-414.386) (-412.464) (-414.047) [-416.053] -- 0:00:17
      692500 -- [-413.289] (-415.229) (-414.394) (-412.757) * (-413.397) [-413.063] (-413.618) (-414.669) -- 0:00:17
      693000 -- (-418.026) [-412.324] (-418.303) (-415.741) * (-418.236) (-414.611) [-412.534] (-412.514) -- 0:00:17
      693500 -- [-412.054] (-413.145) (-415.226) (-412.822) * (-412.627) (-413.650) (-412.473) [-415.015] -- 0:00:17
      694000 -- (-412.952) [-414.008] (-413.700) (-414.239) * (-413.309) (-412.845) (-412.329) [-414.469] -- 0:00:17
      694500 -- (-414.250) (-415.018) [-414.536] (-418.043) * (-416.505) [-415.834] (-413.384) (-412.420) -- 0:00:17
      695000 -- (-413.108) (-412.846) [-413.764] (-413.990) * (-416.605) (-414.459) [-413.955] (-412.862) -- 0:00:17

      Average standard deviation of split frequencies: 0.011303

      695500 -- (-412.103) [-413.443] (-416.679) (-412.570) * (-413.706) (-415.330) (-415.620) [-415.725] -- 0:00:17
      696000 -- (-424.564) (-412.213) (-413.266) [-412.333] * [-412.624] (-413.332) (-417.211) (-412.133) -- 0:00:17
      696500 -- (-416.592) (-413.923) [-413.502] (-412.739) * (-415.583) (-415.467) [-414.489] (-413.567) -- 0:00:17
      697000 -- (-416.378) (-412.653) [-411.908] (-411.770) * [-417.605] (-415.017) (-413.239) (-412.968) -- 0:00:17
      697500 -- (-414.181) [-413.636] (-412.072) (-413.824) * (-416.653) [-411.860] (-412.860) (-416.244) -- 0:00:17
      698000 -- (-417.337) (-414.715) [-413.476] (-411.975) * (-416.480) (-414.026) [-412.048] (-421.747) -- 0:00:17
      698500 -- (-414.072) [-414.033] (-414.408) (-413.115) * (-416.483) [-416.464] (-417.478) (-413.140) -- 0:00:17
      699000 -- (-412.093) [-414.290] (-414.125) (-413.244) * (-416.768) (-415.968) (-414.277) [-414.043] -- 0:00:17
      699500 -- (-416.677) (-413.447) [-412.528] (-412.159) * (-414.853) [-413.084] (-412.972) (-416.221) -- 0:00:17
      700000 -- [-412.683] (-420.289) (-414.860) (-414.858) * (-413.303) [-413.602] (-415.050) (-416.150) -- 0:00:17

      Average standard deviation of split frequencies: 0.010765

      700500 -- [-412.775] (-412.460) (-414.863) (-414.761) * (-412.608) [-412.344] (-414.251) (-414.778) -- 0:00:17
      701000 -- (-412.231) (-413.974) [-412.490] (-420.324) * (-414.254) [-412.300] (-417.138) (-413.712) -- 0:00:17
      701500 -- (-412.319) (-413.775) [-412.964] (-414.982) * (-418.011) [-416.704] (-415.844) (-411.798) -- 0:00:17
      702000 -- (-412.907) [-412.187] (-413.065) (-413.130) * [-414.711] (-415.343) (-417.313) (-416.706) -- 0:00:17
      702500 -- (-413.693) [-414.003] (-417.242) (-412.470) * (-413.533) [-415.042] (-419.952) (-418.668) -- 0:00:17
      703000 -- (-414.862) (-413.454) (-412.519) [-413.179] * (-416.697) [-414.905] (-415.603) (-412.753) -- 0:00:17
      703500 -- [-415.405] (-412.835) (-414.103) (-412.749) * (-414.311) [-412.775] (-414.068) (-416.579) -- 0:00:17
      704000 -- (-414.598) [-414.680] (-414.329) (-413.016) * (-411.906) (-416.602) (-420.240) [-417.282] -- 0:00:17
      704500 -- (-412.469) [-413.229] (-414.304) (-413.170) * (-416.075) (-414.829) [-411.952] (-412.612) -- 0:00:17
      705000 -- [-412.447] (-412.766) (-415.106) (-414.273) * (-413.316) [-413.254] (-412.898) (-416.006) -- 0:00:17

      Average standard deviation of split frequencies: 0.011017

      705500 -- [-414.041] (-414.345) (-416.055) (-413.820) * (-415.446) (-412.993) (-412.145) [-415.169] -- 0:00:17
      706000 -- (-413.781) (-416.621) (-413.991) [-414.047] * [-412.881] (-415.088) (-412.626) (-415.373) -- 0:00:17
      706500 -- (-414.195) [-414.766] (-412.836) (-415.048) * (-415.760) [-414.861] (-412.238) (-414.020) -- 0:00:17
      707000 -- (-412.757) (-413.945) [-414.099] (-412.713) * (-415.464) (-413.258) [-412.070] (-413.418) -- 0:00:16
      707500 -- (-413.846) [-413.858] (-414.484) (-418.670) * (-413.277) (-413.986) [-413.221] (-413.596) -- 0:00:16
      708000 -- [-414.456] (-416.673) (-412.911) (-416.176) * (-412.398) (-418.364) (-415.796) [-413.081] -- 0:00:16
      708500 -- [-412.482] (-413.764) (-413.580) (-415.905) * [-414.741] (-413.004) (-415.495) (-415.636) -- 0:00:16
      709000 -- (-413.368) [-414.579] (-415.628) (-412.407) * [-412.844] (-414.666) (-411.639) (-413.429) -- 0:00:16
      709500 -- (-413.813) (-414.953) (-414.529) [-413.994] * (-413.706) (-414.258) [-413.274] (-414.137) -- 0:00:16
      710000 -- [-415.987] (-420.425) (-413.079) (-416.770) * (-414.214) [-414.375] (-415.615) (-418.800) -- 0:00:16

      Average standard deviation of split frequencies: 0.010655

      710500 -- (-415.727) (-414.946) [-413.551] (-415.304) * (-413.571) (-412.558) [-412.470] (-419.304) -- 0:00:16
      711000 -- [-414.034] (-413.898) (-416.275) (-414.345) * (-424.086) (-418.773) [-414.831] (-416.044) -- 0:00:16
      711500 -- (-412.177) [-412.713] (-414.648) (-416.308) * [-413.591] (-414.895) (-417.177) (-414.408) -- 0:00:16
      712000 -- (-412.547) (-412.600) [-415.610] (-414.411) * (-415.484) (-416.567) (-416.398) [-414.727] -- 0:00:16
      712500 -- (-412.659) (-413.703) (-417.401) [-414.283] * (-414.970) [-413.600] (-412.697) (-414.593) -- 0:00:16
      713000 -- (-412.713) (-416.006) (-412.991) [-415.948] * [-413.985] (-413.802) (-417.717) (-416.857) -- 0:00:16
      713500 -- [-412.362] (-417.656) (-412.790) (-416.381) * [-413.061] (-414.464) (-412.206) (-412.287) -- 0:00:16
      714000 -- [-412.966] (-414.626) (-412.813) (-415.207) * (-412.521) (-412.866) (-416.510) [-415.944] -- 0:00:16
      714500 -- (-412.363) (-415.314) [-412.680] (-413.664) * (-414.547) [-414.468] (-413.656) (-414.851) -- 0:00:16
      715000 -- (-412.540) (-418.655) (-413.657) [-412.148] * (-416.344) (-413.577) [-412.450] (-414.061) -- 0:00:16

      Average standard deviation of split frequencies: 0.010534

      715500 -- (-412.327) [-414.188] (-413.841) (-412.142) * (-412.509) (-416.368) [-414.669] (-413.492) -- 0:00:16
      716000 -- (-412.036) (-413.818) (-413.375) [-412.690] * [-412.632] (-416.267) (-411.928) (-413.636) -- 0:00:16
      716500 -- (-413.008) (-413.529) (-412.908) [-411.708] * [-412.638] (-412.377) (-414.726) (-412.006) -- 0:00:16
      717000 -- (-415.415) [-413.218] (-412.530) (-412.683) * (-413.111) (-413.448) (-414.805) [-412.668] -- 0:00:16
      717500 -- (-412.332) [-414.520] (-416.360) (-412.962) * (-412.871) (-415.305) [-414.603] (-411.908) -- 0:00:16
      718000 -- (-412.775) [-415.842] (-412.276) (-413.093) * [-413.160] (-417.064) (-413.404) (-411.772) -- 0:00:16
      718500 -- (-413.114) (-413.150) (-413.710) [-413.019] * [-414.774] (-413.497) (-413.079) (-411.718) -- 0:00:16
      719000 -- [-416.659] (-412.539) (-412.993) (-414.899) * [-416.155] (-414.604) (-417.470) (-413.967) -- 0:00:16
      719500 -- (-414.784) (-412.670) [-416.202] (-412.081) * (-415.691) (-415.749) [-415.010] (-412.801) -- 0:00:16
      720000 -- (-412.652) (-414.362) [-415.624] (-413.150) * (-414.038) (-413.205) (-418.368) [-412.152] -- 0:00:16

      Average standard deviation of split frequencies: 0.010302

      720500 -- (-412.240) (-412.536) (-417.361) [-415.103] * [-417.456] (-416.711) (-413.512) (-411.861) -- 0:00:16
      721000 -- [-415.678] (-415.874) (-413.788) (-411.769) * (-412.922) [-414.419] (-416.906) (-414.092) -- 0:00:16
      721500 -- (-415.030) [-412.352] (-412.758) (-413.700) * (-412.940) (-421.072) [-413.641] (-413.056) -- 0:00:16
      722000 -- (-414.211) (-414.441) [-414.567] (-413.718) * (-414.303) (-414.212) [-416.013] (-413.546) -- 0:00:16
      722500 -- (-411.906) (-413.576) (-413.280) [-413.314] * [-413.900] (-413.983) (-414.870) (-413.533) -- 0:00:16
      723000 -- (-412.462) [-414.722] (-413.073) (-416.515) * [-416.914] (-413.846) (-412.490) (-417.562) -- 0:00:16
      723500 -- [-412.045] (-413.057) (-412.987) (-417.001) * [-413.043] (-412.422) (-412.782) (-418.310) -- 0:00:16
      724000 -- (-419.064) [-413.938] (-417.580) (-412.188) * [-416.066] (-417.469) (-412.552) (-414.810) -- 0:00:16
      724500 -- [-415.426] (-412.835) (-412.570) (-417.166) * (-413.836) [-414.650] (-419.006) (-416.202) -- 0:00:15
      725000 -- (-413.099) [-413.144] (-412.903) (-421.910) * [-413.240] (-414.644) (-419.319) (-414.553) -- 0:00:15

      Average standard deviation of split frequencies: 0.009821

      725500 -- (-414.650) [-414.544] (-411.837) (-415.313) * (-416.639) (-414.207) [-415.167] (-415.591) -- 0:00:15
      726000 -- (-416.417) [-413.733] (-412.229) (-413.948) * [-413.124] (-412.104) (-421.163) (-413.757) -- 0:00:15
      726500 -- (-413.889) [-412.421] (-413.892) (-415.112) * [-412.249] (-413.240) (-415.164) (-417.853) -- 0:00:15
      727000 -- [-414.131] (-412.660) (-414.589) (-416.582) * [-413.271] (-412.516) (-415.328) (-415.534) -- 0:00:15
      727500 -- (-414.284) [-412.458] (-412.729) (-413.442) * (-415.887) (-415.199) [-414.508] (-414.317) -- 0:00:15
      728000 -- (-412.508) (-412.144) [-414.213] (-414.612) * (-412.979) (-413.158) (-414.283) [-419.432] -- 0:00:15
      728500 -- (-415.884) (-415.663) (-417.289) [-412.947] * (-412.727) (-414.363) (-417.666) [-413.049] -- 0:00:15
      729000 -- (-413.023) (-412.695) (-412.805) [-416.614] * (-415.714) (-413.831) (-415.732) [-413.085] -- 0:00:15
      729500 -- (-414.521) (-413.289) [-413.171] (-414.970) * (-414.505) (-416.099) [-415.385] (-412.665) -- 0:00:15
      730000 -- (-414.447) (-415.782) (-414.533) [-413.436] * (-415.768) (-415.116) (-412.863) [-415.372] -- 0:00:15

      Average standard deviation of split frequencies: 0.009678

      730500 -- (-413.962) [-414.148] (-412.205) (-415.047) * [-414.238] (-418.485) (-412.466) (-416.388) -- 0:00:15
      731000 -- (-412.113) (-416.847) (-412.718) [-413.433] * (-413.483) [-411.996] (-413.178) (-414.079) -- 0:00:15
      731500 -- (-413.633) (-414.557) [-414.026] (-413.547) * (-412.605) [-414.275] (-417.508) (-415.463) -- 0:00:15
      732000 -- (-413.811) [-412.529] (-417.096) (-413.521) * [-413.332] (-413.762) (-416.389) (-414.613) -- 0:00:15
      732500 -- [-416.275] (-412.283) (-413.525) (-415.294) * (-413.258) (-413.136) (-414.560) [-414.238] -- 0:00:15
      733000 -- (-414.532) (-412.701) (-415.861) [-415.487] * (-413.685) (-413.788) [-413.555] (-413.468) -- 0:00:15
      733500 -- (-415.846) (-413.146) (-415.015) [-412.563] * (-412.923) (-413.817) (-413.484) [-413.799] -- 0:00:15
      734000 -- (-414.294) (-413.059) (-414.887) [-417.437] * [-412.983] (-412.851) (-413.624) (-414.328) -- 0:00:15
      734500 -- (-415.148) [-412.426] (-414.354) (-412.321) * (-412.757) (-420.675) [-414.266] (-413.547) -- 0:00:15
      735000 -- [-415.937] (-413.763) (-413.995) (-412.419) * (-413.636) (-414.494) [-413.473] (-415.451) -- 0:00:15

      Average standard deviation of split frequencies: 0.009207

      735500 -- (-412.649) [-413.322] (-412.160) (-415.617) * (-421.164) [-412.965] (-413.521) (-412.894) -- 0:00:15
      736000 -- (-417.018) [-417.042] (-414.094) (-415.730) * [-416.409] (-415.438) (-413.417) (-414.356) -- 0:00:15
      736500 -- (-413.650) (-417.972) [-412.680] (-414.265) * (-415.368) [-414.219] (-413.321) (-412.986) -- 0:00:15
      737000 -- (-412.591) (-413.867) (-414.863) [-414.856] * [-412.820] (-415.869) (-413.782) (-417.356) -- 0:00:15
      737500 -- (-415.228) (-413.458) [-413.789] (-413.813) * (-417.831) [-415.479] (-414.558) (-414.999) -- 0:00:15
      738000 -- (-415.245) (-413.751) (-417.658) [-417.791] * (-417.700) [-413.472] (-411.802) (-416.843) -- 0:00:15
      738500 -- (-414.630) (-414.839) (-413.672) [-412.403] * (-416.127) (-412.341) [-414.602] (-414.043) -- 0:00:15
      739000 -- (-413.420) (-415.768) [-413.691] (-413.095) * (-412.848) [-414.433] (-418.638) (-416.447) -- 0:00:15
      739500 -- (-413.404) (-412.730) [-413.365] (-414.073) * (-413.211) (-414.730) [-416.179] (-414.736) -- 0:00:15
      740000 -- (-413.484) (-414.279) [-416.686] (-415.088) * (-413.475) (-417.817) (-414.539) [-413.320] -- 0:00:15

      Average standard deviation of split frequencies: 0.009348

      740500 -- (-413.506) [-412.268] (-413.048) (-413.316) * (-413.551) (-413.011) (-416.564) [-412.419] -- 0:00:15
      741000 -- (-412.133) (-412.855) [-412.389] (-412.375) * (-415.465) [-413.180] (-417.183) (-413.102) -- 0:00:15
      741500 -- (-412.595) (-413.822) [-412.405] (-417.733) * (-416.443) [-413.754] (-413.493) (-412.216) -- 0:00:14
      742000 -- (-412.697) (-412.753) (-413.711) [-415.597] * (-416.893) (-415.523) (-412.316) [-411.990] -- 0:00:14
      742500 -- (-413.537) (-416.212) [-415.121] (-414.855) * [-414.663] (-415.701) (-413.868) (-413.255) -- 0:00:14
      743000 -- (-413.420) (-417.466) [-413.396] (-413.803) * (-413.448) (-416.894) (-413.515) [-414.545] -- 0:00:14
      743500 -- (-414.628) (-412.672) (-411.990) [-413.803] * (-413.701) (-413.692) [-413.023] (-413.701) -- 0:00:14
      744000 -- (-412.579) (-412.395) (-414.939) [-414.601] * (-415.151) [-413.528] (-411.740) (-416.320) -- 0:00:14
      744500 -- (-411.980) [-413.682] (-415.025) (-415.866) * [-416.001] (-413.609) (-411.768) (-415.680) -- 0:00:14
      745000 -- (-418.124) (-417.165) (-414.748) [-416.232] * (-418.907) [-412.485] (-412.626) (-416.685) -- 0:00:14

      Average standard deviation of split frequencies: 0.010032

      745500 -- [-415.352] (-413.942) (-413.127) (-415.263) * [-412.475] (-412.317) (-414.235) (-417.159) -- 0:00:14
      746000 -- (-413.909) (-415.121) [-412.394] (-414.385) * (-412.531) [-415.759] (-412.075) (-414.958) -- 0:00:14
      746500 -- (-413.110) (-415.392) (-414.569) [-414.543] * [-414.181] (-413.841) (-413.015) (-413.844) -- 0:00:14
      747000 -- (-414.493) [-417.154] (-413.931) (-411.960) * (-416.129) (-413.530) [-412.800] (-413.583) -- 0:00:14
      747500 -- [-413.098] (-412.080) (-415.586) (-411.563) * (-416.851) [-413.427] (-414.775) (-413.519) -- 0:00:14
      748000 -- (-413.536) [-416.619] (-413.793) (-412.718) * [-413.647] (-413.418) (-413.836) (-419.794) -- 0:00:14
      748500 -- [-412.514] (-413.371) (-413.513) (-415.349) * (-415.882) (-415.839) [-416.635] (-414.175) -- 0:00:14
      749000 -- (-412.512) (-414.421) (-419.503) [-414.751] * (-416.526) (-418.489) (-414.733) [-418.506] -- 0:00:14
      749500 -- (-413.854) (-414.829) [-412.740] (-417.594) * (-412.066) [-415.091] (-416.535) (-412.947) -- 0:00:14
      750000 -- (-417.315) [-413.531] (-412.702) (-415.145) * (-414.620) [-414.556] (-414.683) (-412.950) -- 0:00:14

      Average standard deviation of split frequencies: 0.010440

      750500 -- (-412.581) (-412.996) (-412.586) [-415.202] * (-415.596) (-417.016) (-413.700) [-411.815] -- 0:00:14
      751000 -- (-413.796) (-417.076) (-414.415) [-413.611] * (-412.730) [-414.521] (-416.963) (-416.115) -- 0:00:14
      751500 -- (-417.023) [-412.151] (-412.197) (-412.573) * (-415.346) (-415.678) [-417.050] (-419.287) -- 0:00:14
      752000 -- (-412.624) (-412.729) (-412.362) [-413.831] * (-414.502) (-414.153) [-423.157] (-419.993) -- 0:00:14
      752500 -- [-414.763] (-414.822) (-412.374) (-412.315) * (-415.875) [-412.134] (-412.986) (-416.538) -- 0:00:14
      753000 -- [-411.906] (-415.390) (-411.930) (-413.891) * (-413.637) (-413.175) (-412.902) [-414.235] -- 0:00:14
      753500 -- (-412.270) (-415.176) [-412.541] (-413.657) * (-415.549) (-413.096) [-413.219] (-413.163) -- 0:00:14
      754000 -- (-412.564) [-413.493] (-412.112) (-414.574) * (-413.639) (-413.147) [-414.118] (-411.782) -- 0:00:14
      754500 -- [-416.421] (-416.549) (-412.571) (-412.997) * [-412.560] (-415.400) (-412.905) (-414.561) -- 0:00:14
      755000 -- (-415.505) (-414.081) [-415.404] (-413.357) * (-412.624) (-414.928) (-412.592) [-413.367] -- 0:00:14

      Average standard deviation of split frequencies: 0.010873

      755500 -- (-415.397) (-414.607) (-414.981) [-412.303] * [-412.291] (-412.910) (-418.644) (-412.812) -- 0:00:14
      756000 -- (-413.640) [-414.990] (-413.124) (-415.197) * (-412.976) (-414.675) [-414.145] (-414.830) -- 0:00:14
      756500 -- [-413.127] (-414.583) (-412.488) (-415.398) * (-414.713) [-414.619] (-412.203) (-413.275) -- 0:00:14
      757000 -- (-418.040) [-415.139] (-412.480) (-413.736) * [-415.600] (-416.770) (-415.066) (-414.839) -- 0:00:14
      757500 -- [-415.832] (-413.683) (-414.534) (-413.673) * [-413.498] (-414.119) (-413.934) (-413.583) -- 0:00:14
      758000 -- (-411.907) [-411.734] (-416.261) (-412.364) * (-415.822) (-415.821) [-415.105] (-413.842) -- 0:00:14
      758500 -- (-412.076) [-415.699] (-415.479) (-414.424) * [-416.236] (-416.357) (-420.972) (-417.264) -- 0:00:14
      759000 -- (-412.489) (-413.573) [-413.946] (-413.255) * [-414.049] (-416.526) (-415.762) (-416.357) -- 0:00:13
      759500 -- [-418.593] (-412.075) (-414.183) (-415.415) * [-413.756] (-413.944) (-417.994) (-414.302) -- 0:00:13
      760000 -- (-413.732) (-414.901) (-414.148) [-416.765] * (-412.574) (-412.892) [-414.495] (-416.052) -- 0:00:13

      Average standard deviation of split frequencies: 0.010497

      760500 -- (-417.190) [-413.681] (-413.261) (-412.589) * [-417.881] (-411.872) (-414.541) (-416.028) -- 0:00:13
      761000 -- (-417.114) (-415.483) (-416.166) [-414.500] * (-415.325) (-413.192) (-414.287) [-412.553] -- 0:00:13
      761500 -- (-413.363) (-414.702) [-416.641] (-420.996) * (-411.994) [-412.003] (-417.660) (-414.168) -- 0:00:13
      762000 -- (-415.197) (-413.409) [-412.098] (-415.313) * [-413.670] (-414.894) (-414.910) (-417.845) -- 0:00:13
      762500 -- (-419.058) [-413.062] (-413.168) (-412.572) * (-411.897) [-412.209] (-413.082) (-417.421) -- 0:00:13
      763000 -- [-416.830] (-414.228) (-413.982) (-414.541) * [-412.553] (-412.296) (-412.572) (-412.896) -- 0:00:13
      763500 -- (-414.276) (-412.255) (-412.637) [-413.491] * (-413.668) (-413.837) [-413.722] (-412.455) -- 0:00:13
      764000 -- (-414.594) (-412.926) [-416.693] (-414.534) * [-416.055] (-417.319) (-415.051) (-414.049) -- 0:00:13
      764500 -- (-414.100) [-413.400] (-416.089) (-414.776) * [-414.654] (-413.716) (-414.891) (-412.391) -- 0:00:13
      765000 -- [-412.940] (-415.561) (-414.961) (-413.383) * (-411.890) (-413.998) [-414.639] (-415.529) -- 0:00:13

      Average standard deviation of split frequencies: 0.010808

      765500 -- (-415.055) (-415.454) (-422.385) [-413.320] * (-414.269) (-415.987) [-415.610] (-413.646) -- 0:00:13
      766000 -- (-412.767) (-417.115) [-416.080] (-414.431) * (-413.964) (-415.912) [-413.152] (-412.882) -- 0:00:13
      766500 -- (-413.703) (-413.073) [-414.617] (-416.628) * [-414.446] (-413.572) (-415.537) (-416.364) -- 0:00:13
      767000 -- (-413.900) (-414.227) [-416.479] (-413.108) * (-413.860) (-419.781) [-412.583] (-415.546) -- 0:00:13
      767500 -- (-413.178) (-414.914) [-412.959] (-414.706) * (-412.191) (-415.480) (-416.510) [-412.012] -- 0:00:13
      768000 -- (-413.782) (-413.174) (-414.452) [-414.559] * (-418.423) [-413.924] (-413.646) (-414.165) -- 0:00:13
      768500 -- [-415.327] (-415.369) (-415.003) (-414.261) * [-414.805] (-412.788) (-412.780) (-412.197) -- 0:00:13
      769000 -- (-415.163) (-413.348) (-413.763) [-413.824] * (-412.112) (-412.770) [-412.334] (-415.109) -- 0:00:13
      769500 -- [-413.179] (-413.485) (-415.365) (-413.137) * (-412.070) (-414.287) [-412.126] (-413.250) -- 0:00:13
      770000 -- (-414.152) [-414.627] (-413.292) (-413.111) * (-412.361) (-412.625) [-415.434] (-412.500) -- 0:00:13

      Average standard deviation of split frequencies: 0.011010

      770500 -- [-414.725] (-412.633) (-412.351) (-419.351) * (-413.431) (-412.325) (-412.800) [-413.511] -- 0:00:13
      771000 -- (-412.140) (-414.082) [-412.779] (-421.414) * (-414.490) (-417.191) [-412.545] (-413.720) -- 0:00:13
      771500 -- [-413.051] (-412.337) (-413.660) (-413.299) * (-412.820) (-418.223) (-412.559) [-413.029] -- 0:00:13
      772000 -- (-412.337) (-412.862) (-415.762) [-412.859] * [-415.993] (-413.860) (-412.945) (-413.769) -- 0:00:13
      772500 -- [-413.276] (-413.395) (-419.439) (-415.292) * (-416.286) (-412.928) [-413.233] (-414.226) -- 0:00:13
      773000 -- [-411.948] (-412.625) (-414.899) (-413.456) * (-412.783) [-414.436] (-412.518) (-412.681) -- 0:00:13
      773500 -- [-412.634] (-415.276) (-415.859) (-417.259) * (-412.428) (-413.037) (-414.392) [-415.236] -- 0:00:13
      774000 -- (-415.707) (-416.686) [-412.870] (-414.493) * (-413.229) (-412.215) [-412.287] (-415.440) -- 0:00:13
      774500 -- (-412.959) (-412.993) [-413.467] (-412.579) * [-413.216] (-413.453) (-413.592) (-415.400) -- 0:00:13
      775000 -- (-412.018) [-420.974] (-413.096) (-411.801) * (-418.018) [-415.436] (-413.113) (-413.718) -- 0:00:13

      Average standard deviation of split frequencies: 0.010517

      775500 -- [-412.186] (-414.950) (-412.728) (-413.824) * (-412.484) [-415.820] (-413.108) (-415.449) -- 0:00:13
      776000 -- [-413.672] (-413.429) (-413.018) (-415.088) * [-413.519] (-413.810) (-413.746) (-414.289) -- 0:00:12
      776500 -- [-411.670] (-412.791) (-413.531) (-417.726) * (-412.940) (-415.840) (-418.322) [-417.665] -- 0:00:12
      777000 -- [-412.525] (-414.509) (-414.676) (-414.689) * (-415.282) (-413.217) (-416.740) [-412.554] -- 0:00:12
      777500 -- (-412.396) [-413.086] (-411.933) (-413.128) * (-415.573) [-412.717] (-413.960) (-413.994) -- 0:00:12
      778000 -- (-413.735) (-413.564) (-416.866) [-412.525] * (-412.621) (-413.469) (-414.807) [-412.832] -- 0:00:12
      778500 -- (-413.988) (-412.426) (-416.987) [-415.930] * (-417.016) [-413.754] (-416.232) (-413.248) -- 0:00:12
      779000 -- (-412.834) [-411.734] (-413.517) (-412.765) * (-413.663) (-416.240) (-413.502) [-414.502] -- 0:00:12
      779500 -- (-418.181) (-413.087) [-413.009] (-415.308) * (-412.654) (-413.786) (-416.631) [-412.338] -- 0:00:12
      780000 -- (-414.424) (-414.312) [-412.042] (-413.296) * [-416.007] (-414.872) (-412.998) (-417.932) -- 0:00:12

      Average standard deviation of split frequencies: 0.010416

      780500 -- [-413.712] (-413.177) (-413.097) (-412.394) * [-413.805] (-412.795) (-415.069) (-413.805) -- 0:00:12
      781000 -- [-415.523] (-413.456) (-413.279) (-414.318) * (-418.442) (-414.809) (-413.711) [-412.364] -- 0:00:12
      781500 -- (-416.347) [-413.759] (-412.901) (-413.319) * (-413.887) (-412.778) [-415.377] (-413.235) -- 0:00:12
      782000 -- (-415.459) (-413.641) [-414.625] (-413.501) * (-413.246) (-412.973) [-414.895] (-412.897) -- 0:00:12
      782500 -- (-415.620) (-414.181) [-412.795] (-412.271) * (-413.272) (-414.017) (-413.804) [-414.663] -- 0:00:12
      783000 -- [-413.242] (-414.141) (-414.795) (-412.323) * [-413.400] (-415.256) (-416.383) (-416.125) -- 0:00:12
      783500 -- (-415.396) [-413.375] (-416.064) (-418.333) * [-416.806] (-413.385) (-416.524) (-414.246) -- 0:00:12
      784000 -- (-413.993) (-416.818) [-415.087] (-415.054) * [-415.915] (-420.041) (-414.628) (-412.963) -- 0:00:12
      784500 -- (-412.574) [-415.600] (-413.630) (-413.343) * (-413.792) [-415.022] (-415.599) (-414.243) -- 0:00:12
      785000 -- (-418.355) (-415.533) [-413.385] (-413.631) * (-417.420) [-413.134] (-413.387) (-414.167) -- 0:00:12

      Average standard deviation of split frequencies: 0.010046

      785500 -- (-418.762) (-413.137) [-414.070] (-413.533) * [-415.521] (-414.781) (-416.558) (-415.136) -- 0:00:12
      786000 -- (-413.919) (-416.256) (-414.783) [-413.157] * (-415.657) [-412.872] (-412.473) (-415.559) -- 0:00:12
      786500 -- [-413.735] (-413.444) (-413.477) (-413.628)