--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:15:24 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/pheS/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/pheS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pheS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/pheS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1431.44         -1434.91
2      -1431.49         -1434.64
--------------------------------------
TOTAL    -1431.46         -1434.79
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/pheS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pheS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/pheS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.888338    0.085575    0.338210    1.444122    0.856457   1420.61   1460.80    1.000
r(A<->C){all}   0.167019    0.020754    0.000061    0.453799    0.127900    209.31    245.41    1.015
r(A<->G){all}   0.157467    0.017455    0.000018    0.417165    0.123794    175.64    253.77    1.001
r(A<->T){all}   0.173192    0.020990    0.000018    0.467399    0.135878    254.74    283.76    1.005
r(C<->G){all}   0.175872    0.020730    0.000015    0.457800    0.138010    116.78    163.98    1.002
r(C<->T){all}   0.159988    0.017667    0.000087    0.431645    0.123273    135.12    151.73    1.003
r(G<->T){all}   0.166463    0.018465    0.000008    0.431733    0.132988    160.41    216.84    1.000
pi(A){all}      0.195847    0.000147    0.172336    0.218526    0.195399   1203.18   1314.35    1.000
pi(C){all}      0.308168    0.000200    0.282492    0.337813    0.307920   1103.43   1242.36    1.000
pi(G){all}      0.301416    0.000204    0.273471    0.328857    0.301483   1135.14   1177.13    1.000
pi(T){all}      0.194570    0.000148    0.171663    0.218005    0.194444   1255.51   1314.64    1.000
alpha{1,2}      0.423479    0.216649    0.000185    1.349875    0.255547   1085.80   1107.79    1.000
alpha{3}        0.464434    0.229136    0.000651    1.428056    0.305910   1387.93   1405.18    1.000
pinvar{all}     0.998618    0.000003    0.995558    1.000000    0.999153   1110.46   1179.80    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1386.179989
Model 2: PositiveSelection	-1386.179989
Model 0: one-ratio	-1386.180508
Model 7: beta	-1386.179989
Model 8: beta&w>1	-1386.180477


Model 0 vs 1	0.0010379999998804124

Model 2 vs 1	0.0

Model 8 vs 7	9.76000000264321E-4
>C1
VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA

>C2
VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA

>C3
VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA

>C4
VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA

>C5
VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA

>C6
VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA

CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=350 

C1              VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
C2              VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
C3              VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
C4              VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
C5              VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
C6              VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
                **************************************************

C1              ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
C2              ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
C3              ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
C4              ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
C5              ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
C6              ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
                **************************************************

C1              TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
C2              TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
C3              TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
C4              TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
C5              TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
C6              TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
                **************************************************

C1              NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
C2              NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
C3              NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
C4              NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
C5              NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
C6              NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
                **************************************************

C1              YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
C2              YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
C3              YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
C4              YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
C5              YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
C6              YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
                **************************************************

C1              FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
C2              FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
C3              FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
C4              FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
C5              FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
C6              FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
                **************************************************

C1              RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA
C2              RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA
C3              RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA
C4              RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA
C5              RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA
C6              RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA
                **************************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  350 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  350 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10500]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [10500]--->[10500]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.520 Mb, Max= 30.921 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
C2              VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
C3              VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
C4              VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
C5              VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
C6              VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
                **************************************************

C1              ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
C2              ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
C3              ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
C4              ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
C5              ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
C6              ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
                **************************************************

C1              TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
C2              TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
C3              TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
C4              TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
C5              TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
C6              TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
                **************************************************

C1              NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
C2              NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
C3              NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
C4              NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
C5              NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
C6              NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
                **************************************************

C1              YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
C2              YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
C3              YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
C4              YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
C5              YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
C6              YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
                **************************************************

C1              FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
C2              FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
C3              FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
C4              FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
C5              FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
C6              FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
                **************************************************

C1              RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA
C2              RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA
C3              RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA
C4              RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA
C5              RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA
C6              RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA
                **************************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGGTGATCAACCCGTTGATCTGTCGATGTTGTCGTCGGAAGCACTGGC
C2              GTGGGTGATCAACCCGTTGATCTGTCGATGTTGTCGTCGGAAGCACTGGC
C3              GTGGGTGATCAACCCGTTGATCTGTCGATGTTGTCGTCGGAAGCACTGGC
C4              GTGGGTGATCAACCCGTTGATCTGTCGATGTTGTCGTCGGAAGCACTGGC
C5              GTGGGTGATCAACCCGTTGATCTGTCGATGTTGTCGTCGGAAGCACTGGC
C6              GTGGGTGATCAACCCGTTGATCTGTCGATGTTGTCGTCGGAAGCACTGGC
                **************************************************

C1              CAAGGCAGTTAACACCGCCCGCCAAGCCATCGCACTTGCCGTCAATCTCG
C2              CAAGGCAGTTAACACCGCCCGCCAAGCCATCGCACTTGCCGTCAATCTCG
C3              CAAGGCAGTTAACACCGCCCGCCAAGCCATCGCACTTGCCGTCAATCTCG
C4              CAAGGCAGTTAACACCGCCCGCCAAGCCATCGCACTTGCCGTCAATCTCG
C5              CAAGGCAGTTAACACCGCCCGCCAAGCCATCGCACTTGCCGTCAATCTCG
C6              CAAGGCAGTTAACACCGCCCGCCAAGCCATCGCACTTGCCGTCAATCTCG
                **************************************************

C1              ACGCGTTGGCGCTCATCAAGGCCGAGCACCTCGGTGACCGCTCGCCGCTG
C2              ACGCGTTGGCGCTCATCAAGGCCGAGCACCTCGGTGACCGCTCGCCGCTG
C3              ACGCGTTGGCGCTCATCAAGGCCGAGCACCTCGGTGACCGCTCGCCGCTG
C4              ACGCGTTGGCGCTCATCAAGGCCGAGCACCTCGGTGACCGCTCGCCGCTG
C5              ACGCGTTGGCGCTCATCAAGGCCGAGCACCTCGGTGACCGCTCGCCGCTG
C6              ACGCGTTGGCGCTCATCAAGGCCGAGCACCTCGGTGACCGCTCGCCGCTG
                **************************************************

C1              GCGCTCGCACGACAAGCGCTTGCTAGCCTGCCCAAGATTGACCGGGCCGC
C2              GCGCTCGCACGACAAGCGCTTGCTAGCCTGCCCAAGATTGACCGGGCCGC
C3              GCGCTCGCACGACAAGCGCTTGCTAGCCTGCCCAAGATTGACCGGGCCGC
C4              GCGCTCGCACGACAAGCGCTTGCTAGCCTGCCCAAGATTGACCGGGCCGC
C5              GCGCTCGCACGACAAGCGCTTGCTAGCCTGCCCAAGATTGACCGGGCCGC
C6              GCGCTCGCACGACAAGCGCTTGCTAGCCTGCCCAAGATTGACCGGGCCGC
                **************************************************

C1              CGTCGGCAAGCAGGTCAACACGGCCCGCAGCGAGGTCCAGCGTGACTACG
C2              CGTCGGCAAGCAGGTCAACACGGCCCGCAGCGAGGTCCAGCGTGACTACG
C3              CGTCGGCAAGCAGGTCAACACGGCCCGCAGCGAGGTCCAGCGTGACTACG
C4              CGTCGGCAAGCAGGTCAACACGGCCCGCAGCGAGGTCCAGCGTGACTACG
C5              CGTCGGCAAGCAGGTCAACACGGCCCGCAGCGAGGTCCAGCGTGACTACG
C6              CGTCGGCAAGCAGGTCAACACGGCCCGCAGCGAGGTCCAGCGTGACTACG
                **************************************************

C1              ACGAACGACTGGCGACGTTGCAAGCCGAGCGCGACGCGGCCGTGCTGGTC
C2              ACGAACGACTGGCGACGTTGCAAGCCGAGCGCGACGCGGCCGTGCTGGTC
C3              ACGAACGACTGGCGACGTTGCAAGCCGAGCGCGACGCGGCCGTGCTGGTC
C4              ACGAACGACTGGCGACGTTGCAAGCCGAGCGCGACGCGGCCGTGCTGGTC
C5              ACGAACGACTGGCGACGTTGCAAGCCGAGCGCGACGCGGCCGTGCTGGTC
C6              ACGAACGACTGGCGACGTTGCAAGCCGAGCGCGACGCGGCCGTGCTGGTC
                **************************************************

C1              ACCGAACGTATCGATGTCACTCTGCCTTCAACAAGGCAGCCGACCGGAGC
C2              ACCGAACGTATCGATGTCACTCTGCCTTCAACAAGGCAGCCGACCGGAGC
C3              ACCGAACGTATCGATGTCACTCTGCCTTCAACAAGGCAGCCGACCGGAGC
C4              ACCGAACGTATCGATGTCACTCTGCCTTCAACAAGGCAGCCGACCGGAGC
C5              ACCGAACGTATCGATGTCACTCTGCCTTCAACAAGGCAGCCGACCGGAGC
C6              ACCGAACGTATCGATGTCACTCTGCCTTCAACAAGGCAGCCGACCGGAGC
                **************************************************

C1              ACGGCACCCGATAACGATATTGGCCGAGCATATCGCCGATACCTTCATTG
C2              ACGGCACCCGATAACGATATTGGCCGAGCATATCGCCGATACCTTCATTG
C3              ACGGCACCCGATAACGATATTGGCCGAGCATATCGCCGATACCTTCATTG
C4              ACGGCACCCGATAACGATATTGGCCGAGCATATCGCCGATACCTTCATTG
C5              ACGGCACCCGATAACGATATTGGCCGAGCATATCGCCGATACCTTCATTG
C6              ACGGCACCCGATAACGATATTGGCCGAGCATATCGCCGATACCTTCATTG
                **************************************************

C1              CGATGGGATGGGAACTGGTCGACGGACCCGAAGTCGAGACTGAGCAGTTT
C2              CGATGGGATGGGAACTGGTCGACGGACCCGAAGTCGAGACTGAGCAGTTT
C3              CGATGGGATGGGAACTGGTCGACGGACCCGAAGTCGAGACTGAGCAGTTT
C4              CGATGGGATGGGAACTGGTCGACGGACCCGAAGTCGAGACTGAGCAGTTT
C5              CGATGGGATGGGAACTGGTCGACGGACCCGAAGTCGAGACTGAGCAGTTT
C6              CGATGGGATGGGAACTGGTCGACGGACCCGAAGTCGAGACTGAGCAGTTT
                **************************************************

C1              AACTTTGACGCTCTTAACTTTCCTGCCGACCACCCCGCACGCAGTGAACA
C2              AACTTTGACGCTCTTAACTTTCCTGCCGACCACCCCGCACGCAGTGAACA
C3              AACTTTGACGCTCTTAACTTTCCTGCCGACCACCCCGCACGCAGTGAACA
C4              AACTTTGACGCTCTTAACTTTCCTGCCGACCACCCCGCACGCAGTGAACA
C5              AACTTTGACGCTCTTAACTTTCCTGCCGACCACCCCGCACGCAGTGAACA
C6              AACTTTGACGCTCTTAACTTTCCTGCCGACCACCCCGCACGCAGTGAACA
                **************************************************

C1              GGACACCTTTTATATTGCGCCGGACGGTTCACGGCAGCTACTGCGAACCC
C2              GGACACCTTTTATATTGCGCCGGACGGTTCACGGCAGCTACTGCGAACCC
C3              GGACACCTTTTATATTGCGCCGGACGGTTCACGGCAGCTACTGCGAACCC
C4              GGACACCTTTTATATTGCGCCGGACGGTTCACGGCAGCTACTGCGAACCC
C5              GGACACCTTTTATATTGCGCCGGACGGTTCACGGCAGCTACTGCGAACCC
C6              GGACACCTTTTATATTGCGCCGGACGGTTCACGGCAGCTACTGCGAACCC
                **************************************************

C1              ATACTTCACCAGTGCAGGTGCGGACTTTGCTCGAGCGTGAGCTGCCGGTC
C2              ATACTTCACCAGTGCAGGTGCGGACTTTGCTCGAGCGTGAGCTGCCGGTC
C3              ATACTTCACCAGTGCAGGTGCGGACTTTGCTCGAGCGTGAGCTGCCGGTC
C4              ATACTTCACCAGTGCAGGTGCGGACTTTGCTCGAGCGTGAGCTGCCGGTC
C5              ATACTTCACCAGTGCAGGTGCGGACTTTGCTCGAGCGTGAGCTGCCGGTC
C6              ATACTTCACCAGTGCAGGTGCGGACTTTGCTCGAGCGTGAGCTGCCGGTC
                **************************************************

C1              TACGTCATCTCGATCGGTCGAGCCTTCCGCACCGACGAAGTCGATGCCAC
C2              TACGTCATCTCGATCGGTCGAGCCTTCCGCACCGACGAAGTCGATGCCAC
C3              TACGTCATCTCGATCGGTCGAGCCTTCCGCACCGACGAAGTCGATGCCAC
C4              TACGTCATCTCGATCGGTCGAGCCTTCCGCACCGACGAAGTCGATGCCAC
C5              TACGTCATCTCGATCGGTCGAGCCTTCCGCACCGACGAAGTCGATGCCAC
C6              TACGTCATCTCGATCGGTCGAGCCTTCCGCACCGACGAAGTCGATGCCAC
                **************************************************

C1              CCACACGCCCGTCTTCCATCAAGTCGAAGGCCTGGCAGTGGACCGCGGTC
C2              CCACACGCCCGTCTTCCATCAAGTCGAAGGCCTGGCAGTGGACCGCGGTC
C3              CCACACGCCCGTCTTCCATCAAGTCGAAGGCCTGGCAGTGGACCGCGGTC
C4              CCACACGCCCGTCTTCCATCAAGTCGAAGGCCTGGCAGTGGACCGCGGTC
C5              CCACACGCCCGTCTTCCATCAAGTCGAAGGCCTGGCAGTGGACCGCGGTC
C6              CCACACGCCCGTCTTCCATCAAGTCGAAGGCCTGGCAGTGGACCGCGGTC
                **************************************************

C1              TTTCCATGGCGCATCTGCGGGGAACGTTGGACATCTTCGCACGCGCGGAG
C2              TTTCCATGGCGCATCTGCGGGGAACGTTGGACATCTTCGCACGCGCGGAG
C3              TTTCCATGGCGCATCTGCGGGGAACGTTGGACATCTTCGCACGCGCGGAG
C4              TTTCCATGGCGCATCTGCGGGGAACGTTGGACATCTTCGCACGCGCGGAG
C5              TTTCCATGGCGCATCTGCGGGGAACGTTGGACATCTTCGCACGCGCGGAG
C6              TTTCCATGGCGCATCTGCGGGGAACGTTGGACATCTTCGCACGCGCGGAG
                **************************************************

C1              TTCGGGCCGTCGACGCGCACCCGGATCCGGCCGCACTTCTTCCCATTCAC
C2              TTCGGGCCGTCGACGCGCACCCGGATCCGGCCGCACTTCTTCCCATTCAC
C3              TTCGGGCCGTCGACGCGCACCCGGATCCGGCCGCACTTCTTCCCATTCAC
C4              TTCGGGCCGTCGACGCGCACCCGGATCCGGCCGCACTTCTTCCCATTCAC
C5              TTCGGGCCGTCGACGCGCACCCGGATCCGGCCGCACTTCTTCCCATTCAC
C6              TTCGGGCCGTCGACGCGCACCCGGATCCGGCCGCACTTCTTCCCATTCAC
                **************************************************

C1              CGAACCGTCGGCCGAGGTCGATGTATGGTTTGCGAGCAAAAAGGATGGCG
C2              CGAACCGTCGGCCGAGGTCGATGTATGGTTTGCGAGCAAAAAGGATGGCG
C3              CGAACCGTCGGCCGAGGTCGATGTATGGTTTGCGAGCAAAAAGGATGGCG
C4              CGAACCGTCGGCCGAGGTCGATGTATGGTTTGCGAGCAAAAAGGATGGCG
C5              CGAACCGTCGGCCGAGGTCGATGTATGGTTTGCGAGCAAAAAGGATGGCG
C6              CGAACCGTCGGCCGAGGTCGATGTATGGTTTGCGAGCAAAAAGGATGGCG
                **************************************************

C1              CTGACTGGGTGGAATGGGGCGGTTGCGGAATGGTGCATCCAAACGTGTTG
C2              CTGACTGGGTGGAATGGGGCGGTTGCGGAATGGTGCATCCAAACGTGTTG
C3              CTGACTGGGTGGAATGGGGCGGTTGCGGAATGGTGCATCCAAACGTGTTG
C4              CTGACTGGGTGGAATGGGGCGGTTGCGGAATGGTGCATCCAAACGTGTTG
C5              CTGACTGGGTGGAATGGGGCGGTTGCGGAATGGTGCATCCAAACGTGTTG
C6              CTGACTGGGTGGAATGGGGCGGTTGCGGAATGGTGCATCCAAACGTGTTG
                **************************************************

C1              CGGGCAACAGGAATTGACCCGGATATCTACTCCGGTTTCGCATTCGGGAT
C2              CGGGCAACAGGAATTGACCCGGATATCTACTCCGGTTTCGCATTCGGGAT
C3              CGGGCAACAGGAATTGACCCGGATATCTACTCCGGTTTCGCATTCGGGAT
C4              CGGGCAACAGGAATTGACCCGGATATCTACTCCGGTTTCGCATTCGGGAT
C5              CGGGCAACAGGAATTGACCCGGATATCTACTCCGGTTTCGCATTCGGGAT
C6              CGGGCAACAGGAATTGACCCGGATATCTACTCCGGTTTCGCATTCGGGAT
                **************************************************

C1              GGGCCTGGAACGCACCCTGCAGTTCCGCAACAGCATTCCCAACATGCGCG
C2              GGGCCTGGAACGCACCCTGCAGTTCCGCAACAGCATTCCCAACATGCGCG
C3              GGGCCTGGAACGCACCCTGCAGTTCCGCAACAGCATTCCCAACATGCGCG
C4              GGGCCTGGAACGCACCCTGCAGTTCCGCAACAGCATTCCCAACATGCGCG
C5              GGGCCTGGAACGCACCCTGCAGTTCCGCAACAGCATTCCCAACATGCGCG
C6              GGGCCTGGAACGCACCCTGCAGTTCCGCAACAGCATTCCCAACATGCGCG
                **************************************************

C1              ATATGGTCGAAGGGGACGTTCGGTTTTCGTTGCCGTTCGGGGTGGGGGCT
C2              ATATGGTCGAAGGGGACGTTCGGTTTTCGTTGCCGTTCGGGGTGGGGGCT
C3              ATATGGTCGAAGGGGACGTTCGGTTTTCGTTGCCGTTCGGGGTGGGGGCT
C4              ATATGGTCGAAGGGGACGTTCGGTTTTCGTTGCCGTTCGGGGTGGGGGCT
C5              ATATGGTCGAAGGGGACGTTCGGTTTTCGTTGCCGTTCGGGGTGGGGGCT
C6              ATATGGTCGAAGGGGACGTTCGGTTTTCGTTGCCGTTCGGGGTGGGGGCT
                **************************************************



>C1
GTGGGTGATCAACCCGTTGATCTGTCGATGTTGTCGTCGGAAGCACTGGC
CAAGGCAGTTAACACCGCCCGCCAAGCCATCGCACTTGCCGTCAATCTCG
ACGCGTTGGCGCTCATCAAGGCCGAGCACCTCGGTGACCGCTCGCCGCTG
GCGCTCGCACGACAAGCGCTTGCTAGCCTGCCCAAGATTGACCGGGCCGC
CGTCGGCAAGCAGGTCAACACGGCCCGCAGCGAGGTCCAGCGTGACTACG
ACGAACGACTGGCGACGTTGCAAGCCGAGCGCGACGCGGCCGTGCTGGTC
ACCGAACGTATCGATGTCACTCTGCCTTCAACAAGGCAGCCGACCGGAGC
ACGGCACCCGATAACGATATTGGCCGAGCATATCGCCGATACCTTCATTG
CGATGGGATGGGAACTGGTCGACGGACCCGAAGTCGAGACTGAGCAGTTT
AACTTTGACGCTCTTAACTTTCCTGCCGACCACCCCGCACGCAGTGAACA
GGACACCTTTTATATTGCGCCGGACGGTTCACGGCAGCTACTGCGAACCC
ATACTTCACCAGTGCAGGTGCGGACTTTGCTCGAGCGTGAGCTGCCGGTC
TACGTCATCTCGATCGGTCGAGCCTTCCGCACCGACGAAGTCGATGCCAC
CCACACGCCCGTCTTCCATCAAGTCGAAGGCCTGGCAGTGGACCGCGGTC
TTTCCATGGCGCATCTGCGGGGAACGTTGGACATCTTCGCACGCGCGGAG
TTCGGGCCGTCGACGCGCACCCGGATCCGGCCGCACTTCTTCCCATTCAC
CGAACCGTCGGCCGAGGTCGATGTATGGTTTGCGAGCAAAAAGGATGGCG
CTGACTGGGTGGAATGGGGCGGTTGCGGAATGGTGCATCCAAACGTGTTG
CGGGCAACAGGAATTGACCCGGATATCTACTCCGGTTTCGCATTCGGGAT
GGGCCTGGAACGCACCCTGCAGTTCCGCAACAGCATTCCCAACATGCGCG
ATATGGTCGAAGGGGACGTTCGGTTTTCGTTGCCGTTCGGGGTGGGGGCT
>C2
GTGGGTGATCAACCCGTTGATCTGTCGATGTTGTCGTCGGAAGCACTGGC
CAAGGCAGTTAACACCGCCCGCCAAGCCATCGCACTTGCCGTCAATCTCG
ACGCGTTGGCGCTCATCAAGGCCGAGCACCTCGGTGACCGCTCGCCGCTG
GCGCTCGCACGACAAGCGCTTGCTAGCCTGCCCAAGATTGACCGGGCCGC
CGTCGGCAAGCAGGTCAACACGGCCCGCAGCGAGGTCCAGCGTGACTACG
ACGAACGACTGGCGACGTTGCAAGCCGAGCGCGACGCGGCCGTGCTGGTC
ACCGAACGTATCGATGTCACTCTGCCTTCAACAAGGCAGCCGACCGGAGC
ACGGCACCCGATAACGATATTGGCCGAGCATATCGCCGATACCTTCATTG
CGATGGGATGGGAACTGGTCGACGGACCCGAAGTCGAGACTGAGCAGTTT
AACTTTGACGCTCTTAACTTTCCTGCCGACCACCCCGCACGCAGTGAACA
GGACACCTTTTATATTGCGCCGGACGGTTCACGGCAGCTACTGCGAACCC
ATACTTCACCAGTGCAGGTGCGGACTTTGCTCGAGCGTGAGCTGCCGGTC
TACGTCATCTCGATCGGTCGAGCCTTCCGCACCGACGAAGTCGATGCCAC
CCACACGCCCGTCTTCCATCAAGTCGAAGGCCTGGCAGTGGACCGCGGTC
TTTCCATGGCGCATCTGCGGGGAACGTTGGACATCTTCGCACGCGCGGAG
TTCGGGCCGTCGACGCGCACCCGGATCCGGCCGCACTTCTTCCCATTCAC
CGAACCGTCGGCCGAGGTCGATGTATGGTTTGCGAGCAAAAAGGATGGCG
CTGACTGGGTGGAATGGGGCGGTTGCGGAATGGTGCATCCAAACGTGTTG
CGGGCAACAGGAATTGACCCGGATATCTACTCCGGTTTCGCATTCGGGAT
GGGCCTGGAACGCACCCTGCAGTTCCGCAACAGCATTCCCAACATGCGCG
ATATGGTCGAAGGGGACGTTCGGTTTTCGTTGCCGTTCGGGGTGGGGGCT
>C3
GTGGGTGATCAACCCGTTGATCTGTCGATGTTGTCGTCGGAAGCACTGGC
CAAGGCAGTTAACACCGCCCGCCAAGCCATCGCACTTGCCGTCAATCTCG
ACGCGTTGGCGCTCATCAAGGCCGAGCACCTCGGTGACCGCTCGCCGCTG
GCGCTCGCACGACAAGCGCTTGCTAGCCTGCCCAAGATTGACCGGGCCGC
CGTCGGCAAGCAGGTCAACACGGCCCGCAGCGAGGTCCAGCGTGACTACG
ACGAACGACTGGCGACGTTGCAAGCCGAGCGCGACGCGGCCGTGCTGGTC
ACCGAACGTATCGATGTCACTCTGCCTTCAACAAGGCAGCCGACCGGAGC
ACGGCACCCGATAACGATATTGGCCGAGCATATCGCCGATACCTTCATTG
CGATGGGATGGGAACTGGTCGACGGACCCGAAGTCGAGACTGAGCAGTTT
AACTTTGACGCTCTTAACTTTCCTGCCGACCACCCCGCACGCAGTGAACA
GGACACCTTTTATATTGCGCCGGACGGTTCACGGCAGCTACTGCGAACCC
ATACTTCACCAGTGCAGGTGCGGACTTTGCTCGAGCGTGAGCTGCCGGTC
TACGTCATCTCGATCGGTCGAGCCTTCCGCACCGACGAAGTCGATGCCAC
CCACACGCCCGTCTTCCATCAAGTCGAAGGCCTGGCAGTGGACCGCGGTC
TTTCCATGGCGCATCTGCGGGGAACGTTGGACATCTTCGCACGCGCGGAG
TTCGGGCCGTCGACGCGCACCCGGATCCGGCCGCACTTCTTCCCATTCAC
CGAACCGTCGGCCGAGGTCGATGTATGGTTTGCGAGCAAAAAGGATGGCG
CTGACTGGGTGGAATGGGGCGGTTGCGGAATGGTGCATCCAAACGTGTTG
CGGGCAACAGGAATTGACCCGGATATCTACTCCGGTTTCGCATTCGGGAT
GGGCCTGGAACGCACCCTGCAGTTCCGCAACAGCATTCCCAACATGCGCG
ATATGGTCGAAGGGGACGTTCGGTTTTCGTTGCCGTTCGGGGTGGGGGCT
>C4
GTGGGTGATCAACCCGTTGATCTGTCGATGTTGTCGTCGGAAGCACTGGC
CAAGGCAGTTAACACCGCCCGCCAAGCCATCGCACTTGCCGTCAATCTCG
ACGCGTTGGCGCTCATCAAGGCCGAGCACCTCGGTGACCGCTCGCCGCTG
GCGCTCGCACGACAAGCGCTTGCTAGCCTGCCCAAGATTGACCGGGCCGC
CGTCGGCAAGCAGGTCAACACGGCCCGCAGCGAGGTCCAGCGTGACTACG
ACGAACGACTGGCGACGTTGCAAGCCGAGCGCGACGCGGCCGTGCTGGTC
ACCGAACGTATCGATGTCACTCTGCCTTCAACAAGGCAGCCGACCGGAGC
ACGGCACCCGATAACGATATTGGCCGAGCATATCGCCGATACCTTCATTG
CGATGGGATGGGAACTGGTCGACGGACCCGAAGTCGAGACTGAGCAGTTT
AACTTTGACGCTCTTAACTTTCCTGCCGACCACCCCGCACGCAGTGAACA
GGACACCTTTTATATTGCGCCGGACGGTTCACGGCAGCTACTGCGAACCC
ATACTTCACCAGTGCAGGTGCGGACTTTGCTCGAGCGTGAGCTGCCGGTC
TACGTCATCTCGATCGGTCGAGCCTTCCGCACCGACGAAGTCGATGCCAC
CCACACGCCCGTCTTCCATCAAGTCGAAGGCCTGGCAGTGGACCGCGGTC
TTTCCATGGCGCATCTGCGGGGAACGTTGGACATCTTCGCACGCGCGGAG
TTCGGGCCGTCGACGCGCACCCGGATCCGGCCGCACTTCTTCCCATTCAC
CGAACCGTCGGCCGAGGTCGATGTATGGTTTGCGAGCAAAAAGGATGGCG
CTGACTGGGTGGAATGGGGCGGTTGCGGAATGGTGCATCCAAACGTGTTG
CGGGCAACAGGAATTGACCCGGATATCTACTCCGGTTTCGCATTCGGGAT
GGGCCTGGAACGCACCCTGCAGTTCCGCAACAGCATTCCCAACATGCGCG
ATATGGTCGAAGGGGACGTTCGGTTTTCGTTGCCGTTCGGGGTGGGGGCT
>C5
GTGGGTGATCAACCCGTTGATCTGTCGATGTTGTCGTCGGAAGCACTGGC
CAAGGCAGTTAACACCGCCCGCCAAGCCATCGCACTTGCCGTCAATCTCG
ACGCGTTGGCGCTCATCAAGGCCGAGCACCTCGGTGACCGCTCGCCGCTG
GCGCTCGCACGACAAGCGCTTGCTAGCCTGCCCAAGATTGACCGGGCCGC
CGTCGGCAAGCAGGTCAACACGGCCCGCAGCGAGGTCCAGCGTGACTACG
ACGAACGACTGGCGACGTTGCAAGCCGAGCGCGACGCGGCCGTGCTGGTC
ACCGAACGTATCGATGTCACTCTGCCTTCAACAAGGCAGCCGACCGGAGC
ACGGCACCCGATAACGATATTGGCCGAGCATATCGCCGATACCTTCATTG
CGATGGGATGGGAACTGGTCGACGGACCCGAAGTCGAGACTGAGCAGTTT
AACTTTGACGCTCTTAACTTTCCTGCCGACCACCCCGCACGCAGTGAACA
GGACACCTTTTATATTGCGCCGGACGGTTCACGGCAGCTACTGCGAACCC
ATACTTCACCAGTGCAGGTGCGGACTTTGCTCGAGCGTGAGCTGCCGGTC
TACGTCATCTCGATCGGTCGAGCCTTCCGCACCGACGAAGTCGATGCCAC
CCACACGCCCGTCTTCCATCAAGTCGAAGGCCTGGCAGTGGACCGCGGTC
TTTCCATGGCGCATCTGCGGGGAACGTTGGACATCTTCGCACGCGCGGAG
TTCGGGCCGTCGACGCGCACCCGGATCCGGCCGCACTTCTTCCCATTCAC
CGAACCGTCGGCCGAGGTCGATGTATGGTTTGCGAGCAAAAAGGATGGCG
CTGACTGGGTGGAATGGGGCGGTTGCGGAATGGTGCATCCAAACGTGTTG
CGGGCAACAGGAATTGACCCGGATATCTACTCCGGTTTCGCATTCGGGAT
GGGCCTGGAACGCACCCTGCAGTTCCGCAACAGCATTCCCAACATGCGCG
ATATGGTCGAAGGGGACGTTCGGTTTTCGTTGCCGTTCGGGGTGGGGGCT
>C6
GTGGGTGATCAACCCGTTGATCTGTCGATGTTGTCGTCGGAAGCACTGGC
CAAGGCAGTTAACACCGCCCGCCAAGCCATCGCACTTGCCGTCAATCTCG
ACGCGTTGGCGCTCATCAAGGCCGAGCACCTCGGTGACCGCTCGCCGCTG
GCGCTCGCACGACAAGCGCTTGCTAGCCTGCCCAAGATTGACCGGGCCGC
CGTCGGCAAGCAGGTCAACACGGCCCGCAGCGAGGTCCAGCGTGACTACG
ACGAACGACTGGCGACGTTGCAAGCCGAGCGCGACGCGGCCGTGCTGGTC
ACCGAACGTATCGATGTCACTCTGCCTTCAACAAGGCAGCCGACCGGAGC
ACGGCACCCGATAACGATATTGGCCGAGCATATCGCCGATACCTTCATTG
CGATGGGATGGGAACTGGTCGACGGACCCGAAGTCGAGACTGAGCAGTTT
AACTTTGACGCTCTTAACTTTCCTGCCGACCACCCCGCACGCAGTGAACA
GGACACCTTTTATATTGCGCCGGACGGTTCACGGCAGCTACTGCGAACCC
ATACTTCACCAGTGCAGGTGCGGACTTTGCTCGAGCGTGAGCTGCCGGTC
TACGTCATCTCGATCGGTCGAGCCTTCCGCACCGACGAAGTCGATGCCAC
CCACACGCCCGTCTTCCATCAAGTCGAAGGCCTGGCAGTGGACCGCGGTC
TTTCCATGGCGCATCTGCGGGGAACGTTGGACATCTTCGCACGCGCGGAG
TTCGGGCCGTCGACGCGCACCCGGATCCGGCCGCACTTCTTCCCATTCAC
CGAACCGTCGGCCGAGGTCGATGTATGGTTTGCGAGCAAAAAGGATGGCG
CTGACTGGGTGGAATGGGGCGGTTGCGGAATGGTGCATCCAAACGTGTTG
CGGGCAACAGGAATTGACCCGGATATCTACTCCGGTTTCGCATTCGGGAT
GGGCCTGGAACGCACCCTGCAGTTCCGCAACAGCATTCCCAACATGCGCG
ATATGGTCGAAGGGGACGTTCGGTTTTCGTTGCCGTTCGGGGTGGGGGCT
>C1
VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA

>C2
VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA

>C3
VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA

>C4
VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA

>C5
VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA

>C6
VGDQPVDLSMLSSEALAKAVNTARQAIALAVNLDALALIKAEHLGDRSPL
ALARQALASLPKIDRAAVGKQVNTARSEVQRDYDERLATLQAERDAAVLV
TERIDVTLPSTRQPTGARHPITILAEHIADTFIAMGWELVDGPEVETEQF
NFDALNFPADHPARSEQDTFYIAPDGSRQLLRTHTSPVQVRTLLERELPV
YVISIGRAFRTDEVDATHTPVFHQVEGLAVDRGLSMAHLRGTLDIFARAE
FGPSTRTRIRPHFFPFTEPSAEVDVWFASKKDGADWVEWGGCGMVHPNVL
RATGIDPDIYSGFAFGMGLERTLQFRNSIPNMRDMVEGDVRFSLPFGVGA



                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/pheS/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1050 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579785238
      Setting output file names to "/data/10res/pheS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 574405533
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9978922310
      Seed = 605923248
      Swapseed = 1579785238
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2349.950205 -- -24.965149
         Chain 2 -- -2349.950205 -- -24.965149
         Chain 3 -- -2349.950340 -- -24.965149
         Chain 4 -- -2349.950340 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2349.950340 -- -24.965149
         Chain 2 -- -2349.950205 -- -24.965149
         Chain 3 -- -2349.950340 -- -24.965149
         Chain 4 -- -2349.950340 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2349.950] (-2349.950) (-2349.950) (-2349.950) * [-2349.950] (-2349.950) (-2349.950) (-2349.950) 
        500 -- [-1440.271] (-1462.276) (-1442.938) (-1443.743) * (-1469.107) [-1438.494] (-1469.823) (-1441.102) -- 0:00:00
       1000 -- (-1440.736) (-1453.531) [-1446.719] (-1439.367) * (-1460.288) (-1447.174) [-1441.789] (-1440.144) -- 0:00:00
       1500 -- (-1438.463) (-1450.555) (-1437.243) [-1436.432] * [-1443.087] (-1440.864) (-1438.289) (-1439.570) -- 0:00:00
       2000 -- (-1445.720) (-1456.315) [-1437.190] (-1443.649) * [-1434.731] (-1448.429) (-1438.622) (-1440.153) -- 0:00:00
       2500 -- [-1444.752] (-1447.838) (-1443.987) (-1447.834) * (-1440.075) (-1443.093) (-1438.320) [-1446.725] -- 0:00:00
       3000 -- [-1444.147] (-1435.143) (-1447.177) (-1438.409) * (-1447.627) [-1438.142] (-1437.269) (-1438.458) -- 0:00:00
       3500 -- (-1444.396) (-1443.557) (-1439.720) [-1435.803] * (-1440.391) [-1441.483] (-1437.089) (-1441.651) -- 0:00:00
       4000 -- (-1446.999) (-1437.768) [-1439.144] (-1439.840) * (-1437.590) (-1441.561) (-1446.142) [-1440.779] -- 0:00:00
       4500 -- (-1450.612) (-1439.858) (-1441.048) [-1440.669] * (-1440.519) [-1439.164] (-1447.730) (-1448.926) -- 0:00:00
       5000 -- (-1442.648) (-1441.877) (-1441.186) [-1435.115] * (-1432.239) (-1446.829) [-1439.621] (-1441.893) -- 0:00:00

      Average standard deviation of split frequencies: 0.069838

       5500 -- (-1441.342) (-1450.235) (-1442.946) [-1437.795] * (-1432.458) [-1435.743] (-1446.449) (-1439.408) -- 0:00:00
       6000 -- (-1444.798) [-1443.796] (-1441.275) (-1440.530) * [-1433.052] (-1440.412) (-1440.171) (-1451.847) -- 0:00:00
       6500 -- (-1443.864) (-1444.733) (-1451.487) [-1437.618] * (-1431.334) (-1442.470) [-1444.124] (-1442.553) -- 0:00:00
       7000 -- [-1440.701] (-1439.813) (-1439.793) (-1452.819) * (-1431.343) [-1436.920] (-1440.693) (-1445.460) -- 0:00:00
       7500 -- (-1448.832) (-1438.828) [-1439.175] (-1442.670) * (-1431.021) (-1436.960) [-1444.823] (-1444.643) -- 0:00:00
       8000 -- (-1435.665) (-1442.657) (-1440.397) [-1444.689] * [-1432.829] (-1452.895) (-1443.377) (-1455.910) -- 0:00:00
       8500 -- [-1446.115] (-1443.201) (-1449.845) (-1442.672) * (-1430.964) (-1437.378) [-1440.396] (-1449.839) -- 0:00:00
       9000 -- [-1439.454] (-1441.302) (-1438.812) (-1438.941) * (-1431.095) (-1439.924) (-1444.288) [-1440.754] -- 0:00:00
       9500 -- (-1449.970) [-1440.235] (-1444.043) (-1448.811) * (-1431.669) (-1438.904) (-1446.411) [-1438.060] -- 0:00:00
      10000 -- (-1442.118) [-1444.337] (-1435.662) (-1445.609) * (-1430.679) (-1441.203) (-1441.158) [-1439.610] -- 0:01:39

      Average standard deviation of split frequencies: 0.063836

      10500 -- (-1440.071) (-1442.234) [-1441.054] (-1439.395) * [-1431.430] (-1438.423) (-1451.924) (-1440.761) -- 0:01:34
      11000 -- (-1447.926) (-1438.329) (-1437.858) [-1439.248] * [-1431.457] (-1439.190) (-1441.357) (-1442.145) -- 0:01:29
      11500 -- (-1442.224) [-1433.025] (-1437.401) (-1447.211) * (-1430.023) [-1440.886] (-1442.505) (-1443.879) -- 0:01:25
      12000 -- (-1436.423) (-1442.122) (-1445.573) [-1438.214] * (-1430.879) (-1448.315) (-1439.844) [-1441.103] -- 0:01:22
      12500 -- (-1443.385) (-1437.908) (-1449.082) [-1438.399] * (-1431.586) (-1440.202) [-1434.952] (-1440.444) -- 0:01:19
      13000 -- (-1437.692) [-1437.730] (-1450.206) (-1444.499) * (-1431.388) [-1437.565] (-1441.233) (-1446.298) -- 0:01:15
      13500 -- (-1442.188) [-1444.128] (-1439.179) (-1440.317) * (-1431.198) [-1440.863] (-1444.134) (-1444.730) -- 0:01:13
      14000 -- (-1437.783) [-1443.111] (-1447.560) (-1442.412) * (-1430.141) [-1446.245] (-1444.607) (-1438.251) -- 0:01:10
      14500 -- (-1437.974) (-1446.674) [-1441.533] (-1441.458) * (-1432.522) (-1441.587) [-1444.567] (-1442.128) -- 0:01:07
      15000 -- (-1436.730) (-1443.750) (-1439.402) [-1439.244] * [-1432.074] (-1441.158) (-1445.597) (-1443.065) -- 0:01:05

      Average standard deviation of split frequencies: 0.067110

      15500 -- [-1440.168] (-1449.199) (-1437.063) (-1446.427) * [-1433.350] (-1433.853) (-1438.643) (-1443.188) -- 0:01:03
      16000 -- [-1444.146] (-1443.266) (-1440.407) (-1442.776) * (-1434.092) [-1432.633] (-1450.557) (-1442.730) -- 0:01:01
      16500 -- (-1446.803) (-1434.622) [-1440.234] (-1440.184) * (-1432.133) (-1435.116) (-1446.645) [-1438.441] -- 0:00:59
      17000 -- (-1441.347) (-1441.967) (-1446.322) [-1436.295] * (-1431.549) (-1437.051) (-1445.743) [-1442.720] -- 0:00:57
      17500 -- (-1438.774) [-1438.835] (-1445.717) (-1439.811) * (-1432.469) (-1434.728) [-1437.016] (-1446.812) -- 0:00:56
      18000 -- (-1440.672) (-1441.960) (-1443.579) [-1439.697] * [-1430.575] (-1434.650) (-1439.158) (-1452.275) -- 0:00:54
      18500 -- (-1438.133) [-1438.302] (-1440.046) (-1445.081) * (-1430.781) (-1434.508) (-1445.130) [-1439.458] -- 0:00:53
      19000 -- [-1437.874] (-1445.167) (-1436.886) (-1439.510) * (-1430.749) (-1435.327) [-1440.402] (-1436.292) -- 0:00:51
      19500 -- (-1438.019) (-1443.491) (-1438.317) [-1437.409] * [-1430.786] (-1432.769) (-1446.371) (-1437.160) -- 0:00:50
      20000 -- [-1438.710] (-1446.540) (-1447.361) (-1440.999) * (-1430.772) (-1431.983) (-1452.121) [-1442.044] -- 0:00:49

      Average standard deviation of split frequencies: 0.054744

      20500 -- (-1447.014) [-1439.723] (-1440.079) (-1446.038) * (-1431.065) (-1434.343) (-1454.016) [-1437.341] -- 0:00:47
      21000 -- [-1445.543] (-1444.224) (-1442.011) (-1440.514) * [-1431.464] (-1431.340) (-1431.339) (-1446.779) -- 0:00:46
      21500 -- (-1448.934) [-1437.031] (-1439.505) (-1445.247) * [-1434.462] (-1431.291) (-1431.854) (-1436.653) -- 0:00:45
      22000 -- [-1443.228] (-1445.571) (-1445.994) (-1446.406) * [-1431.401] (-1431.059) (-1430.518) (-1444.002) -- 0:00:44
      22500 -- (-1446.046) [-1444.211] (-1440.415) (-1441.285) * [-1431.335] (-1431.716) (-1432.735) (-1448.441) -- 0:00:43
      23000 -- (-1443.992) (-1437.525) (-1443.158) [-1441.284] * (-1432.733) (-1430.785) (-1431.927) [-1437.402] -- 0:00:42
      23500 -- (-1441.262) [-1439.506] (-1446.413) (-1442.646) * (-1431.379) [-1430.748] (-1433.703) (-1440.358) -- 0:01:23
      24000 -- (-1447.517) [-1434.406] (-1451.736) (-1439.732) * (-1431.775) [-1430.707] (-1431.657) (-1437.229) -- 0:01:21
      24500 -- (-1436.520) (-1439.893) [-1441.618] (-1438.157) * [-1433.381] (-1432.540) (-1434.637) (-1435.792) -- 0:01:19
      25000 -- (-1440.754) (-1439.143) [-1436.338] (-1437.977) * (-1432.150) [-1430.778] (-1430.256) (-1443.206) -- 0:01:18

      Average standard deviation of split frequencies: 0.057689

      25500 -- (-1443.040) (-1449.393) (-1437.623) [-1438.288] * (-1433.727) (-1431.672) (-1432.541) [-1444.534] -- 0:01:16
      26000 -- (-1440.402) (-1440.868) [-1438.477] (-1440.437) * (-1431.770) (-1431.781) [-1436.677] (-1450.982) -- 0:01:14
      26500 -- (-1442.705) [-1434.036] (-1445.404) (-1446.387) * [-1431.037] (-1435.190) (-1434.175) (-1450.806) -- 0:01:13
      27000 -- (-1435.704) (-1437.748) [-1442.892] (-1440.911) * (-1430.520) [-1435.043] (-1431.919) (-1451.051) -- 0:01:12
      27500 -- (-1436.451) (-1434.009) [-1442.948] (-1442.451) * (-1430.493) [-1434.085] (-1432.910) (-1440.444) -- 0:01:10
      28000 -- (-1432.901) (-1436.621) (-1435.721) [-1448.012] * (-1430.470) (-1432.288) [-1433.302] (-1444.663) -- 0:01:09
      28500 -- (-1433.755) (-1438.598) [-1439.863] (-1437.468) * (-1431.390) (-1441.190) (-1432.031) [-1440.732] -- 0:01:08
      29000 -- [-1432.505] (-1438.128) (-1446.165) (-1443.478) * (-1433.388) (-1434.310) (-1432.666) [-1438.540] -- 0:01:06
      29500 -- (-1435.510) (-1447.434) (-1441.048) [-1438.057] * (-1432.080) (-1434.605) [-1434.010] (-1444.166) -- 0:01:05
      30000 -- (-1432.085) (-1441.836) (-1445.880) [-1447.982] * (-1430.200) (-1433.750) [-1433.665] (-1440.999) -- 0:01:04

      Average standard deviation of split frequencies: 0.046925

      30500 -- (-1431.667) (-1444.938) [-1443.565] (-1454.958) * (-1432.702) (-1432.380) [-1434.011] (-1443.663) -- 0:01:03
      31000 -- (-1431.383) (-1440.224) (-1439.246) [-1440.821] * [-1431.031] (-1433.050) (-1433.903) (-1449.467) -- 0:01:02
      31500 -- [-1430.628] (-1440.354) (-1443.281) (-1440.773) * [-1431.789] (-1432.509) (-1434.284) (-1437.883) -- 0:01:01
      32000 -- [-1433.652] (-1439.481) (-1439.169) (-1448.040) * [-1433.811] (-1432.405) (-1434.984) (-1441.143) -- 0:01:00
      32500 -- (-1434.652) [-1439.314] (-1440.920) (-1449.494) * (-1434.755) (-1431.954) [-1432.925] (-1440.810) -- 0:00:59
      33000 -- [-1431.572] (-1441.987) (-1441.429) (-1446.128) * (-1436.389) [-1432.256] (-1432.610) (-1441.838) -- 0:00:58
      33500 -- [-1433.042] (-1442.122) (-1439.743) (-1446.116) * (-1434.905) [-1433.553] (-1431.250) (-1444.724) -- 0:00:57
      34000 -- (-1437.150) (-1441.766) (-1440.073) [-1442.056] * (-1432.879) (-1431.723) (-1431.137) [-1440.385] -- 0:00:56
      34500 -- (-1433.756) (-1442.807) [-1438.037] (-1444.539) * [-1433.236] (-1432.928) (-1431.771) (-1439.702) -- 0:00:55
      35000 -- (-1434.049) (-1439.311) (-1439.620) [-1437.506] * [-1433.490] (-1434.042) (-1430.342) (-1435.746) -- 0:00:55

      Average standard deviation of split frequencies: 0.041466

      35500 -- [-1432.997] (-1440.749) (-1440.760) (-1444.775) * (-1433.020) (-1434.018) [-1433.111] (-1439.372) -- 0:00:54
      36000 -- (-1432.003) (-1445.933) [-1442.456] (-1441.972) * (-1433.272) [-1432.220] (-1430.122) (-1440.706) -- 0:00:53
      36500 -- (-1432.068) (-1442.902) [-1440.387] (-1444.897) * (-1431.123) (-1434.148) (-1432.815) [-1443.625] -- 0:00:52
      37000 -- (-1433.669) (-1441.048) [-1440.375] (-1446.950) * (-1435.433) (-1436.073) [-1432.058] (-1435.929) -- 0:00:52
      37500 -- (-1433.616) (-1441.027) (-1443.473) [-1439.513] * (-1433.128) (-1439.140) [-1432.038] (-1441.468) -- 0:00:51
      38000 -- (-1433.794) [-1435.821] (-1449.008) (-1441.140) * [-1432.163] (-1433.727) (-1432.426) (-1442.532) -- 0:00:50
      38500 -- (-1433.110) (-1443.437) [-1439.308] (-1442.255) * (-1432.763) (-1433.955) (-1431.480) [-1438.250] -- 0:00:49
      39000 -- [-1431.979] (-1442.090) (-1438.228) (-1441.664) * (-1433.656) (-1430.508) (-1431.434) [-1441.671] -- 0:01:13
      39500 -- (-1431.589) [-1435.619] (-1447.717) (-1438.666) * [-1431.929] (-1432.108) (-1430.418) (-1444.830) -- 0:01:12
      40000 -- (-1435.130) [-1442.788] (-1444.396) (-1433.005) * [-1431.657] (-1431.407) (-1432.609) (-1439.319) -- 0:01:12

      Average standard deviation of split frequencies: 0.035996

      40500 -- (-1433.528) [-1437.463] (-1448.981) (-1434.065) * (-1432.748) [-1433.457] (-1430.180) (-1449.243) -- 0:01:11
      41000 -- (-1431.944) (-1444.333) (-1445.140) [-1431.538] * (-1432.911) [-1431.347] (-1430.180) (-1438.806) -- 0:01:10
      41500 -- [-1432.169] (-1440.979) (-1444.503) (-1433.568) * (-1431.551) (-1431.767) (-1430.804) [-1435.699] -- 0:01:09
      42000 -- (-1432.074) [-1439.642] (-1444.977) (-1433.242) * (-1434.399) (-1431.609) (-1430.556) [-1439.552] -- 0:01:08
      42500 -- (-1434.414) (-1444.070) (-1446.359) [-1433.430] * (-1433.102) [-1432.264] (-1431.625) (-1441.893) -- 0:01:07
      43000 -- (-1432.682) (-1442.828) [-1442.348] (-1433.800) * [-1432.217] (-1434.085) (-1431.195) (-1440.304) -- 0:01:06
      43500 -- [-1432.074] (-1438.911) (-1446.217) (-1432.904) * (-1431.890) (-1434.473) (-1433.202) [-1448.888] -- 0:01:05
      44000 -- (-1434.058) (-1445.766) (-1441.649) [-1431.679] * [-1431.890] (-1432.786) (-1433.934) (-1443.594) -- 0:01:05
      44500 -- (-1436.471) (-1447.256) (-1441.668) [-1433.264] * (-1432.353) (-1433.470) [-1431.621] (-1443.607) -- 0:01:04
      45000 -- (-1431.470) (-1438.080) [-1450.476] (-1432.608) * (-1430.801) (-1433.317) [-1431.314] (-1439.833) -- 0:01:03

      Average standard deviation of split frequencies: 0.029719

      45500 -- [-1432.054] (-1438.073) (-1446.227) (-1430.605) * (-1431.135) (-1434.036) (-1431.280) [-1435.054] -- 0:01:02
      46000 -- (-1430.698) [-1443.435] (-1444.172) (-1433.684) * (-1432.548) [-1433.797] (-1430.151) (-1444.650) -- 0:01:02
      46500 -- [-1436.285] (-1449.130) (-1441.180) (-1434.372) * (-1432.087) (-1433.735) [-1431.950] (-1440.056) -- 0:01:01
      47000 -- [-1433.592] (-1443.087) (-1444.679) (-1436.641) * (-1432.080) (-1433.217) (-1432.012) [-1437.469] -- 0:01:00
      47500 -- (-1439.082) (-1439.529) [-1435.138] (-1436.684) * (-1433.472) (-1432.434) [-1431.940] (-1444.954) -- 0:01:00
      48000 -- (-1432.419) [-1437.701] (-1441.057) (-1435.214) * (-1432.491) (-1435.617) [-1432.424] (-1442.801) -- 0:00:59
      48500 -- (-1432.240) [-1438.947] (-1442.465) (-1436.707) * [-1432.773] (-1432.453) (-1431.466) (-1444.348) -- 0:00:58
      49000 -- [-1432.525] (-1436.664) (-1454.378) (-1434.175) * (-1432.743) (-1433.552) (-1432.363) [-1438.401] -- 0:00:58
      49500 -- (-1431.929) (-1443.338) [-1433.690] (-1433.898) * (-1432.745) (-1433.753) (-1433.540) [-1439.976] -- 0:00:57
      50000 -- (-1436.676) (-1445.080) [-1432.022] (-1432.649) * (-1431.220) (-1432.884) (-1431.373) [-1444.758] -- 0:00:57

      Average standard deviation of split frequencies: 0.030570

      50500 -- (-1435.047) (-1441.427) [-1431.666] (-1432.664) * (-1430.439) [-1430.342] (-1433.210) (-1441.601) -- 0:00:56
      51000 -- (-1433.510) (-1437.257) (-1433.175) [-1433.558] * (-1431.008) [-1432.601] (-1433.082) (-1438.455) -- 0:00:55
      51500 -- [-1432.090] (-1440.348) (-1435.572) (-1433.876) * (-1432.030) [-1430.920] (-1432.076) (-1443.102) -- 0:00:55
      52000 -- [-1432.547] (-1443.290) (-1435.413) (-1430.209) * (-1433.135) (-1433.474) [-1432.259] (-1436.655) -- 0:00:54
      52500 -- (-1430.101) (-1438.698) (-1431.896) [-1435.827] * (-1435.584) (-1431.448) [-1431.524] (-1439.802) -- 0:00:54
      53000 -- (-1430.102) (-1439.277) [-1432.811] (-1430.500) * (-1435.076) (-1431.365) [-1430.653] (-1442.992) -- 0:00:53
      53500 -- (-1431.153) (-1437.471) (-1433.876) [-1432.575] * (-1434.101) [-1431.262] (-1432.353) (-1443.770) -- 0:00:53
      54000 -- (-1430.616) (-1436.337) [-1430.916] (-1431.614) * (-1431.555) (-1431.315) [-1433.014] (-1438.956) -- 0:00:52
      54500 -- (-1430.620) [-1435.929] (-1430.733) (-1431.942) * [-1431.708] (-1431.346) (-1433.673) (-1435.851) -- 0:01:09
      55000 -- (-1430.584) (-1436.571) [-1430.575] (-1431.833) * (-1431.004) (-1434.152) (-1436.264) [-1438.563] -- 0:01:08

      Average standard deviation of split frequencies: 0.033251

      55500 -- [-1430.882] (-1446.302) (-1430.946) (-1433.107) * (-1431.104) [-1432.787] (-1431.926) (-1434.473) -- 0:01:08
      56000 -- (-1432.389) (-1442.443) (-1430.862) [-1430.742] * [-1430.572] (-1434.524) (-1430.475) (-1436.715) -- 0:01:07
      56500 -- (-1433.362) (-1443.285) [-1432.694] (-1431.584) * (-1431.265) (-1435.009) [-1433.472] (-1440.709) -- 0:01:06
      57000 -- (-1430.929) (-1442.692) (-1432.518) [-1432.268] * [-1433.433] (-1433.222) (-1431.615) (-1447.452) -- 0:01:06
      57500 -- (-1435.869) [-1439.950] (-1436.684) (-1429.971) * (-1432.942) [-1432.532] (-1434.106) (-1438.552) -- 0:01:05
      58000 -- (-1432.525) (-1439.795) (-1431.263) [-1429.877] * (-1432.391) (-1432.346) [-1436.258] (-1443.616) -- 0:01:04
      58500 -- (-1431.212) (-1446.455) [-1431.056] (-1433.368) * (-1431.684) [-1432.771] (-1432.485) (-1447.929) -- 0:01:04
      59000 -- (-1431.816) [-1440.823] (-1431.852) (-1438.510) * [-1431.519] (-1430.472) (-1433.277) (-1435.061) -- 0:01:03
      59500 -- (-1434.618) (-1436.845) (-1432.546) [-1435.228] * [-1432.124] (-1430.488) (-1433.970) (-1432.446) -- 0:01:03
      60000 -- (-1434.737) [-1437.736] (-1433.101) (-1434.888) * (-1433.214) (-1431.109) [-1432.436] (-1432.464) -- 0:01:02

      Average standard deviation of split frequencies: 0.037372

      60500 -- (-1434.764) [-1438.206] (-1434.019) (-1431.433) * (-1432.149) (-1431.907) (-1432.448) [-1431.191] -- 0:01:02
      61000 -- [-1431.162] (-1441.109) (-1433.359) (-1431.525) * (-1433.747) (-1433.953) [-1430.347] (-1431.455) -- 0:01:01
      61500 -- (-1430.599) [-1441.635] (-1431.808) (-1433.726) * [-1430.907] (-1431.497) (-1431.564) (-1433.031) -- 0:01:01
      62000 -- [-1434.385] (-1446.127) (-1433.889) (-1432.004) * (-1432.334) (-1431.253) [-1430.613] (-1439.020) -- 0:01:00
      62500 -- (-1430.804) (-1443.679) (-1431.609) [-1433.426] * [-1432.903] (-1430.755) (-1431.476) (-1432.440) -- 0:01:00
      63000 -- (-1432.081) (-1437.739) (-1431.642) [-1435.621] * [-1432.642] (-1430.393) (-1435.891) (-1434.373) -- 0:00:59
      63500 -- (-1431.933) [-1442.366] (-1431.642) (-1433.993) * [-1432.826] (-1430.383) (-1434.802) (-1431.557) -- 0:00:58
      64000 -- [-1431.999] (-1434.509) (-1432.988) (-1432.981) * [-1433.300] (-1432.452) (-1435.230) (-1431.513) -- 0:00:58
      64500 -- [-1430.944] (-1444.879) (-1430.437) (-1432.822) * (-1433.139) (-1433.678) [-1433.679] (-1431.142) -- 0:00:58
      65000 -- (-1433.311) (-1448.572) (-1431.136) [-1431.807] * [-1431.256] (-1432.011) (-1434.250) (-1434.256) -- 0:00:57

      Average standard deviation of split frequencies: 0.032466

      65500 -- (-1432.404) (-1446.568) [-1430.755] (-1430.332) * (-1433.090) (-1431.934) [-1431.589] (-1433.034) -- 0:00:57
      66000 -- (-1432.358) (-1451.064) [-1430.375] (-1431.044) * [-1431.866] (-1433.138) (-1432.961) (-1432.747) -- 0:00:56
      66500 -- [-1435.967] (-1446.043) (-1436.198) (-1433.063) * [-1431.679] (-1431.345) (-1434.839) (-1431.062) -- 0:00:56
      67000 -- [-1430.324] (-1443.115) (-1435.312) (-1435.017) * [-1431.010] (-1431.373) (-1434.989) (-1434.104) -- 0:00:55
      67500 -- (-1430.754) [-1444.238] (-1432.473) (-1435.578) * (-1434.602) [-1431.384] (-1432.673) (-1431.166) -- 0:00:55
      68000 -- [-1430.641] (-1441.904) (-1431.608) (-1436.125) * (-1436.746) (-1430.433) (-1432.495) [-1431.003] -- 0:00:54
      68500 -- (-1430.911) (-1444.363) (-1433.054) [-1430.646] * [-1435.782] (-1434.244) (-1434.321) (-1431.429) -- 0:00:54
      69000 -- [-1435.100] (-1450.808) (-1434.539) (-1432.421) * (-1431.141) (-1432.916) [-1435.634] (-1431.640) -- 0:00:53
      69500 -- (-1431.666) [-1439.416] (-1430.922) (-1432.721) * (-1431.481) (-1431.150) (-1432.194) [-1431.203] -- 0:00:53
      70000 -- (-1432.433) (-1445.630) [-1430.590] (-1436.832) * [-1431.868] (-1431.600) (-1432.599) (-1431.880) -- 0:00:53

      Average standard deviation of split frequencies: 0.029109

      70500 -- (-1434.133) [-1447.825] (-1432.139) (-1430.999) * [-1432.521] (-1432.324) (-1430.489) (-1433.097) -- 0:01:05
      71000 -- (-1435.822) (-1438.459) [-1431.701] (-1434.252) * [-1432.267] (-1430.873) (-1431.446) (-1430.873) -- 0:01:05
      71500 -- (-1431.207) (-1440.922) [-1432.177] (-1432.064) * (-1435.719) (-1431.742) [-1432.834] (-1431.244) -- 0:01:04
      72000 -- [-1432.096] (-1438.397) (-1433.403) (-1431.983) * [-1430.960] (-1431.416) (-1431.039) (-1436.728) -- 0:01:04
      72500 -- (-1434.242) (-1440.090) [-1434.672] (-1431.983) * (-1431.023) [-1433.159] (-1433.190) (-1437.335) -- 0:01:03
      73000 -- (-1433.364) (-1442.660) [-1436.421] (-1435.338) * (-1431.279) (-1435.550) [-1431.728] (-1434.592) -- 0:01:03
      73500 -- (-1430.934) (-1437.785) (-1436.808) [-1434.398] * (-1431.871) [-1436.196] (-1436.041) (-1430.873) -- 0:01:03
      74000 -- (-1431.560) (-1434.099) [-1434.606] (-1430.251) * (-1431.973) [-1435.204] (-1435.217) (-1430.716) -- 0:01:02
      74500 -- (-1430.487) (-1433.557) [-1432.702] (-1432.284) * (-1432.765) (-1437.676) (-1434.555) [-1432.806] -- 0:01:02
      75000 -- (-1431.655) (-1437.485) [-1434.295] (-1434.109) * [-1431.824] (-1433.744) (-1433.253) (-1431.686) -- 0:01:01

      Average standard deviation of split frequencies: 0.027348

      75500 -- (-1433.085) [-1434.246] (-1436.671) (-1431.967) * (-1432.266) (-1431.941) (-1432.997) [-1430.329] -- 0:01:01
      76000 -- [-1431.101] (-1432.288) (-1433.932) (-1431.574) * (-1431.302) (-1431.187) [-1432.908] (-1431.058) -- 0:01:00
      76500 -- (-1429.869) [-1432.715] (-1431.309) (-1430.792) * (-1432.004) (-1430.391) [-1432.383] (-1432.364) -- 0:01:00
      77000 -- (-1429.869) (-1432.376) (-1431.344) [-1431.215] * (-1432.427) [-1430.810] (-1435.599) (-1435.000) -- 0:00:59
      77500 -- (-1431.074) (-1431.669) [-1431.548] (-1434.422) * (-1433.272) (-1430.731) (-1430.169) [-1430.327] -- 0:00:59
      78000 -- (-1432.775) (-1431.712) [-1433.658] (-1434.303) * (-1432.368) (-1430.835) (-1430.574) [-1430.809] -- 0:00:59
      78500 -- (-1430.143) [-1433.184] (-1430.753) (-1431.786) * (-1431.975) (-1431.530) (-1431.934) [-1431.592] -- 0:00:58
      79000 -- [-1430.896] (-1433.487) (-1430.596) (-1431.186) * [-1432.135] (-1433.306) (-1432.348) (-1431.758) -- 0:00:58
      79500 -- (-1430.472) [-1433.452] (-1431.664) (-1431.535) * (-1431.700) (-1431.517) [-1432.345] (-1437.045) -- 0:00:57
      80000 -- (-1431.541) [-1430.139] (-1436.176) (-1433.775) * (-1436.333) (-1432.080) (-1431.454) [-1437.366] -- 0:00:57

      Average standard deviation of split frequencies: 0.026144

      80500 -- (-1431.555) [-1430.213] (-1436.440) (-1434.572) * (-1431.870) (-1431.181) [-1431.096] (-1433.448) -- 0:00:57
      81000 -- (-1435.937) [-1430.215] (-1431.396) (-1431.118) * [-1430.737] (-1431.197) (-1434.482) (-1433.147) -- 0:00:56
      81500 -- (-1433.544) (-1430.378) (-1434.906) [-1431.321] * (-1434.043) (-1431.751) (-1435.069) [-1433.816] -- 0:00:56
      82000 -- (-1431.634) (-1431.385) (-1435.952) [-1430.951] * [-1431.475] (-1431.335) (-1433.524) (-1430.482) -- 0:00:55
      82500 -- (-1430.731) (-1431.984) [-1432.853] (-1432.698) * (-1430.608) (-1432.653) [-1432.224] (-1430.482) -- 0:00:55
      83000 -- [-1430.893] (-1431.942) (-1431.170) (-1432.791) * (-1431.964) (-1431.831) (-1432.493) [-1431.337] -- 0:00:55
      83500 -- (-1431.033) (-1431.492) (-1431.168) [-1431.081] * (-1433.446) (-1431.831) [-1432.347] (-1431.539) -- 0:00:54
      84000 -- [-1430.633] (-1432.941) (-1432.099) (-1431.037) * (-1432.590) [-1431.827] (-1433.361) (-1431.539) -- 0:00:54
      84500 -- (-1432.354) [-1433.688] (-1432.216) (-1434.822) * (-1432.590) (-1431.621) [-1433.796] (-1431.818) -- 0:00:54
      85000 -- (-1440.288) (-1436.887) (-1433.734) [-1432.320] * (-1431.092) (-1432.531) [-1434.480] (-1430.974) -- 0:00:53

      Average standard deviation of split frequencies: 0.025501

      85500 -- (-1434.124) (-1432.243) [-1433.258] (-1432.032) * (-1430.184) (-1433.070) [-1436.397] (-1430.958) -- 0:00:53
      86000 -- (-1431.353) (-1433.440) (-1432.728) [-1432.231] * (-1430.184) (-1432.128) (-1433.404) [-1430.419] -- 0:00:53
      86500 -- (-1430.985) [-1433.136] (-1436.095) (-1432.924) * (-1432.690) (-1432.411) [-1433.551] (-1431.097) -- 0:01:03
      87000 -- [-1431.819] (-1431.505) (-1434.070) (-1432.696) * (-1432.353) [-1432.284] (-1431.733) (-1430.509) -- 0:01:02
      87500 -- (-1434.138) (-1432.522) [-1432.181] (-1436.203) * (-1431.659) (-1430.860) (-1431.807) [-1433.261] -- 0:01:02
      88000 -- (-1431.719) (-1432.739) [-1433.446] (-1434.660) * (-1432.651) (-1431.280) (-1437.283) [-1432.846] -- 0:01:02
      88500 -- (-1433.012) [-1432.155] (-1433.930) (-1434.687) * (-1431.322) (-1434.818) (-1435.638) [-1433.437] -- 0:01:01
      89000 -- [-1432.247] (-1432.593) (-1431.607) (-1431.577) * (-1433.572) (-1431.640) (-1433.628) [-1431.889] -- 0:01:01
      89500 -- [-1432.378] (-1432.864) (-1432.416) (-1434.577) * (-1433.322) (-1432.313) (-1432.450) [-1435.155] -- 0:01:01
      90000 -- [-1432.987] (-1431.025) (-1432.176) (-1433.345) * [-1430.722] (-1434.969) (-1433.993) (-1436.032) -- 0:01:00

      Average standard deviation of split frequencies: 0.022035

      90500 -- (-1431.858) (-1430.736) [-1431.692] (-1431.544) * (-1432.381) (-1432.130) (-1432.826) [-1429.977] -- 0:01:00
      91000 -- (-1434.178) (-1432.162) [-1431.651] (-1431.065) * (-1434.074) [-1432.076] (-1432.374) (-1434.561) -- 0:00:59
      91500 -- [-1430.374] (-1430.491) (-1430.158) (-1430.845) * (-1432.556) (-1431.988) [-1431.418] (-1436.704) -- 0:00:59
      92000 -- [-1430.732] (-1431.927) (-1430.601) (-1432.246) * (-1433.922) [-1433.571] (-1431.035) (-1434.028) -- 0:00:59
      92500 -- [-1434.495] (-1430.225) (-1433.001) (-1431.862) * (-1432.528) (-1436.141) (-1435.640) [-1431.683] -- 0:00:58
      93000 -- (-1430.028) (-1432.395) (-1433.411) [-1430.384] * (-1432.688) [-1430.413] (-1431.756) (-1430.721) -- 0:00:58
      93500 -- (-1430.940) (-1431.838) (-1433.535) [-1436.627] * [-1432.442] (-1431.392) (-1430.786) (-1431.648) -- 0:00:58
      94000 -- [-1432.886] (-1430.708) (-1433.402) (-1430.716) * (-1433.106) (-1433.874) (-1430.702) [-1431.614] -- 0:00:57
      94500 -- [-1432.035] (-1434.234) (-1433.551) (-1433.346) * (-1431.881) (-1431.034) (-1433.689) [-1430.451] -- 0:00:57
      95000 -- (-1431.669) (-1430.298) [-1432.724] (-1434.195) * (-1431.974) [-1432.061] (-1433.671) (-1434.752) -- 0:00:57

      Average standard deviation of split frequencies: 0.021606

      95500 -- (-1433.271) [-1432.192] (-1433.003) (-1434.781) * [-1432.547] (-1432.977) (-1431.407) (-1433.133) -- 0:00:56
      96000 -- [-1431.142] (-1431.252) (-1431.923) (-1431.228) * [-1431.375] (-1431.662) (-1432.077) (-1430.902) -- 0:00:56
      96500 -- (-1431.174) (-1430.397) (-1431.821) [-1434.078] * (-1437.777) [-1430.703] (-1432.259) (-1432.533) -- 0:00:56
      97000 -- (-1431.136) [-1430.395] (-1431.201) (-1432.915) * (-1434.328) [-1432.532] (-1434.008) (-1431.552) -- 0:00:55
      97500 -- (-1430.332) [-1430.461] (-1430.873) (-1432.857) * (-1435.442) [-1433.464] (-1433.761) (-1431.569) -- 0:00:55
      98000 -- (-1430.943) [-1430.487] (-1430.143) (-1434.392) * (-1432.133) (-1431.158) [-1431.936] (-1431.563) -- 0:00:55
      98500 -- (-1429.911) (-1430.637) [-1430.121] (-1434.465) * (-1432.802) (-1431.106) [-1434.406] (-1434.520) -- 0:00:54
      99000 -- (-1432.502) [-1430.637] (-1435.331) (-1432.951) * (-1432.932) (-1431.752) (-1434.136) [-1431.532] -- 0:00:54
      99500 -- (-1430.066) (-1431.112) (-1434.749) [-1431.518] * (-1432.935) (-1432.595) (-1434.086) [-1432.077] -- 0:00:54
      100000 -- (-1431.643) (-1430.703) [-1435.275] (-1434.533) * [-1431.597] (-1433.072) (-1432.429) (-1433.855) -- 0:00:54

      Average standard deviation of split frequencies: 0.023882

      100500 -- (-1431.921) (-1430.768) (-1431.897) [-1433.747] * (-1431.601) (-1432.410) (-1432.487) [-1432.896] -- 0:00:53
      101000 -- (-1432.884) [-1434.499] (-1437.073) (-1433.968) * (-1430.463) [-1432.110] (-1433.304) (-1434.202) -- 0:00:53
      101500 -- (-1430.209) [-1430.662] (-1434.303) (-1433.572) * (-1431.686) (-1433.089) [-1432.790] (-1430.559) -- 0:00:53
      102000 -- (-1431.062) [-1430.735] (-1433.823) (-1431.871) * (-1432.177) (-1432.562) [-1433.526] (-1431.585) -- 0:01:01
      102500 -- (-1430.362) (-1430.260) (-1432.295) [-1432.493] * (-1432.050) [-1434.335] (-1434.388) (-1431.190) -- 0:01:01
      103000 -- (-1431.704) (-1433.117) [-1434.678] (-1433.753) * [-1431.111] (-1430.695) (-1432.222) (-1431.457) -- 0:01:00
      103500 -- (-1433.019) (-1431.049) (-1432.973) [-1430.553] * [-1432.936] (-1433.390) (-1431.939) (-1434.589) -- 0:01:00
      104000 -- (-1432.406) (-1431.923) [-1431.849] (-1431.153) * [-1435.934] (-1431.278) (-1430.674) (-1434.437) -- 0:01:00
      104500 -- (-1431.713) (-1430.634) (-1434.935) [-1431.717] * (-1432.491) (-1430.573) (-1430.877) [-1430.946] -- 0:00:59
      105000 -- (-1431.402) (-1431.243) [-1433.381] (-1430.910) * (-1435.495) [-1431.968] (-1430.652) (-1430.402) -- 0:00:59

      Average standard deviation of split frequencies: 0.021347

      105500 -- (-1430.783) (-1430.006) (-1433.310) [-1430.852] * [-1437.100] (-1431.677) (-1433.091) (-1432.812) -- 0:00:59
      106000 -- (-1431.749) (-1431.953) (-1433.613) [-1431.221] * (-1432.188) [-1429.961] (-1431.649) (-1432.241) -- 0:00:59
      106500 -- (-1431.228) (-1432.297) [-1435.726] (-1432.547) * (-1435.716) [-1430.745] (-1431.649) (-1432.988) -- 0:00:58
      107000 -- (-1431.522) (-1436.065) (-1433.056) [-1433.375] * (-1433.043) (-1430.278) (-1430.829) [-1431.703] -- 0:00:58
      107500 -- (-1435.038) (-1443.081) (-1431.207) [-1432.652] * [-1433.596] (-1433.551) (-1430.386) (-1433.024) -- 0:00:58
      108000 -- (-1431.713) (-1444.908) (-1429.974) [-1431.294] * (-1434.346) (-1432.530) (-1430.407) [-1430.995] -- 0:00:57
      108500 -- (-1431.650) (-1433.156) (-1430.000) [-1430.143] * (-1438.375) (-1433.584) (-1431.883) [-1431.894] -- 0:00:57
      109000 -- (-1431.123) (-1438.752) [-1429.990] (-1433.533) * (-1432.335) (-1433.406) [-1433.901] (-1430.667) -- 0:00:57
      109500 -- [-1431.124] (-1432.632) (-1432.978) (-1433.077) * (-1433.843) (-1431.099) (-1430.050) [-1431.122] -- 0:00:56
      110000 -- [-1432.739] (-1437.913) (-1433.917) (-1433.160) * (-1434.070) (-1438.154) [-1430.050] (-1430.874) -- 0:00:56

      Average standard deviation of split frequencies: 0.019676

      110500 -- (-1430.130) (-1435.151) (-1432.220) [-1431.576] * [-1434.595] (-1439.015) (-1430.661) (-1431.327) -- 0:00:56
      111000 -- (-1430.133) (-1436.330) [-1431.035] (-1431.373) * [-1431.689] (-1435.215) (-1431.468) (-1429.961) -- 0:00:56
      111500 -- (-1431.777) (-1432.754) (-1432.145) [-1431.889] * [-1433.144] (-1435.165) (-1431.682) (-1430.179) -- 0:00:55
      112000 -- (-1430.730) (-1430.868) [-1432.919] (-1435.421) * (-1434.220) (-1436.542) [-1432.055] (-1430.543) -- 0:00:55
      112500 -- (-1431.501) (-1431.536) [-1431.502] (-1431.039) * (-1433.564) [-1436.895] (-1430.607) (-1430.633) -- 0:00:55
      113000 -- (-1435.978) [-1432.608] (-1430.602) (-1430.758) * (-1432.946) [-1435.219] (-1430.567) (-1432.736) -- 0:00:54
      113500 -- (-1432.587) [-1432.142] (-1430.886) (-1431.946) * (-1432.546) (-1437.588) [-1431.920] (-1433.465) -- 0:00:54
      114000 -- (-1430.534) (-1433.972) (-1431.101) [-1434.775] * (-1433.214) (-1440.630) (-1432.546) [-1431.990] -- 0:00:54
      114500 -- [-1430.532] (-1431.857) (-1432.473) (-1431.952) * (-1433.113) (-1432.805) (-1433.173) [-1433.193] -- 0:00:54
      115000 -- (-1432.183) (-1434.536) [-1433.222] (-1436.905) * (-1432.678) [-1435.527] (-1434.707) (-1434.540) -- 0:00:53

      Average standard deviation of split frequencies: 0.022448

      115500 -- [-1431.168] (-1434.388) (-1431.465) (-1434.409) * (-1433.093) (-1432.704) (-1433.763) [-1434.053] -- 0:00:53
      116000 -- (-1431.168) [-1434.632] (-1431.724) (-1433.813) * [-1433.663] (-1432.287) (-1437.016) (-1432.536) -- 0:00:53
      116500 -- [-1430.669] (-1432.527) (-1431.684) (-1431.841) * (-1431.677) [-1430.642] (-1435.945) (-1431.117) -- 0:00:53
      117000 -- (-1429.900) (-1430.340) (-1434.139) [-1433.033] * (-1433.199) (-1430.834) [-1432.232] (-1431.125) -- 0:00:52
      117500 -- (-1430.931) [-1430.688] (-1434.109) (-1431.878) * (-1433.669) (-1432.979) [-1432.402] (-1432.725) -- 0:00:52
      118000 -- [-1432.379] (-1430.001) (-1435.882) (-1434.584) * (-1432.425) [-1430.941] (-1435.163) (-1431.171) -- 0:00:59
      118500 -- (-1431.134) (-1430.635) (-1433.460) [-1434.548] * (-1432.058) [-1431.238] (-1433.919) (-1433.223) -- 0:00:59
      119000 -- (-1431.153) (-1430.477) (-1433.059) [-1430.804] * (-1430.162) [-1431.248] (-1431.820) (-1433.482) -- 0:00:59
      119500 -- (-1430.669) [-1430.202] (-1435.126) (-1435.314) * [-1432.660] (-1431.475) (-1436.697) (-1433.854) -- 0:00:58
      120000 -- (-1430.862) [-1431.852] (-1433.721) (-1431.554) * (-1430.540) [-1431.307] (-1439.365) (-1434.283) -- 0:00:58

      Average standard deviation of split frequencies: 0.021394

      120500 -- (-1430.430) (-1434.237) (-1434.842) [-1431.260] * (-1430.651) (-1430.980) (-1433.761) [-1432.305] -- 0:00:58
      121000 -- (-1432.421) (-1434.083) (-1432.501) [-1436.102] * (-1433.534) (-1434.349) [-1431.543] (-1432.655) -- 0:00:58
      121500 -- (-1431.174) (-1431.379) (-1432.739) [-1432.144] * [-1432.938] (-1435.079) (-1431.075) (-1434.303) -- 0:00:57
      122000 -- (-1434.032) (-1431.811) [-1432.223] (-1434.852) * [-1430.558] (-1435.673) (-1433.865) (-1433.150) -- 0:00:57
      122500 -- [-1434.601] (-1431.744) (-1432.236) (-1436.252) * (-1432.896) (-1434.440) (-1436.376) [-1432.316] -- 0:00:57
      123000 -- (-1435.690) (-1432.430) [-1436.004] (-1434.458) * (-1435.502) (-1431.285) (-1435.442) [-1431.152] -- 0:00:57
      123500 -- (-1435.696) [-1431.327] (-1434.932) (-1433.325) * (-1434.968) (-1436.155) (-1433.421) [-1431.813] -- 0:00:56
      124000 -- (-1435.514) (-1432.443) (-1430.764) [-1432.353] * (-1432.480) (-1431.169) [-1432.119] (-1436.128) -- 0:00:56
      124500 -- (-1436.324) (-1431.777) (-1437.238) [-1430.550] * (-1430.824) [-1431.746] (-1432.120) (-1432.679) -- 0:00:56
      125000 -- (-1432.607) (-1432.016) (-1430.281) [-1431.013] * (-1430.004) (-1431.743) [-1434.043] (-1431.457) -- 0:00:56

      Average standard deviation of split frequencies: 0.021023

      125500 -- (-1433.608) (-1430.887) [-1430.289] (-1437.509) * [-1434.283] (-1432.299) (-1433.351) (-1433.323) -- 0:00:55
      126000 -- (-1434.744) [-1429.875] (-1431.472) (-1432.349) * (-1432.960) (-1434.313) (-1430.107) [-1432.842] -- 0:00:55
      126500 -- (-1437.181) (-1429.868) [-1432.578] (-1433.340) * (-1434.190) [-1430.799] (-1430.121) (-1431.322) -- 0:00:55
      127000 -- (-1434.282) (-1434.908) (-1430.792) [-1431.622] * (-1436.582) (-1432.261) (-1432.596) [-1431.221] -- 0:00:54
      127500 -- [-1432.653] (-1435.378) (-1430.767) (-1433.015) * (-1431.789) [-1430.425] (-1432.689) (-1431.887) -- 0:00:54
      128000 -- (-1431.563) (-1432.372) (-1431.760) [-1431.303] * (-1432.119) [-1431.591] (-1432.994) (-1431.995) -- 0:00:54
      128500 -- (-1431.396) [-1433.639] (-1430.240) (-1431.576) * (-1431.197) (-1433.138) (-1434.667) [-1432.169] -- 0:00:54
      129000 -- [-1430.762] (-1433.884) (-1432.195) (-1431.378) * (-1432.197) (-1436.158) (-1434.823) [-1430.784] -- 0:00:54
      129500 -- (-1432.334) (-1432.344) (-1431.229) [-1430.535] * (-1432.262) [-1434.954] (-1434.119) (-1430.979) -- 0:00:53
      130000 -- (-1432.349) [-1431.460] (-1431.229) (-1430.457) * (-1439.372) [-1433.711] (-1431.974) (-1434.100) -- 0:00:53

      Average standard deviation of split frequencies: 0.022548

      130500 -- (-1430.251) [-1432.154] (-1431.033) (-1430.860) * (-1438.404) (-1433.557) (-1434.683) [-1431.714] -- 0:00:53
      131000 -- (-1430.511) (-1433.626) (-1431.636) [-1430.488] * (-1434.229) [-1431.638] (-1430.893) (-1430.625) -- 0:00:53
      131500 -- (-1433.032) (-1430.393) (-1432.385) [-1431.572] * (-1431.290) (-1434.386) [-1430.639] (-1434.579) -- 0:00:52
      132000 -- (-1431.906) [-1433.760] (-1434.774) (-1432.196) * (-1433.143) [-1431.966] (-1430.905) (-1432.177) -- 0:00:52
      132500 -- (-1430.153) [-1435.631] (-1435.296) (-1434.899) * (-1431.345) (-1433.748) (-1433.301) [-1432.394] -- 0:00:52
      133000 -- (-1432.967) (-1433.358) (-1431.402) [-1434.102] * [-1431.343] (-1432.161) (-1434.138) (-1433.407) -- 0:00:52
      133500 -- (-1433.615) (-1431.085) (-1431.402) [-1433.279] * [-1431.674] (-1430.827) (-1430.791) (-1434.236) -- 0:00:51
      134000 -- (-1433.615) (-1434.128) (-1435.098) [-1433.544] * [-1430.661] (-1430.828) (-1431.334) (-1433.386) -- 0:00:58
      134500 -- (-1435.045) (-1433.067) [-1432.558] (-1437.111) * (-1432.103) (-1431.461) [-1431.682] (-1432.962) -- 0:00:57
      135000 -- (-1434.101) [-1431.716] (-1430.717) (-1431.769) * (-1432.440) (-1430.514) [-1432.045] (-1433.625) -- 0:00:57

      Average standard deviation of split frequencies: 0.020615

      135500 -- (-1434.670) (-1430.870) (-1430.899) [-1432.621] * (-1430.172) [-1430.106] (-1430.156) (-1429.961) -- 0:00:57
      136000 -- (-1433.107) (-1433.433) (-1430.401) [-1431.595] * (-1431.387) [-1430.113] (-1432.780) (-1430.267) -- 0:00:57
      136500 -- (-1432.688) (-1432.971) (-1430.283) [-1430.872] * (-1432.074) [-1430.411] (-1432.622) (-1430.638) -- 0:00:56
      137000 -- (-1430.489) (-1435.504) (-1434.806) [-1434.147] * [-1433.120] (-1435.149) (-1430.501) (-1432.129) -- 0:00:56
      137500 -- (-1430.376) [-1430.803] (-1432.854) (-1431.465) * [-1431.791] (-1431.474) (-1430.216) (-1432.206) -- 0:00:56
      138000 -- [-1433.268] (-1431.627) (-1434.215) (-1435.734) * (-1431.756) [-1430.398] (-1431.871) (-1430.662) -- 0:00:56
      138500 -- (-1432.602) (-1435.806) (-1436.197) [-1433.203] * (-1437.484) (-1430.150) (-1431.854) [-1432.667] -- 0:00:55
      139000 -- (-1432.554) [-1434.170] (-1435.357) (-1431.969) * (-1439.853) [-1430.147] (-1431.619) (-1430.480) -- 0:00:55
      139500 -- (-1431.285) (-1434.185) (-1430.659) [-1433.609] * (-1435.233) (-1430.151) (-1431.195) [-1430.890] -- 0:00:55
      140000 -- (-1431.763) [-1432.290] (-1433.575) (-1435.542) * (-1437.124) (-1430.050) (-1431.675) [-1431.168] -- 0:00:55

      Average standard deviation of split frequencies: 0.018990

      140500 -- [-1431.745] (-1435.205) (-1431.548) (-1432.584) * (-1437.368) (-1430.864) (-1430.965) [-1431.388] -- 0:00:55
      141000 -- (-1434.076) (-1432.626) [-1432.048] (-1432.731) * (-1433.944) (-1432.305) (-1433.499) [-1434.879] -- 0:00:54
      141500 -- (-1433.671) (-1431.255) [-1432.437] (-1432.524) * (-1434.471) [-1436.641] (-1433.069) (-1432.103) -- 0:00:54
      142000 -- [-1431.553] (-1432.069) (-1435.271) (-1433.104) * (-1434.471) [-1430.129] (-1433.191) (-1433.465) -- 0:00:54
      142500 -- [-1432.736] (-1431.921) (-1431.319) (-1432.160) * (-1432.845) [-1431.548] (-1434.663) (-1430.761) -- 0:00:54
      143000 -- (-1433.080) (-1432.348) [-1431.302] (-1431.901) * (-1430.353) (-1432.329) (-1435.595) [-1430.819] -- 0:00:53
      143500 -- (-1432.822) (-1432.737) [-1434.488] (-1430.584) * (-1430.394) (-1434.161) (-1430.776) [-1430.584] -- 0:00:53
      144000 -- (-1432.926) (-1431.797) (-1430.706) [-1430.275] * [-1430.276] (-1435.566) (-1430.540) (-1434.810) -- 0:00:53
      144500 -- (-1431.381) (-1432.841) (-1431.113) [-1430.513] * (-1430.385) (-1435.018) (-1430.347) [-1432.819] -- 0:00:53
      145000 -- (-1433.088) (-1434.069) [-1432.568] (-1432.546) * (-1434.740) (-1431.939) (-1432.577) [-1435.371] -- 0:00:53

      Average standard deviation of split frequencies: 0.017758

      145500 -- (-1432.970) (-1431.573) [-1431.271] (-1430.355) * (-1434.875) (-1431.206) [-1431.326] (-1432.871) -- 0:00:52
      146000 -- [-1431.246] (-1432.117) (-1432.023) (-1435.119) * (-1434.082) (-1432.633) (-1430.288) [-1435.419] -- 0:00:52
      146500 -- [-1431.210] (-1430.804) (-1432.078) (-1433.169) * (-1434.277) (-1432.003) [-1431.464] (-1431.196) -- 0:00:52
      147000 -- (-1431.762) [-1431.142] (-1432.508) (-1434.184) * (-1430.811) (-1435.237) (-1430.826) [-1430.972] -- 0:00:52
      147500 -- (-1433.880) (-1431.094) [-1431.422] (-1430.645) * (-1431.866) (-1433.528) (-1430.304) [-1432.045] -- 0:00:52
      148000 -- (-1435.305) (-1433.063) (-1432.435) [-1430.428] * (-1432.252) [-1431.954] (-1430.272) (-1432.250) -- 0:00:51
      148500 -- (-1431.401) (-1431.329) (-1430.655) [-1430.743] * (-1432.656) (-1432.639) [-1430.303] (-1432.771) -- 0:00:51
      149000 -- (-1434.626) (-1431.439) (-1431.902) [-1435.145] * (-1437.445) (-1432.132) [-1430.540] (-1436.553) -- 0:00:51
      149500 -- (-1431.477) [-1433.508] (-1432.004) (-1430.798) * (-1434.757) [-1430.035] (-1430.069) (-1434.530) -- 0:00:51
      150000 -- [-1431.163] (-1434.275) (-1432.022) (-1431.237) * (-1433.837) (-1430.848) [-1433.442] (-1431.572) -- 0:00:56

      Average standard deviation of split frequencies: 0.018773

      150500 -- [-1430.701] (-1433.027) (-1438.977) (-1432.208) * (-1434.411) (-1431.154) (-1432.350) [-1434.045] -- 0:00:56
      151000 -- [-1430.787] (-1434.899) (-1433.764) (-1433.144) * (-1435.627) [-1431.433] (-1433.073) (-1432.256) -- 0:00:56
      151500 -- (-1430.804) [-1432.506] (-1434.799) (-1433.842) * (-1433.634) [-1432.860] (-1432.187) (-1431.414) -- 0:00:56
      152000 -- (-1432.797) (-1430.397) (-1436.400) [-1432.276] * (-1434.133) [-1430.170] (-1431.245) (-1433.088) -- 0:00:55
      152500 -- (-1430.974) (-1434.047) (-1432.414) [-1431.908] * (-1434.068) [-1430.210] (-1433.802) (-1431.495) -- 0:00:55
      153000 -- [-1431.730] (-1433.486) (-1430.855) (-1432.428) * (-1437.026) [-1430.992] (-1437.558) (-1430.672) -- 0:00:55
      153500 -- (-1430.943) [-1430.103] (-1431.512) (-1435.095) * (-1435.527) (-1431.332) [-1430.752] (-1432.622) -- 0:00:55
      154000 -- [-1431.851] (-1431.415) (-1434.201) (-1435.388) * (-1430.449) (-1434.828) (-1430.719) [-1431.509] -- 0:00:54
      154500 -- [-1431.525] (-1434.029) (-1431.945) (-1435.153) * (-1430.435) (-1434.526) [-1432.853] (-1431.428) -- 0:00:54
      155000 -- (-1432.522) [-1431.157] (-1431.007) (-1430.755) * [-1430.926] (-1431.993) (-1434.974) (-1432.683) -- 0:00:54

      Average standard deviation of split frequencies: 0.016260

      155500 -- (-1431.748) [-1431.157] (-1430.512) (-1430.952) * (-1430.948) (-1431.178) (-1431.621) [-1432.737] -- 0:00:54
      156000 -- (-1433.661) [-1432.798] (-1430.508) (-1432.905) * (-1433.602) (-1438.304) [-1432.874] (-1434.502) -- 0:00:54
      156500 -- (-1432.524) (-1434.226) (-1430.462) [-1430.830] * (-1430.677) (-1431.492) (-1432.473) [-1430.407] -- 0:00:53
      157000 -- (-1432.480) (-1430.362) (-1430.988) [-1433.516] * (-1438.233) [-1430.428] (-1433.203) (-1431.331) -- 0:00:53
      157500 -- [-1430.895] (-1430.387) (-1433.876) (-1432.284) * (-1432.331) (-1432.410) (-1434.071) [-1431.517] -- 0:00:53
      158000 -- (-1434.535) (-1430.911) (-1434.772) [-1430.833] * (-1433.361) [-1430.465] (-1434.308) (-1431.297) -- 0:00:53
      158500 -- (-1432.924) (-1432.212) (-1430.471) [-1430.846] * (-1430.808) (-1431.023) (-1434.237) [-1431.944] -- 0:00:53
      159000 -- (-1430.508) [-1432.448] (-1430.681) (-1433.072) * (-1430.058) (-1431.805) (-1431.884) [-1430.590] -- 0:00:52
      159500 -- (-1434.520) (-1437.404) (-1436.594) [-1437.230] * (-1433.445) (-1432.970) (-1430.379) [-1432.938] -- 0:00:52
      160000 -- (-1435.747) (-1434.361) [-1435.778] (-1432.168) * (-1431.033) [-1430.968] (-1431.419) (-1434.072) -- 0:00:52

      Average standard deviation of split frequencies: 0.015509

      160500 -- (-1439.129) (-1433.013) [-1435.916] (-1432.010) * (-1432.241) (-1433.731) (-1430.870) [-1436.067] -- 0:00:52
      161000 -- (-1431.728) (-1432.309) (-1432.005) [-1431.405] * (-1430.634) [-1432.545] (-1431.675) (-1438.903) -- 0:00:52
      161500 -- [-1431.709] (-1432.514) (-1432.210) (-1430.785) * [-1430.596] (-1431.608) (-1432.497) (-1431.323) -- 0:00:51
      162000 -- (-1431.740) [-1437.810] (-1431.819) (-1430.368) * (-1432.519) (-1431.349) [-1432.644] (-1431.239) -- 0:00:51
      162500 -- (-1433.838) [-1435.134] (-1434.140) (-1433.754) * (-1433.575) (-1432.402) [-1430.762] (-1432.397) -- 0:00:51
      163000 -- (-1431.090) [-1433.732] (-1431.894) (-1431.957) * (-1433.736) (-1432.048) (-1432.327) [-1430.703] -- 0:00:51
      163500 -- (-1434.202) [-1433.492] (-1434.531) (-1433.784) * (-1433.716) (-1435.354) (-1432.761) [-1431.519] -- 0:00:51
      164000 -- [-1432.097] (-1438.316) (-1432.841) (-1432.685) * (-1433.464) (-1433.439) (-1433.002) [-1430.704] -- 0:00:50
      164500 -- (-1431.787) (-1434.506) (-1434.589) [-1431.145] * (-1430.311) [-1435.691] (-1430.863) (-1429.908) -- 0:00:50
      165000 -- (-1432.473) (-1432.387) [-1434.742] (-1434.294) * (-1431.564) (-1432.284) (-1433.286) [-1430.178] -- 0:00:50

      Average standard deviation of split frequencies: 0.018391

      165500 -- (-1432.609) [-1430.936] (-1431.937) (-1431.995) * [-1431.407] (-1434.134) (-1431.686) (-1430.168) -- 0:00:50
      166000 -- (-1433.764) (-1430.761) (-1432.912) [-1431.566] * (-1432.527) [-1431.857] (-1431.353) (-1430.275) -- 0:00:55
      166500 -- (-1431.859) [-1432.319] (-1430.353) (-1435.247) * (-1431.811) [-1430.650] (-1431.029) (-1431.125) -- 0:00:55
      167000 -- [-1430.353] (-1431.264) (-1430.596) (-1435.247) * [-1430.868] (-1431.235) (-1431.554) (-1433.733) -- 0:00:54
      167500 -- [-1432.110] (-1437.271) (-1431.043) (-1430.952) * (-1430.524) (-1432.389) [-1434.894] (-1432.637) -- 0:00:54
      168000 -- (-1431.498) (-1430.296) (-1433.323) [-1431.278] * [-1430.706] (-1431.459) (-1434.896) (-1432.076) -- 0:00:54
      168500 -- (-1431.488) (-1434.423) [-1433.410] (-1432.221) * [-1432.350] (-1434.834) (-1435.618) (-1433.218) -- 0:00:54
      169000 -- [-1435.330] (-1436.367) (-1431.341) (-1431.079) * (-1434.252) [-1434.922] (-1433.212) (-1430.107) -- 0:00:54
      169500 -- (-1431.203) [-1432.523] (-1431.238) (-1431.199) * (-1430.719) (-1431.903) [-1435.315] (-1430.366) -- 0:00:53
      170000 -- (-1431.806) [-1431.122] (-1431.845) (-1431.385) * (-1432.523) [-1432.195] (-1433.471) (-1432.224) -- 0:00:53

      Average standard deviation of split frequencies: 0.017263

      170500 -- (-1432.005) [-1432.165] (-1431.558) (-1430.697) * (-1434.029) (-1432.902) [-1433.617] (-1430.886) -- 0:00:53
      171000 -- (-1432.165) (-1432.520) [-1430.497] (-1430.422) * (-1432.274) [-1434.740] (-1432.978) (-1433.910) -- 0:00:53
      171500 -- (-1431.915) [-1433.495] (-1431.852) (-1432.005) * (-1432.059) (-1430.304) (-1432.205) [-1433.570] -- 0:00:53
      172000 -- (-1434.159) [-1433.500] (-1433.789) (-1437.062) * [-1433.027] (-1431.402) (-1434.166) (-1434.761) -- 0:00:52
      172500 -- (-1436.228) (-1432.121) (-1432.210) [-1431.358] * (-1432.386) [-1431.340] (-1431.796) (-1432.258) -- 0:00:52
      173000 -- (-1435.271) (-1433.016) (-1431.896) [-1431.220] * (-1430.667) (-1432.214) [-1431.190] (-1431.567) -- 0:00:52
      173500 -- [-1431.883] (-1430.783) (-1431.654) (-1431.836) * (-1434.083) (-1435.045) [-1432.004] (-1431.537) -- 0:00:52
      174000 -- [-1431.562] (-1431.907) (-1431.218) (-1431.039) * (-1430.932) (-1435.943) (-1430.247) [-1430.494] -- 0:00:52
      174500 -- (-1431.414) (-1431.767) (-1433.246) [-1431.663] * (-1430.408) [-1432.596] (-1430.874) (-1432.348) -- 0:00:52
      175000 -- (-1431.571) (-1438.227) (-1432.848) [-1430.026] * (-1431.186) (-1432.736) [-1430.847] (-1429.987) -- 0:00:51

      Average standard deviation of split frequencies: 0.016581

      175500 -- (-1430.921) (-1433.243) (-1431.232) [-1430.958] * [-1431.322] (-1432.921) (-1430.955) (-1431.455) -- 0:00:51
      176000 -- [-1430.951] (-1432.454) (-1436.158) (-1430.861) * [-1430.351] (-1432.114) (-1433.117) (-1432.010) -- 0:00:51
      176500 -- (-1431.052) [-1432.968] (-1436.089) (-1429.863) * (-1433.152) [-1434.193] (-1433.647) (-1430.734) -- 0:00:51
      177000 -- (-1436.236) [-1430.593] (-1436.188) (-1433.322) * (-1431.202) [-1433.049] (-1431.094) (-1430.733) -- 0:00:51
      177500 -- [-1437.358] (-1432.938) (-1430.655) (-1432.476) * [-1431.009] (-1433.702) (-1431.980) (-1433.437) -- 0:00:50
      178000 -- (-1430.537) (-1435.894) (-1431.978) [-1430.982] * (-1431.752) (-1436.977) (-1433.207) [-1435.245] -- 0:00:50
      178500 -- (-1439.143) [-1433.808] (-1432.366) (-1430.569) * (-1432.934) (-1436.164) (-1436.218) [-1431.139] -- 0:00:50
      179000 -- (-1434.305) (-1431.486) (-1434.738) [-1431.631] * (-1432.977) (-1432.897) [-1433.065] (-1433.092) -- 0:00:50
      179500 -- [-1430.746] (-1430.305) (-1432.302) (-1432.825) * (-1433.115) (-1432.856) (-1432.289) [-1434.740] -- 0:00:50
      180000 -- [-1430.747] (-1430.832) (-1432.854) (-1432.831) * [-1431.635] (-1430.695) (-1431.233) (-1433.125) -- 0:00:50

      Average standard deviation of split frequencies: 0.015916

      180500 -- (-1431.851) (-1432.515) (-1432.423) [-1432.614] * [-1432.519] (-1431.337) (-1434.515) (-1433.880) -- 0:00:49
      181000 -- (-1432.228) [-1431.000] (-1433.456) (-1430.578) * (-1432.708) [-1430.254] (-1432.224) (-1433.608) -- 0:00:49
      181500 -- (-1431.204) (-1431.561) (-1432.578) [-1430.061] * (-1434.695) (-1430.856) (-1431.398) [-1437.168] -- 0:00:49
      182000 -- [-1431.947] (-1432.455) (-1434.000) (-1431.103) * (-1431.136) [-1431.385] (-1432.673) (-1432.459) -- 0:00:53
      182500 -- (-1431.967) [-1434.359] (-1431.661) (-1430.925) * [-1430.831] (-1431.816) (-1432.670) (-1431.553) -- 0:00:53
      183000 -- (-1431.993) (-1433.993) (-1432.521) [-1432.382] * [-1432.226] (-1434.073) (-1435.929) (-1430.641) -- 0:00:53
      183500 -- [-1433.991] (-1431.925) (-1434.104) (-1430.878) * (-1432.379) (-1431.229) (-1430.709) [-1431.038] -- 0:00:53
      184000 -- (-1433.029) [-1433.128] (-1432.530) (-1431.744) * (-1433.131) (-1433.796) [-1431.096] (-1431.704) -- 0:00:53
      184500 -- (-1435.315) [-1430.273] (-1432.555) (-1432.916) * (-1435.990) (-1430.982) [-1432.000] (-1430.765) -- 0:00:53
      185000 -- [-1433.463] (-1430.886) (-1431.680) (-1431.570) * (-1434.520) (-1430.767) (-1432.190) [-1431.823] -- 0:00:52

      Average standard deviation of split frequencies: 0.016601

      185500 -- (-1433.429) (-1431.858) [-1431.439] (-1431.314) * (-1431.194) [-1432.381] (-1432.704) (-1435.021) -- 0:00:52
      186000 -- (-1434.599) (-1431.270) (-1432.607) [-1432.072] * (-1431.203) (-1433.280) (-1436.214) [-1433.065] -- 0:00:52
      186500 -- (-1432.695) (-1432.341) [-1433.879] (-1432.136) * [-1433.179] (-1430.373) (-1434.156) (-1433.348) -- 0:00:52
      187000 -- (-1438.671) (-1431.829) [-1431.653] (-1433.031) * [-1432.240] (-1436.093) (-1432.683) (-1431.580) -- 0:00:52
      187500 -- (-1436.804) (-1432.970) (-1432.004) [-1430.964] * (-1434.491) (-1435.804) (-1433.453) [-1430.824] -- 0:00:52
      188000 -- [-1432.663] (-1436.479) (-1433.301) (-1431.705) * [-1432.730] (-1433.412) (-1433.887) (-1431.773) -- 0:00:51
      188500 -- (-1433.392) (-1433.302) [-1431.361] (-1434.106) * [-1434.196] (-1433.557) (-1436.036) (-1433.788) -- 0:00:51
      189000 -- (-1436.884) (-1433.671) [-1431.792] (-1435.246) * (-1433.201) (-1431.752) [-1436.661] (-1432.195) -- 0:00:51
      189500 -- (-1433.941) [-1437.741] (-1430.993) (-1433.251) * (-1434.271) [-1433.344] (-1432.879) (-1432.818) -- 0:00:51
      190000 -- [-1433.417] (-1433.472) (-1431.602) (-1437.333) * (-1432.808) (-1436.238) [-1434.073] (-1431.982) -- 0:00:51

      Average standard deviation of split frequencies: 0.018790

      190500 -- (-1433.479) [-1435.991] (-1431.028) (-1437.784) * (-1431.592) [-1436.695] (-1436.886) (-1431.891) -- 0:00:50
      191000 -- (-1434.658) [-1431.055] (-1430.901) (-1439.658) * [-1432.199] (-1429.828) (-1430.867) (-1432.912) -- 0:00:50
      191500 -- (-1435.126) (-1430.829) [-1432.150] (-1433.316) * (-1432.421) (-1430.867) (-1430.859) [-1433.727] -- 0:00:50
      192000 -- [-1432.357] (-1434.070) (-1431.883) (-1437.182) * [-1431.715] (-1431.659) (-1432.713) (-1435.796) -- 0:00:50
      192500 -- (-1431.441) [-1434.181] (-1431.298) (-1431.583) * (-1434.284) (-1431.072) (-1431.721) [-1437.873] -- 0:00:50
      193000 -- (-1430.010) (-1432.056) [-1432.153] (-1432.347) * [-1435.894] (-1431.442) (-1431.236) (-1439.160) -- 0:00:50
      193500 -- [-1430.583] (-1431.300) (-1432.188) (-1432.024) * (-1435.584) [-1430.088] (-1432.821) (-1437.711) -- 0:00:50
      194000 -- (-1435.341) [-1433.913] (-1433.953) (-1432.224) * (-1433.961) [-1431.270] (-1431.896) (-1436.900) -- 0:00:49
      194500 -- (-1436.003) (-1433.628) [-1432.919] (-1431.651) * [-1433.823] (-1431.533) (-1432.226) (-1437.308) -- 0:00:49
      195000 -- (-1436.646) [-1431.284] (-1432.054) (-1431.140) * (-1433.884) (-1436.636) [-1432.269] (-1433.339) -- 0:00:49

      Average standard deviation of split frequencies: 0.016475

      195500 -- [-1429.999] (-1432.591) (-1431.844) (-1430.591) * (-1434.046) [-1432.277] (-1431.203) (-1434.851) -- 0:00:49
      196000 -- (-1433.246) (-1431.366) [-1431.328] (-1432.406) * (-1430.989) (-1432.004) [-1432.369] (-1435.569) -- 0:00:49
      196500 -- (-1432.043) [-1431.744] (-1433.947) (-1430.758) * (-1431.326) (-1431.042) (-1431.254) [-1434.366] -- 0:00:49
      197000 -- (-1432.369) [-1430.546] (-1431.353) (-1434.483) * (-1430.550) (-1435.895) [-1434.274] (-1434.934) -- 0:00:48
      197500 -- (-1432.198) (-1430.347) (-1431.389) [-1433.523] * (-1431.708) [-1431.745] (-1432.147) (-1437.400) -- 0:00:48
      198000 -- (-1432.325) (-1430.426) (-1432.376) [-1431.907] * (-1433.543) [-1431.568] (-1432.738) (-1433.092) -- 0:00:52
      198500 -- (-1430.113) [-1431.073] (-1430.859) (-1431.862) * (-1432.606) [-1432.380] (-1432.266) (-1432.914) -- 0:00:52
      199000 -- (-1430.563) (-1431.038) [-1430.813] (-1433.404) * (-1435.882) (-1431.916) [-1431.815] (-1432.898) -- 0:00:52
      199500 -- [-1431.201] (-1435.520) (-1431.000) (-1432.829) * (-1433.118) (-1430.935) [-1432.716] (-1433.760) -- 0:00:52
      200000 -- [-1432.200] (-1436.737) (-1431.001) (-1436.307) * [-1433.063] (-1436.823) (-1431.235) (-1434.816) -- 0:00:51

      Average standard deviation of split frequencies: 0.017310

      200500 -- (-1431.898) [-1436.058] (-1434.786) (-1436.990) * [-1433.540] (-1433.427) (-1431.741) (-1435.168) -- 0:00:51
      201000 -- [-1431.501] (-1440.829) (-1432.834) (-1432.893) * (-1432.594) (-1433.525) (-1433.787) [-1434.022] -- 0:00:51
      201500 -- (-1432.383) (-1432.307) [-1431.641] (-1431.882) * (-1441.039) (-1430.294) (-1438.727) [-1434.422] -- 0:00:51
      202000 -- [-1434.959] (-1433.347) (-1431.908) (-1433.173) * (-1437.064) [-1431.523] (-1438.065) (-1431.343) -- 0:00:51
      202500 -- (-1434.198) (-1432.316) [-1431.506] (-1431.773) * (-1431.813) [-1432.271] (-1435.030) (-1431.724) -- 0:00:51
      203000 -- (-1430.850) (-1432.613) [-1436.180] (-1432.632) * (-1432.263) [-1432.767] (-1434.588) (-1432.070) -- 0:00:51
      203500 -- (-1430.580) (-1430.074) [-1433.869] (-1434.439) * [-1435.481] (-1442.393) (-1431.904) (-1430.950) -- 0:00:50
      204000 -- (-1433.346) [-1430.129] (-1432.829) (-1434.862) * (-1434.565) (-1433.617) (-1433.165) [-1430.674] -- 0:00:50
      204500 -- [-1430.659] (-1430.180) (-1431.191) (-1432.997) * (-1431.425) (-1431.559) (-1439.388) [-1432.164] -- 0:00:50
      205000 -- (-1436.416) (-1431.250) (-1433.582) [-1432.205] * [-1430.993] (-1431.946) (-1437.521) (-1432.731) -- 0:00:50

      Average standard deviation of split frequencies: 0.015898

      205500 -- [-1433.274] (-1430.809) (-1432.617) (-1431.825) * (-1431.290) [-1431.967] (-1433.166) (-1431.682) -- 0:00:50
      206000 -- (-1433.518) (-1431.246) (-1432.999) [-1431.725] * (-1430.086) [-1432.973] (-1433.239) (-1432.215) -- 0:00:50
      206500 -- (-1433.456) (-1430.999) [-1430.482] (-1431.738) * [-1432.078] (-1432.658) (-1432.138) (-1435.916) -- 0:00:49
      207000 -- (-1433.451) [-1431.396] (-1438.609) (-1431.130) * (-1430.916) (-1434.031) [-1433.051] (-1432.464) -- 0:00:49
      207500 -- (-1430.689) [-1432.269] (-1436.301) (-1431.594) * (-1430.673) (-1433.186) (-1435.305) [-1432.303] -- 0:00:49
      208000 -- (-1433.855) (-1431.663) [-1437.220] (-1431.228) * (-1431.431) [-1432.787] (-1433.392) (-1430.597) -- 0:00:49
      208500 -- (-1432.968) (-1431.935) [-1434.110] (-1431.280) * (-1430.715) (-1433.346) (-1431.391) [-1429.946] -- 0:00:49
      209000 -- [-1432.913] (-1432.700) (-1435.081) (-1433.970) * (-1430.635) (-1432.486) [-1431.251] (-1430.355) -- 0:00:49
      209500 -- (-1430.419) (-1436.568) [-1433.667] (-1432.852) * [-1430.784] (-1430.208) (-1430.738) (-1431.273) -- 0:00:49
      210000 -- (-1431.366) [-1431.566] (-1433.355) (-1430.780) * (-1432.227) (-1430.836) (-1433.059) [-1431.712] -- 0:00:48

      Average standard deviation of split frequencies: 0.015193

      210500 -- [-1430.898] (-1432.564) (-1433.887) (-1430.828) * (-1430.318) (-1430.328) (-1431.604) [-1431.693] -- 0:00:48
      211000 -- [-1431.203] (-1433.384) (-1437.648) (-1432.343) * (-1431.789) [-1431.349] (-1432.241) (-1433.949) -- 0:00:48
      211500 -- (-1430.570) [-1431.500] (-1437.808) (-1430.577) * [-1431.577] (-1433.134) (-1431.193) (-1432.423) -- 0:00:48
      212000 -- (-1431.275) [-1431.296] (-1434.084) (-1432.182) * (-1432.916) (-1433.265) (-1433.642) [-1432.376] -- 0:00:48
      212500 -- (-1431.754) (-1431.254) [-1430.635] (-1435.946) * (-1432.248) (-1434.691) (-1433.838) [-1431.673] -- 0:00:48
      213000 -- (-1430.873) (-1432.773) [-1433.158] (-1437.092) * (-1431.888) [-1433.313] (-1431.172) (-1432.370) -- 0:00:48
      213500 -- (-1430.773) (-1433.767) (-1433.391) [-1435.543] * (-1430.933) (-1431.030) [-1430.716] (-1430.111) -- 0:00:51
      214000 -- (-1430.373) (-1431.895) [-1436.671] (-1433.985) * (-1433.338) (-1429.932) (-1432.118) [-1430.180] -- 0:00:51
      214500 -- (-1430.200) [-1430.778] (-1435.747) (-1432.234) * (-1430.298) (-1430.580) [-1433.630] (-1430.694) -- 0:00:51
      215000 -- (-1430.139) (-1430.978) (-1434.733) [-1431.602] * (-1430.197) (-1430.948) (-1433.258) [-1430.903] -- 0:00:51

      Average standard deviation of split frequencies: 0.015392

      215500 -- (-1430.139) (-1432.292) [-1431.346] (-1431.320) * (-1432.402) (-1435.533) (-1432.009) [-1430.644] -- 0:00:50
      216000 -- (-1431.160) [-1432.734] (-1430.843) (-1432.438) * (-1431.062) [-1430.398] (-1430.641) (-1431.725) -- 0:00:50
      216500 -- (-1431.156) [-1431.809] (-1430.705) (-1435.158) * (-1430.078) (-1435.855) (-1430.815) [-1431.197] -- 0:00:50
      217000 -- (-1433.340) (-1432.077) (-1431.033) [-1433.960] * (-1431.830) (-1435.775) (-1432.082) [-1431.875] -- 0:00:50
      217500 -- (-1433.340) [-1432.627] (-1433.246) (-1436.213) * [-1431.024] (-1430.993) (-1431.475) (-1433.134) -- 0:00:50
      218000 -- (-1434.375) (-1433.625) [-1432.394] (-1432.755) * [-1431.677] (-1432.622) (-1433.179) (-1435.697) -- 0:00:50
      218500 -- (-1429.993) (-1432.348) (-1430.634) [-1431.499] * (-1430.297) (-1433.654) (-1431.893) [-1432.755] -- 0:00:50
      219000 -- (-1433.514) (-1431.986) [-1431.025] (-1431.424) * (-1435.026) [-1430.331] (-1433.999) (-1433.116) -- 0:00:49
      219500 -- (-1435.616) (-1431.629) (-1432.602) [-1431.223] * [-1432.005] (-1431.379) (-1432.418) (-1431.386) -- 0:00:49
      220000 -- (-1433.729) (-1430.216) (-1431.076) [-1431.955] * (-1431.302) (-1431.532) (-1430.041) [-1432.996] -- 0:00:49

      Average standard deviation of split frequencies: 0.015291

      220500 -- (-1433.834) [-1436.655] (-1431.024) (-1431.710) * (-1431.240) (-1431.002) (-1431.099) [-1431.693] -- 0:00:49
      221000 -- (-1431.853) (-1436.234) (-1434.021) [-1434.008] * (-1430.305) [-1430.167] (-1431.690) (-1433.390) -- 0:00:49
      221500 -- (-1434.329) [-1432.718] (-1434.294) (-1431.609) * [-1430.320] (-1430.456) (-1430.853) (-1432.786) -- 0:00:49
      222000 -- (-1437.888) [-1432.728] (-1436.516) (-1432.566) * (-1432.076) (-1430.161) [-1430.412] (-1433.735) -- 0:00:49
      222500 -- (-1434.463) (-1431.762) [-1432.960] (-1432.503) * [-1433.224] (-1431.536) (-1431.598) (-1438.263) -- 0:00:48
      223000 -- (-1432.698) [-1433.984] (-1435.166) (-1430.747) * (-1434.489) (-1434.661) (-1430.225) [-1433.761] -- 0:00:48
      223500 -- (-1431.505) [-1431.551] (-1433.601) (-1430.531) * [-1433.623] (-1433.591) (-1430.138) (-1431.731) -- 0:00:48
      224000 -- (-1431.591) [-1432.036] (-1432.872) (-1430.847) * (-1433.730) [-1436.298] (-1431.600) (-1436.395) -- 0:00:48
      224500 -- (-1431.823) (-1431.659) [-1432.671] (-1431.852) * (-1431.173) [-1435.117] (-1431.180) (-1432.009) -- 0:00:48
      225000 -- [-1431.367] (-1431.693) (-1433.870) (-1432.170) * (-1431.368) (-1431.382) (-1431.880) [-1433.253] -- 0:00:48

      Average standard deviation of split frequencies: 0.014711

      225500 -- [-1432.594] (-1433.454) (-1432.485) (-1432.100) * (-1431.732) (-1430.956) (-1430.878) [-1431.773] -- 0:00:48
      226000 -- (-1433.442) (-1431.853) [-1432.223] (-1431.815) * (-1434.925) (-1431.315) [-1430.990] (-1433.244) -- 0:00:47
      226500 -- (-1434.761) [-1434.052] (-1432.796) (-1433.319) * (-1432.371) [-1435.682] (-1431.795) (-1438.274) -- 0:00:47
      227000 -- (-1437.211) (-1434.415) (-1431.670) [-1432.128] * (-1435.334) (-1433.045) [-1431.449] (-1433.001) -- 0:00:47
      227500 -- (-1433.028) (-1431.644) [-1431.533] (-1437.161) * [-1435.052] (-1430.808) (-1431.899) (-1432.997) -- 0:00:47
      228000 -- (-1433.533) (-1430.309) [-1431.390] (-1433.525) * (-1432.411) [-1431.361] (-1431.136) (-1430.960) -- 0:00:47
      228500 -- (-1434.255) [-1433.992] (-1432.160) (-1433.392) * (-1434.709) [-1432.152] (-1431.768) (-1432.515) -- 0:00:47
      229000 -- (-1430.615) (-1434.029) [-1430.684] (-1433.627) * (-1433.002) [-1431.137] (-1431.465) (-1435.361) -- 0:00:47
      229500 -- (-1431.481) [-1435.323] (-1430.968) (-1432.578) * (-1432.350) (-1430.877) [-1433.640] (-1430.236) -- 0:00:50
      230000 -- [-1431.663] (-1434.146) (-1430.697) (-1432.999) * [-1433.632] (-1433.775) (-1435.638) (-1430.480) -- 0:00:50

      Average standard deviation of split frequencies: 0.015596

      230500 -- (-1431.652) [-1431.956] (-1432.234) (-1430.811) * (-1430.743) (-1430.782) (-1433.054) [-1430.720] -- 0:00:50
      231000 -- (-1433.107) (-1431.227) [-1432.675] (-1430.811) * (-1431.846) (-1430.065) [-1431.352] (-1430.467) -- 0:00:49
      231500 -- (-1431.416) (-1432.285) (-1435.400) [-1431.589] * [-1431.846] (-1433.570) (-1431.252) (-1431.701) -- 0:00:49
      232000 -- [-1430.632] (-1432.925) (-1432.361) (-1433.696) * (-1431.975) (-1432.387) (-1431.698) [-1431.416] -- 0:00:49
      232500 -- (-1432.772) (-1431.696) [-1431.359] (-1431.945) * (-1431.627) (-1432.348) (-1430.307) [-1431.146] -- 0:00:49
      233000 -- [-1430.078] (-1431.879) (-1431.399) (-1431.056) * [-1431.465] (-1431.191) (-1432.822) (-1432.259) -- 0:00:49
      233500 -- (-1430.078) (-1433.158) (-1432.371) [-1434.370] * (-1431.560) (-1430.829) (-1437.377) [-1431.468] -- 0:00:49
      234000 -- [-1431.432] (-1433.261) (-1430.421) (-1433.314) * (-1431.831) (-1435.412) [-1430.412] (-1430.454) -- 0:00:49
      234500 -- (-1430.847) (-1431.100) [-1433.449] (-1431.065) * (-1431.925) (-1431.620) (-1430.535) [-1430.390] -- 0:00:48
      235000 -- (-1431.558) [-1433.566] (-1434.004) (-1430.877) * (-1431.151) (-1431.016) [-1434.884] (-1432.334) -- 0:00:48

      Average standard deviation of split frequencies: 0.017136

      235500 -- (-1431.451) (-1432.980) [-1431.523] (-1430.609) * (-1430.252) (-1430.764) (-1436.145) [-1433.054] -- 0:00:48
      236000 -- [-1431.954] (-1433.371) (-1431.730) (-1430.566) * (-1431.085) [-1431.018] (-1432.218) (-1435.105) -- 0:00:48
      236500 -- (-1435.198) (-1433.175) (-1433.116) [-1433.723] * (-1432.617) (-1431.955) (-1433.756) [-1434.770] -- 0:00:48
      237000 -- [-1432.181] (-1431.782) (-1434.206) (-1432.132) * [-1433.192] (-1432.506) (-1431.855) (-1434.862) -- 0:00:48
      237500 -- (-1431.032) (-1433.951) (-1431.825) [-1431.416] * (-1436.600) (-1432.188) [-1431.564] (-1435.679) -- 0:00:48
      238000 -- [-1431.046] (-1430.811) (-1433.669) (-1431.344) * (-1432.778) (-1430.281) [-1431.324] (-1433.447) -- 0:00:48
      238500 -- (-1432.554) (-1432.675) [-1434.462] (-1432.173) * (-1433.355) (-1430.031) [-1432.355] (-1436.479) -- 0:00:47
      239000 -- (-1430.740) (-1432.265) (-1435.049) [-1432.895] * (-1432.694) (-1429.976) [-1432.092] (-1437.034) -- 0:00:47
      239500 -- (-1430.498) (-1431.886) [-1430.497] (-1433.325) * (-1431.159) (-1434.971) (-1431.583) [-1433.184] -- 0:00:47
      240000 -- (-1431.509) (-1432.100) [-1435.234] (-1433.281) * (-1430.909) (-1435.307) (-1430.679) [-1431.980] -- 0:00:47

      Average standard deviation of split frequencies: 0.017010

      240500 -- (-1434.567) [-1436.136] (-1433.393) (-1431.830) * (-1432.581) (-1431.330) (-1431.426) [-1432.056] -- 0:00:47
      241000 -- [-1430.729] (-1437.176) (-1434.600) (-1433.269) * (-1434.898) (-1433.861) (-1431.523) [-1432.047] -- 0:00:47
      241500 -- (-1433.273) [-1432.015] (-1433.255) (-1435.992) * (-1430.510) (-1432.477) [-1431.929] (-1432.545) -- 0:00:47
      242000 -- (-1433.126) (-1432.570) (-1435.039) [-1432.337] * (-1431.971) [-1432.035] (-1430.988) (-1430.943) -- 0:00:46
      242500 -- (-1430.733) (-1432.451) [-1432.242] (-1431.065) * (-1433.184) (-1431.756) (-1434.007) [-1431.602] -- 0:00:46
      243000 -- (-1431.032) (-1431.429) [-1431.641] (-1435.098) * (-1434.795) (-1432.277) [-1431.991] (-1431.466) -- 0:00:46
      243500 -- (-1431.148) [-1431.229] (-1431.307) (-1432.383) * [-1433.585] (-1433.918) (-1433.580) (-1432.976) -- 0:00:46
      244000 -- (-1432.803) (-1431.967) [-1431.017] (-1432.527) * (-1434.079) (-1439.895) [-1433.165] (-1437.520) -- 0:00:46
      244500 -- (-1432.975) (-1433.949) (-1431.022) [-1433.454] * (-1431.203) (-1430.991) (-1434.380) [-1433.490] -- 0:00:46
      245000 -- (-1438.383) (-1432.155) [-1431.017] (-1431.357) * (-1431.244) (-1432.258) (-1435.902) [-1435.710] -- 0:00:46

      Average standard deviation of split frequencies: 0.016641

      245500 -- (-1432.848) (-1431.692) (-1432.937) [-1431.510] * [-1431.140] (-1436.080) (-1436.913) (-1433.039) -- 0:00:49
      246000 -- [-1433.164] (-1432.063) (-1432.397) (-1433.248) * [-1433.315] (-1433.559) (-1432.718) (-1435.714) -- 0:00:49
      246500 -- (-1434.609) (-1432.674) [-1433.178] (-1433.334) * (-1432.889) (-1434.402) [-1432.749] (-1432.116) -- 0:00:48
      247000 -- [-1432.002] (-1431.055) (-1430.892) (-1432.220) * (-1431.751) (-1436.240) [-1432.079] (-1431.762) -- 0:00:48
      247500 -- (-1433.428) (-1436.153) (-1432.535) [-1432.616] * [-1434.079] (-1431.837) (-1432.427) (-1431.195) -- 0:00:48
      248000 -- (-1434.876) (-1433.610) [-1430.269] (-1430.305) * (-1432.971) [-1430.933] (-1431.282) (-1432.286) -- 0:00:48
      248500 -- [-1434.451] (-1431.332) (-1431.028) (-1430.582) * (-1432.019) (-1431.089) [-1431.928] (-1433.513) -- 0:00:48
      249000 -- (-1432.715) [-1431.371] (-1430.871) (-1430.724) * (-1433.608) [-1430.352] (-1430.951) (-1434.074) -- 0:00:48
      249500 -- [-1430.386] (-1431.758) (-1434.973) (-1431.815) * (-1434.238) [-1432.335] (-1432.215) (-1434.111) -- 0:00:48
      250000 -- (-1430.220) [-1430.894] (-1433.461) (-1431.612) * (-1434.653) (-1430.831) (-1430.019) [-1431.102] -- 0:00:48

      Average standard deviation of split frequencies: 0.017123

      250500 -- (-1430.938) (-1434.192) (-1434.731) [-1431.521] * [-1431.191] (-1432.382) (-1432.077) (-1431.361) -- 0:00:47
      251000 -- [-1431.660] (-1434.007) (-1432.901) (-1432.034) * (-1433.752) (-1432.895) [-1430.387] (-1434.245) -- 0:00:47
      251500 -- [-1432.582] (-1434.038) (-1432.899) (-1432.037) * [-1431.531] (-1432.710) (-1434.427) (-1435.156) -- 0:00:47
      252000 -- [-1431.662] (-1431.904) (-1430.967) (-1433.082) * [-1430.755] (-1432.286) (-1434.056) (-1436.234) -- 0:00:47
      252500 -- (-1430.207) (-1433.865) (-1430.981) [-1433.100] * (-1431.466) (-1431.674) (-1431.625) [-1433.528] -- 0:00:47
      253000 -- (-1431.180) [-1430.313] (-1438.061) (-1435.263) * [-1431.418] (-1430.885) (-1431.429) (-1437.547) -- 0:00:47
      253500 -- (-1431.735) (-1432.341) [-1431.895] (-1430.421) * (-1432.135) [-1431.056] (-1431.210) (-1439.687) -- 0:00:47
      254000 -- (-1432.654) [-1432.790] (-1431.820) (-1431.604) * [-1434.901] (-1437.487) (-1433.545) (-1432.001) -- 0:00:46
      254500 -- (-1436.052) (-1432.994) (-1431.339) [-1431.742] * [-1436.940] (-1436.006) (-1436.144) (-1430.280) -- 0:00:46
      255000 -- (-1436.215) (-1432.175) (-1437.610) [-1430.950] * (-1434.629) (-1433.850) (-1434.657) [-1430.562] -- 0:00:46

      Average standard deviation of split frequencies: 0.016573

      255500 -- (-1431.645) [-1431.457] (-1434.199) (-1431.057) * (-1432.976) [-1430.684] (-1435.001) (-1432.035) -- 0:00:46
      256000 -- (-1431.631) [-1432.193] (-1431.473) (-1431.541) * [-1429.997] (-1433.625) (-1430.837) (-1430.047) -- 0:00:46
      256500 -- (-1433.161) (-1431.181) (-1430.573) [-1433.867] * (-1432.870) [-1436.379] (-1430.944) (-1430.516) -- 0:00:46
      257000 -- (-1431.991) (-1431.503) [-1430.678] (-1430.607) * (-1431.522) (-1433.386) [-1431.736] (-1430.474) -- 0:00:46
      257500 -- (-1431.721) (-1433.496) (-1431.658) [-1431.280] * [-1432.180] (-1430.070) (-1431.573) (-1430.624) -- 0:00:46
      258000 -- (-1430.655) (-1433.729) [-1430.788] (-1430.886) * [-1431.675] (-1430.070) (-1435.328) (-1432.183) -- 0:00:46
      258500 -- (-1430.672) (-1433.489) [-1432.957] (-1431.223) * (-1433.820) [-1430.265] (-1435.328) (-1431.912) -- 0:00:45
      259000 -- (-1433.554) (-1431.631) [-1431.814] (-1431.383) * (-1434.117) (-1432.058) (-1430.958) [-1432.848] -- 0:00:45
      259500 -- (-1434.032) [-1431.225] (-1432.054) (-1433.335) * [-1432.564] (-1431.906) (-1432.535) (-1433.167) -- 0:00:45
      260000 -- (-1432.423) (-1432.208) [-1430.636] (-1430.511) * (-1431.123) [-1431.505] (-1430.944) (-1433.782) -- 0:00:45

      Average standard deviation of split frequencies: 0.017582

      260500 -- (-1433.171) [-1432.166] (-1432.632) (-1431.595) * (-1430.798) (-1430.904) [-1430.943] (-1433.909) -- 0:00:45
      261000 -- (-1433.341) (-1432.363) [-1433.100] (-1430.957) * [-1434.315] (-1430.898) (-1433.167) (-1436.335) -- 0:00:45
      261500 -- (-1438.706) (-1431.831) (-1430.113) [-1433.327] * (-1432.850) (-1432.409) (-1432.610) [-1432.728] -- 0:00:48
      262000 -- (-1437.454) (-1431.693) [-1430.986] (-1431.061) * [-1434.794] (-1430.464) (-1435.201) (-1432.545) -- 0:00:47
      262500 -- (-1439.388) (-1431.912) (-1430.940) [-1434.602] * (-1435.423) (-1431.665) (-1435.087) [-1432.097] -- 0:00:47
      263000 -- (-1430.247) (-1432.699) [-1430.933] (-1437.152) * [-1432.048] (-1436.766) (-1434.692) (-1432.050) -- 0:00:47
      263500 -- (-1434.976) (-1434.622) (-1434.630) [-1430.738] * [-1433.526] (-1433.171) (-1435.795) (-1430.429) -- 0:00:47
      264000 -- (-1430.328) (-1433.820) [-1438.530] (-1430.872) * (-1433.670) (-1433.231) (-1430.524) [-1432.905] -- 0:00:47
      264500 -- (-1430.367) (-1432.578) (-1434.739) [-1433.951] * [-1431.007] (-1431.849) (-1432.433) (-1441.135) -- 0:00:47
      265000 -- [-1430.867] (-1431.435) (-1432.210) (-1432.859) * (-1431.005) (-1432.274) [-1431.319] (-1439.255) -- 0:00:47

      Average standard deviation of split frequencies: 0.016416

      265500 -- (-1430.653) (-1430.740) (-1431.544) [-1430.513] * (-1434.329) [-1432.680] (-1431.196) (-1432.005) -- 0:00:47
      266000 -- (-1429.791) (-1431.131) (-1437.779) [-1430.558] * (-1435.348) [-1430.056] (-1432.290) (-1432.131) -- 0:00:46
      266500 -- (-1430.657) [-1433.693] (-1437.068) (-1430.966) * (-1435.035) [-1430.569] (-1431.649) (-1435.965) -- 0:00:46
      267000 -- (-1431.394) [-1431.625] (-1434.854) (-1432.531) * (-1436.475) (-1431.283) [-1431.114] (-1436.167) -- 0:00:46
      267500 -- (-1432.403) (-1431.298) [-1433.070] (-1431.984) * [-1432.646] (-1431.168) (-1435.569) (-1431.947) -- 0:00:46
      268000 -- [-1431.517] (-1431.647) (-1432.856) (-1434.744) * (-1431.851) [-1431.510] (-1431.687) (-1431.811) -- 0:00:46
      268500 -- [-1431.517] (-1432.771) (-1434.188) (-1431.031) * (-1432.886) (-1431.300) (-1430.656) [-1432.546] -- 0:00:46
      269000 -- (-1433.061) [-1432.733] (-1433.694) (-1430.484) * (-1430.752) (-1432.764) [-1430.076] (-1431.078) -- 0:00:46
      269500 -- (-1435.337) (-1433.328) (-1433.475) [-1431.106] * (-1430.504) (-1432.120) (-1430.257) [-1431.672] -- 0:00:46
      270000 -- (-1435.151) (-1433.568) [-1433.529] (-1431.493) * (-1430.267) [-1432.112] (-1430.257) (-1432.878) -- 0:00:45

      Average standard deviation of split frequencies: 0.017050

      270500 -- (-1437.172) (-1430.854) (-1435.604) [-1433.240] * (-1430.267) [-1433.097] (-1434.370) (-1435.265) -- 0:00:45
      271000 -- (-1435.208) (-1431.598) [-1432.420] (-1432.492) * [-1430.267] (-1434.890) (-1433.385) (-1432.372) -- 0:00:45
      271500 -- [-1430.952] (-1434.331) (-1431.092) (-1431.187) * (-1431.110) (-1436.496) [-1431.247] (-1436.681) -- 0:00:45
      272000 -- (-1432.263) (-1435.328) [-1433.408] (-1435.298) * (-1431.040) (-1436.334) (-1430.417) [-1435.389] -- 0:00:45
      272500 -- (-1430.859) [-1434.159] (-1433.814) (-1430.675) * [-1435.054] (-1432.960) (-1431.328) (-1433.911) -- 0:00:45
      273000 -- (-1433.596) (-1435.568) [-1434.162] (-1431.000) * (-1432.684) [-1431.320] (-1431.267) (-1431.719) -- 0:00:45
      273500 -- [-1431.159] (-1431.189) (-1430.033) (-1431.218) * (-1432.192) (-1431.990) (-1430.466) [-1430.012] -- 0:00:45
      274000 -- (-1431.257) [-1433.709] (-1432.026) (-1429.941) * (-1431.632) (-1431.829) (-1430.932) [-1431.609] -- 0:00:45
      274500 -- (-1430.632) (-1434.466) (-1431.121) [-1431.919] * [-1432.589] (-1432.704) (-1431.389) (-1430.053) -- 0:00:44
      275000 -- (-1430.486) (-1432.266) (-1434.223) [-1431.154] * (-1436.077) (-1434.262) (-1432.492) [-1430.658] -- 0:00:44

      Average standard deviation of split frequencies: 0.016720

      275500 -- [-1432.207] (-1432.126) (-1432.157) (-1433.537) * [-1434.026] (-1433.143) (-1435.291) (-1430.877) -- 0:00:44
      276000 -- (-1430.887) (-1431.181) (-1432.546) [-1432.883] * (-1431.376) (-1433.543) (-1433.110) [-1432.188] -- 0:00:44
      276500 -- (-1431.935) [-1433.187] (-1434.118) (-1433.128) * (-1432.576) (-1431.587) [-1435.936] (-1430.413) -- 0:00:44
      277000 -- (-1431.410) (-1429.842) (-1435.072) [-1432.250] * [-1438.743] (-1431.753) (-1434.732) (-1430.644) -- 0:00:44
      277500 -- (-1430.004) (-1431.946) (-1434.463) [-1431.234] * (-1434.351) (-1431.771) (-1432.069) [-1430.355] -- 0:00:46
      278000 -- (-1431.686) (-1431.009) [-1432.052] (-1436.650) * [-1433.812] (-1431.917) (-1431.401) (-1433.749) -- 0:00:46
      278500 -- [-1431.639] (-1430.341) (-1431.982) (-1433.300) * (-1433.731) [-1431.622] (-1435.020) (-1431.562) -- 0:00:46
      279000 -- (-1431.938) (-1431.229) (-1436.975) [-1430.616] * [-1431.238] (-1432.127) (-1431.714) (-1431.996) -- 0:00:46
      279500 -- [-1431.742] (-1432.957) (-1434.858) (-1431.552) * (-1433.138) [-1431.668] (-1432.163) (-1431.066) -- 0:00:46
      280000 -- (-1432.697) [-1430.564] (-1433.965) (-1431.726) * (-1431.164) [-1433.386] (-1433.056) (-1431.847) -- 0:00:46

      Average standard deviation of split frequencies: 0.015558

      280500 -- (-1435.323) (-1430.873) [-1431.404] (-1433.159) * (-1431.068) [-1435.991] (-1432.202) (-1432.439) -- 0:00:46
      281000 -- (-1434.465) (-1431.064) [-1431.386] (-1434.276) * [-1436.278] (-1431.814) (-1431.138) (-1430.374) -- 0:00:46
      281500 -- (-1431.396) (-1430.259) [-1431.913] (-1432.082) * (-1435.453) [-1433.476] (-1432.661) (-1430.210) -- 0:00:45
      282000 -- (-1432.952) [-1433.268] (-1431.252) (-1432.046) * (-1432.058) (-1432.332) (-1433.700) [-1430.198] -- 0:00:45
      282500 -- (-1433.188) (-1431.155) [-1430.725] (-1431.619) * [-1432.351] (-1430.796) (-1433.257) (-1430.740) -- 0:00:45
      283000 -- [-1433.584] (-1430.213) (-1432.091) (-1431.461) * (-1431.558) (-1431.924) (-1432.503) [-1431.488] -- 0:00:45
      283500 -- (-1431.639) [-1430.214] (-1431.926) (-1433.719) * (-1434.511) (-1431.771) [-1432.588] (-1431.865) -- 0:00:45
      284000 -- (-1431.764) (-1431.260) [-1433.015] (-1432.634) * (-1433.393) (-1432.744) [-1432.903] (-1433.741) -- 0:00:45
      284500 -- (-1431.848) (-1431.541) [-1434.846] (-1432.361) * (-1430.475) (-1434.817) [-1435.223] (-1433.291) -- 0:00:45
      285000 -- (-1436.704) [-1430.503] (-1431.959) (-1432.201) * (-1431.065) [-1431.635] (-1434.653) (-1433.054) -- 0:00:45

      Average standard deviation of split frequencies: 0.016309

      285500 -- (-1432.569) [-1430.481] (-1432.653) (-1432.395) * (-1433.211) (-1432.795) [-1430.468] (-1431.162) -- 0:00:45
      286000 -- (-1433.821) [-1430.359] (-1436.113) (-1433.359) * [-1431.913] (-1431.411) (-1431.061) (-1433.967) -- 0:00:44
      286500 -- (-1431.633) (-1433.371) [-1431.746] (-1431.665) * (-1431.182) (-1430.952) (-1433.032) [-1433.189] -- 0:00:44
      287000 -- (-1433.026) [-1431.053] (-1433.099) (-1430.453) * (-1431.350) [-1431.543] (-1434.363) (-1432.994) -- 0:00:44
      287500 -- (-1435.356) [-1430.216] (-1430.555) (-1430.942) * (-1430.265) (-1431.404) (-1434.239) [-1433.030] -- 0:00:44
      288000 -- (-1435.096) (-1430.552) (-1431.828) [-1431.958] * [-1431.037] (-1432.046) (-1431.634) (-1431.017) -- 0:00:44
      288500 -- (-1431.966) [-1431.066] (-1434.018) (-1430.998) * [-1431.305] (-1430.908) (-1436.661) (-1431.983) -- 0:00:44
      289000 -- [-1431.626] (-1430.917) (-1432.533) (-1430.153) * [-1432.305] (-1434.010) (-1434.134) (-1433.525) -- 0:00:44
      289500 -- [-1431.003] (-1435.661) (-1432.292) (-1430.159) * (-1431.757) [-1431.910] (-1433.260) (-1433.153) -- 0:00:44
      290000 -- [-1430.535] (-1433.790) (-1431.532) (-1430.477) * (-1431.511) (-1434.434) (-1430.698) [-1432.142] -- 0:00:44

      Average standard deviation of split frequencies: 0.015587

      290500 -- (-1430.435) [-1430.876] (-1432.617) (-1430.646) * [-1431.697] (-1434.202) (-1432.902) (-1433.306) -- 0:00:43
      291000 -- (-1431.390) (-1431.206) [-1432.396] (-1431.566) * [-1431.443] (-1433.007) (-1430.612) (-1433.023) -- 0:00:43
      291500 -- (-1431.108) (-1434.753) (-1433.542) [-1430.330] * (-1435.388) (-1433.470) (-1429.941) [-1433.120] -- 0:00:43
      292000 -- (-1432.503) (-1434.349) (-1431.370) [-1431.777] * (-1431.180) (-1431.659) [-1430.666] (-1435.286) -- 0:00:43
      292500 -- [-1430.908] (-1434.582) (-1433.035) (-1435.587) * (-1432.431) [-1431.560] (-1434.167) (-1431.583) -- 0:00:43
      293000 -- (-1432.979) (-1433.322) (-1432.950) [-1435.689] * (-1433.083) (-1433.059) (-1431.605) [-1431.226] -- 0:00:45
      293500 -- (-1433.560) (-1432.830) [-1431.455] (-1433.627) * (-1431.580) (-1432.104) (-1433.106) [-1432.597] -- 0:00:45
      294000 -- (-1433.225) [-1433.677] (-1430.828) (-1430.188) * (-1431.117) (-1431.962) (-1430.709) [-1432.047] -- 0:00:45
      294500 -- (-1433.615) (-1435.444) [-1430.136] (-1430.258) * (-1431.040) [-1436.304] (-1432.005) (-1433.064) -- 0:00:45
      295000 -- (-1432.998) [-1430.791] (-1431.569) (-1430.012) * (-1433.429) (-1436.272) [-1433.301] (-1432.691) -- 0:00:45

      Average standard deviation of split frequencies: 0.015660

      295500 -- (-1432.245) [-1430.757] (-1431.773) (-1430.222) * (-1433.426) (-1432.946) [-1433.487] (-1433.598) -- 0:00:45
      296000 -- (-1435.388) (-1432.114) (-1430.693) [-1430.103] * (-1434.376) [-1435.102] (-1435.307) (-1431.760) -- 0:00:45
      296500 -- (-1432.709) (-1435.493) [-1430.519] (-1434.410) * [-1431.823] (-1432.146) (-1434.007) (-1431.254) -- 0:00:45
      297000 -- (-1433.660) (-1436.965) (-1430.399) [-1431.538] * (-1431.783) [-1430.663] (-1434.055) (-1433.510) -- 0:00:44
      297500 -- (-1433.808) (-1435.521) (-1430.893) [-1431.065] * (-1429.961) [-1430.828] (-1441.409) (-1433.352) -- 0:00:44
      298000 -- (-1433.592) [-1431.118] (-1431.454) (-1430.477) * (-1435.037) [-1434.161] (-1439.193) (-1436.081) -- 0:00:44
      298500 -- (-1432.020) [-1432.785] (-1435.572) (-1432.815) * (-1431.131) [-1432.590] (-1440.057) (-1433.838) -- 0:00:44
      299000 -- (-1433.291) (-1435.447) (-1433.269) [-1431.536] * (-1434.099) (-1431.366) (-1437.892) [-1431.501] -- 0:00:44
      299500 -- (-1431.430) [-1431.983] (-1432.730) (-1436.041) * [-1433.679] (-1435.525) (-1435.387) (-1432.177) -- 0:00:44
      300000 -- (-1432.448) (-1432.131) (-1432.662) [-1434.855] * (-1430.113) (-1433.029) [-1434.240] (-1433.312) -- 0:00:44

      Average standard deviation of split frequencies: 0.017247

      300500 -- (-1431.804) [-1432.439] (-1431.562) (-1433.530) * (-1433.396) [-1430.454] (-1434.312) (-1430.807) -- 0:00:44
      301000 -- [-1430.957] (-1431.114) (-1434.504) (-1433.450) * (-1435.502) (-1431.068) [-1433.400] (-1430.467) -- 0:00:44
      301500 -- [-1431.341] (-1433.670) (-1434.793) (-1430.306) * (-1434.982) [-1432.349] (-1431.713) (-1431.806) -- 0:00:44
      302000 -- (-1431.414) (-1434.488) [-1431.442] (-1435.191) * (-1435.015) (-1430.544) [-1431.970] (-1433.457) -- 0:00:43
      302500 -- (-1432.319) [-1432.589] (-1431.095) (-1438.817) * (-1434.352) [-1430.414] (-1430.856) (-1431.990) -- 0:00:43
      303000 -- [-1431.325] (-1432.521) (-1431.400) (-1436.971) * (-1430.496) (-1429.879) [-1433.017] (-1431.648) -- 0:00:43
      303500 -- (-1432.436) (-1434.382) [-1431.505] (-1429.796) * [-1431.677] (-1430.574) (-1435.364) (-1436.874) -- 0:00:43
      304000 -- [-1431.875] (-1431.740) (-1431.437) (-1429.899) * [-1430.808] (-1431.706) (-1432.912) (-1431.982) -- 0:00:43
      304500 -- (-1431.547) [-1431.168] (-1432.657) (-1429.899) * (-1430.252) [-1432.971] (-1432.544) (-1432.140) -- 0:00:43
      305000 -- (-1430.545) (-1430.935) (-1434.132) [-1430.165] * [-1431.491] (-1432.282) (-1431.585) (-1431.774) -- 0:00:43

      Average standard deviation of split frequencies: 0.017595

      305500 -- (-1431.055) [-1431.066] (-1439.190) (-1430.245) * (-1430.768) (-1433.952) (-1431.941) [-1433.440] -- 0:00:43
      306000 -- (-1432.434) [-1432.201] (-1436.672) (-1431.640) * [-1430.400] (-1432.078) (-1432.186) (-1431.491) -- 0:00:43
      306500 -- (-1433.463) [-1430.587] (-1436.726) (-1432.719) * (-1432.279) (-1432.878) (-1431.574) [-1432.435] -- 0:00:42
      307000 -- [-1433.134] (-1433.102) (-1433.706) (-1431.236) * (-1434.285) [-1433.343] (-1432.755) (-1432.307) -- 0:00:42
      307500 -- (-1431.348) (-1433.614) (-1433.933) [-1432.402] * (-1430.527) (-1430.589) [-1436.237] (-1432.880) -- 0:00:42
      308000 -- (-1431.225) (-1435.900) [-1432.264] (-1433.649) * [-1430.315] (-1431.656) (-1433.446) (-1433.558) -- 0:00:42
      308500 -- (-1433.224) (-1434.764) (-1433.154) [-1432.015] * [-1431.919] (-1432.230) (-1435.715) (-1434.250) -- 0:00:42
      309000 -- (-1432.236) (-1433.337) (-1433.018) [-1431.269] * (-1430.571) [-1433.660] (-1433.401) (-1430.182) -- 0:00:44
      309500 -- [-1431.916] (-1432.386) (-1434.492) (-1430.717) * (-1430.543) (-1431.351) [-1433.169] (-1437.923) -- 0:00:44
      310000 -- [-1431.584] (-1431.975) (-1435.162) (-1431.189) * [-1430.577] (-1431.983) (-1433.214) (-1433.198) -- 0:00:44

      Average standard deviation of split frequencies: 0.017171

      310500 -- (-1431.578) (-1431.182) (-1434.022) [-1431.358] * [-1430.662] (-1433.004) (-1434.225) (-1432.677) -- 0:00:44
      311000 -- [-1430.359] (-1433.493) (-1434.087) (-1430.840) * (-1432.779) (-1433.603) (-1434.006) [-1430.974] -- 0:00:44
      311500 -- [-1431.168] (-1433.597) (-1432.725) (-1432.110) * (-1434.590) [-1434.434] (-1432.135) (-1434.410) -- 0:00:44
      312000 -- (-1431.412) [-1435.587] (-1440.168) (-1434.037) * (-1433.700) [-1436.117] (-1431.878) (-1431.414) -- 0:00:44
      312500 -- [-1431.104] (-1435.595) (-1432.962) (-1433.541) * [-1430.741] (-1436.457) (-1430.972) (-1430.239) -- 0:00:44
      313000 -- [-1431.002] (-1433.211) (-1432.491) (-1432.277) * (-1435.479) (-1434.309) [-1432.355] (-1434.242) -- 0:00:43
      313500 -- (-1430.265) [-1429.912] (-1430.440) (-1433.532) * (-1431.414) (-1437.362) [-1431.715] (-1432.449) -- 0:00:43
      314000 -- (-1431.870) (-1432.847) [-1432.127] (-1434.281) * (-1430.835) (-1434.041) (-1431.285) [-1435.305] -- 0:00:43
      314500 -- (-1431.870) (-1432.993) (-1433.345) [-1431.867] * (-1432.076) (-1431.695) [-1431.769] (-1435.432) -- 0:00:43
      315000 -- (-1434.017) (-1434.932) [-1433.086] (-1432.048) * (-1436.395) [-1431.349] (-1431.412) (-1431.829) -- 0:00:43

      Average standard deviation of split frequencies: 0.017273

      315500 -- [-1432.176] (-1430.804) (-1432.110) (-1433.037) * (-1438.551) (-1435.634) (-1431.984) [-1435.928] -- 0:00:43
      316000 -- (-1432.121) [-1431.393] (-1431.772) (-1431.491) * (-1430.446) [-1431.379] (-1435.095) (-1435.143) -- 0:00:43
      316500 -- (-1433.324) (-1431.316) (-1431.772) [-1432.048] * (-1431.404) (-1432.105) (-1430.986) [-1432.701] -- 0:00:43
      317000 -- (-1434.210) (-1431.095) [-1431.772] (-1431.074) * [-1431.408] (-1433.080) (-1429.847) (-1431.124) -- 0:00:43
      317500 -- [-1430.313] (-1433.084) (-1431.005) (-1430.420) * (-1430.237) [-1433.394] (-1433.648) (-1430.906) -- 0:00:42
      318000 -- (-1430.143) (-1433.403) [-1431.005] (-1431.168) * (-1433.440) (-1437.229) (-1431.402) [-1431.743] -- 0:00:42
      318500 -- [-1430.512] (-1435.746) (-1433.568) (-1430.944) * (-1431.456) (-1432.875) (-1432.158) [-1431.781] -- 0:00:42
      319000 -- (-1430.504) (-1432.903) [-1432.139] (-1430.202) * (-1434.330) (-1435.570) [-1432.742] (-1432.140) -- 0:00:42
      319500 -- [-1430.201] (-1432.424) (-1432.182) (-1432.058) * (-1432.776) (-1434.146) [-1432.480] (-1431.729) -- 0:00:42
      320000 -- (-1431.071) (-1430.526) (-1433.509) [-1431.166] * [-1431.676] (-1434.575) (-1432.057) (-1430.974) -- 0:00:42

      Average standard deviation of split frequencies: 0.017559

      320500 -- [-1438.250] (-1430.420) (-1430.459) (-1433.056) * [-1431.840] (-1438.699) (-1433.926) (-1431.075) -- 0:00:42
      321000 -- (-1434.680) (-1429.943) (-1434.631) [-1431.726] * (-1432.297) [-1431.494] (-1431.283) (-1432.872) -- 0:00:42
      321500 -- (-1433.572) [-1430.229] (-1432.122) (-1434.251) * [-1432.827] (-1431.449) (-1431.651) (-1433.182) -- 0:00:42
      322000 -- (-1433.115) [-1431.878] (-1431.275) (-1434.437) * (-1431.585) (-1434.124) [-1431.789] (-1433.191) -- 0:00:42
      322500 -- [-1431.510] (-1433.157) (-1432.853) (-1437.052) * (-1431.617) (-1437.190) (-1432.805) [-1430.156] -- 0:00:42
      323000 -- (-1432.740) [-1432.262] (-1431.565) (-1435.652) * (-1431.526) (-1433.619) (-1431.084) [-1430.487] -- 0:00:41
      323500 -- (-1431.404) (-1432.288) (-1430.839) [-1432.607] * (-1433.056) [-1434.977] (-1430.864) (-1431.389) -- 0:00:41
      324000 -- [-1432.342] (-1430.230) (-1432.316) (-1431.961) * (-1434.284) (-1433.987) [-1430.652] (-1431.418) -- 0:00:41
      324500 -- (-1431.828) [-1430.231] (-1430.573) (-1432.263) * (-1431.526) (-1431.475) (-1431.748) [-1431.282] -- 0:00:41
      325000 -- (-1435.661) (-1430.809) (-1430.682) [-1432.066] * (-1432.739) [-1436.199] (-1431.162) (-1437.535) -- 0:00:43

      Average standard deviation of split frequencies: 0.017593

      325500 -- (-1432.771) (-1430.876) (-1431.605) [-1431.758] * (-1432.319) (-1435.627) (-1433.216) [-1433.422] -- 0:00:43
      326000 -- (-1433.121) [-1432.617] (-1431.882) (-1431.097) * (-1430.817) (-1435.622) [-1434.301] (-1436.650) -- 0:00:43
      326500 -- [-1433.556] (-1432.893) (-1436.919) (-1430.750) * (-1431.101) (-1432.748) (-1430.639) [-1432.640] -- 0:00:43
      327000 -- (-1433.529) (-1434.345) (-1434.791) [-1431.620] * [-1431.156] (-1432.643) (-1430.487) (-1434.270) -- 0:00:43
      327500 -- [-1430.577] (-1434.174) (-1436.277) (-1430.577) * (-1431.142) (-1432.887) [-1431.175] (-1435.594) -- 0:00:43
      328000 -- (-1438.325) (-1431.989) (-1435.303) [-1431.776] * [-1433.673] (-1432.803) (-1432.361) (-1439.048) -- 0:00:43
      328500 -- (-1430.966) [-1433.648] (-1432.416) (-1430.705) * (-1431.680) (-1431.066) (-1432.555) [-1431.222] -- 0:00:42
      329000 -- [-1431.199] (-1433.452) (-1430.787) (-1435.880) * (-1432.321) (-1433.597) (-1431.859) [-1431.579] -- 0:00:42
      329500 -- (-1431.513) [-1430.948] (-1431.947) (-1433.427) * [-1431.641] (-1435.761) (-1432.404) (-1433.683) -- 0:00:42
      330000 -- (-1431.074) (-1431.475) (-1430.909) [-1437.985] * [-1431.487] (-1435.943) (-1434.819) (-1433.232) -- 0:00:42

      Average standard deviation of split frequencies: 0.017028

      330500 -- (-1433.420) (-1436.415) [-1430.069] (-1432.254) * (-1430.871) [-1431.390] (-1430.906) (-1433.328) -- 0:00:42
      331000 -- [-1431.570] (-1430.628) (-1430.208) (-1435.662) * (-1430.329) (-1433.403) [-1430.886] (-1432.059) -- 0:00:42
      331500 -- [-1439.346] (-1432.409) (-1430.663) (-1432.295) * (-1431.130) (-1433.200) [-1430.667] (-1432.689) -- 0:00:42
      332000 -- (-1430.690) (-1430.521) (-1431.164) [-1431.749] * (-1430.104) (-1435.375) (-1430.744) [-1432.186] -- 0:00:42
      332500 -- (-1430.792) (-1430.463) [-1433.737] (-1430.595) * (-1431.595) (-1431.800) [-1431.053] (-1431.901) -- 0:00:42
      333000 -- [-1431.322] (-1431.493) (-1431.513) (-1435.697) * (-1433.385) (-1434.865) (-1431.030) [-1432.539] -- 0:00:42
      333500 -- [-1431.445] (-1433.207) (-1436.300) (-1430.684) * (-1434.765) [-1432.334] (-1432.117) (-1430.437) -- 0:00:41
      334000 -- (-1431.077) [-1435.549] (-1432.772) (-1434.350) * (-1433.978) (-1435.890) (-1433.602) [-1430.548] -- 0:00:41
      334500 -- [-1434.161] (-1436.821) (-1431.059) (-1431.937) * (-1431.957) (-1431.046) (-1431.281) [-1432.359] -- 0:00:41
      335000 -- (-1433.322) (-1432.186) [-1430.887] (-1432.508) * (-1432.123) [-1431.323] (-1430.531) (-1432.981) -- 0:00:41

      Average standard deviation of split frequencies: 0.015901

      335500 -- (-1434.952) (-1431.656) (-1432.489) [-1432.056] * (-1434.167) (-1431.443) [-1430.524] (-1435.276) -- 0:00:41
      336000 -- (-1432.933) (-1431.812) [-1430.866] (-1432.967) * (-1434.688) (-1432.450) (-1430.545) [-1434.427] -- 0:00:41
      336500 -- [-1432.294] (-1434.722) (-1430.896) (-1434.990) * (-1431.461) (-1432.428) [-1430.225] (-1434.161) -- 0:00:41
      337000 -- (-1431.142) [-1431.641] (-1432.904) (-1433.436) * (-1431.504) (-1434.028) (-1431.870) [-1432.408] -- 0:00:41
      337500 -- [-1431.545] (-1435.107) (-1433.333) (-1440.508) * (-1432.034) (-1433.265) (-1431.960) [-1431.893] -- 0:00:41
      338000 -- [-1430.737] (-1435.711) (-1434.871) (-1438.778) * (-1433.054) (-1431.613) [-1431.816] (-1432.948) -- 0:00:41
      338500 -- (-1433.149) (-1431.993) [-1432.271] (-1432.245) * [-1433.877] (-1431.657) (-1431.216) (-1431.180) -- 0:00:41
      339000 -- (-1434.974) (-1431.069) [-1434.228] (-1432.123) * (-1436.551) (-1430.856) [-1431.278] (-1430.464) -- 0:00:40
      339500 -- (-1431.647) [-1431.302] (-1434.155) (-1431.427) * [-1436.696] (-1430.308) (-1433.375) (-1432.950) -- 0:00:40
      340000 -- [-1430.204] (-1430.714) (-1434.513) (-1435.887) * [-1433.640] (-1435.443) (-1431.741) (-1430.595) -- 0:00:40

      Average standard deviation of split frequencies: 0.015791

      340500 -- (-1431.341) [-1431.703] (-1432.816) (-1433.517) * [-1432.475] (-1435.636) (-1434.104) (-1431.417) -- 0:00:40
      341000 -- (-1430.326) [-1433.396] (-1432.052) (-1432.464) * [-1430.618] (-1433.251) (-1433.769) (-1433.675) -- 0:00:42
      341500 -- (-1431.599) [-1432.065] (-1432.052) (-1432.419) * [-1431.329] (-1431.550) (-1434.891) (-1434.247) -- 0:00:42
      342000 -- (-1431.388) [-1430.734] (-1431.370) (-1432.443) * (-1433.601) (-1434.018) (-1433.262) [-1432.624] -- 0:00:42
      342500 -- [-1430.398] (-1432.340) (-1433.710) (-1430.960) * (-1432.463) (-1434.354) [-1430.370] (-1432.280) -- 0:00:42
      343000 -- (-1433.822) (-1431.973) (-1432.143) [-1430.998] * (-1431.814) (-1432.613) (-1430.070) [-1430.001] -- 0:00:42
      343500 -- [-1431.038] (-1435.370) (-1433.481) (-1430.364) * (-1433.356) (-1432.065) [-1436.634] (-1430.424) -- 0:00:42
      344000 -- (-1433.752) [-1431.536] (-1432.766) (-1431.053) * [-1430.532] (-1434.811) (-1430.790) (-1430.893) -- 0:00:41
      344500 -- [-1432.098] (-1431.586) (-1441.747) (-1430.526) * (-1430.591) (-1432.786) (-1430.430) [-1430.844] -- 0:00:41
      345000 -- (-1430.406) (-1434.062) [-1434.318] (-1432.803) * (-1430.874) (-1432.854) [-1431.389] (-1437.152) -- 0:00:41

      Average standard deviation of split frequencies: 0.016189

      345500 -- (-1434.341) (-1439.183) [-1432.511] (-1430.876) * (-1432.325) (-1430.402) [-1433.329] (-1434.391) -- 0:00:41
      346000 -- (-1433.124) [-1433.863] (-1431.599) (-1432.141) * [-1431.540] (-1430.053) (-1430.541) (-1431.121) -- 0:00:41
      346500 -- (-1436.750) [-1433.229] (-1434.531) (-1436.825) * (-1433.035) (-1430.415) [-1430.535] (-1432.131) -- 0:00:41
      347000 -- (-1432.451) (-1432.957) [-1432.577] (-1441.738) * (-1431.820) [-1430.378] (-1430.240) (-1433.120) -- 0:00:41
      347500 -- (-1439.834) (-1430.520) [-1433.626] (-1435.908) * (-1435.946) (-1431.399) (-1430.876) [-1431.712] -- 0:00:41
      348000 -- [-1431.441] (-1431.563) (-1436.601) (-1433.619) * (-1431.349) (-1431.501) [-1432.295] (-1431.017) -- 0:00:41
      348500 -- (-1432.933) (-1432.882) (-1433.888) [-1432.504] * (-1434.176) [-1431.882] (-1431.843) (-1434.340) -- 0:00:41
      349000 -- [-1432.271] (-1431.663) (-1433.272) (-1430.818) * (-1435.870) (-1439.727) (-1432.752) [-1433.500] -- 0:00:41
      349500 -- [-1433.496] (-1437.428) (-1431.477) (-1432.617) * (-1430.712) (-1432.801) (-1434.233) [-1430.798] -- 0:00:40
      350000 -- (-1434.538) [-1434.081] (-1430.858) (-1438.792) * [-1430.260] (-1431.373) (-1433.180) (-1432.016) -- 0:00:40

      Average standard deviation of split frequencies: 0.016922

      350500 -- (-1431.684) (-1433.154) (-1433.716) [-1431.411] * (-1430.330) [-1434.260] (-1432.999) (-1430.786) -- 0:00:40
      351000 -- (-1431.749) (-1433.950) (-1434.356) [-1430.443] * (-1430.960) (-1431.193) [-1437.197] (-1434.147) -- 0:00:40
      351500 -- (-1434.991) (-1436.965) [-1431.453] (-1431.170) * [-1430.391] (-1434.050) (-1431.554) (-1432.867) -- 0:00:40
      352000 -- (-1432.873) (-1436.321) (-1432.851) [-1430.749] * [-1430.688] (-1431.364) (-1440.022) (-1431.487) -- 0:00:40
      352500 -- [-1432.060] (-1432.370) (-1431.027) (-1431.000) * (-1430.371) [-1431.341] (-1431.008) (-1434.490) -- 0:00:40
      353000 -- (-1430.807) (-1434.817) [-1430.899] (-1431.133) * [-1430.698] (-1431.129) (-1433.049) (-1430.397) -- 0:00:40
      353500 -- [-1431.738] (-1430.861) (-1433.858) (-1435.354) * (-1429.795) [-1431.067] (-1434.661) (-1431.073) -- 0:00:40
      354000 -- [-1433.561] (-1431.003) (-1430.782) (-1433.912) * (-1431.211) (-1432.290) [-1432.770] (-1430.965) -- 0:00:40
      354500 -- (-1437.386) [-1433.212] (-1432.599) (-1431.738) * (-1430.902) (-1432.826) (-1431.124) [-1430.262] -- 0:00:40
      355000 -- (-1434.466) (-1437.679) [-1430.305] (-1433.029) * [-1431.604] (-1430.691) (-1434.163) (-1432.351) -- 0:00:39

      Average standard deviation of split frequencies: 0.017604

      355500 -- [-1431.638] (-1432.821) (-1433.383) (-1436.518) * (-1431.526) (-1432.063) [-1436.416] (-1431.105) -- 0:00:39
      356000 -- [-1431.904] (-1433.401) (-1433.361) (-1433.211) * (-1432.299) [-1432.815] (-1431.149) (-1431.169) -- 0:00:39
      356500 -- (-1433.950) (-1432.663) (-1430.687) [-1431.138] * [-1434.130] (-1432.101) (-1433.395) (-1431.100) -- 0:00:39
      357000 -- (-1433.928) (-1430.970) [-1430.586] (-1432.885) * (-1434.140) [-1430.970] (-1432.883) (-1432.003) -- 0:00:41
      357500 -- (-1433.576) (-1432.806) (-1430.128) [-1431.621] * [-1432.681] (-1431.679) (-1433.259) (-1431.257) -- 0:00:41
      358000 -- (-1434.764) [-1430.140] (-1432.025) (-1431.338) * (-1434.582) [-1431.406] (-1433.618) (-1430.799) -- 0:00:41
      358500 -- (-1431.935) (-1432.767) (-1431.011) [-1431.796] * (-1432.707) [-1433.582] (-1433.560) (-1431.551) -- 0:00:41
      359000 -- (-1433.620) [-1431.531] (-1434.159) (-1432.413) * (-1434.010) (-1430.805) [-1434.232] (-1433.382) -- 0:00:41
      359500 -- (-1432.757) (-1430.856) [-1432.685] (-1430.936) * (-1433.773) (-1431.898) [-1435.991] (-1431.544) -- 0:00:40
      360000 -- (-1436.288) (-1432.442) (-1432.799) [-1430.330] * [-1430.761] (-1431.120) (-1432.387) (-1431.928) -- 0:00:40

      Average standard deviation of split frequencies: 0.017068

      360500 -- (-1431.959) (-1432.918) [-1431.397] (-1432.827) * [-1431.218] (-1431.197) (-1431.838) (-1431.082) -- 0:00:40
      361000 -- (-1433.664) (-1436.937) [-1432.696] (-1435.629) * (-1429.942) (-1432.748) [-1431.039] (-1432.153) -- 0:00:40
      361500 -- (-1432.355) (-1439.058) [-1432.773] (-1431.556) * (-1431.356) [-1432.034] (-1433.152) (-1433.628) -- 0:00:40
      362000 -- (-1433.650) (-1430.970) (-1434.992) [-1431.344] * (-1433.328) (-1431.738) (-1431.501) [-1433.182] -- 0:00:40
      362500 -- (-1431.563) (-1434.763) (-1432.919) [-1431.600] * [-1433.528] (-1432.719) (-1431.803) (-1431.830) -- 0:00:40
      363000 -- (-1432.767) (-1431.992) (-1438.456) [-1431.559] * (-1432.726) [-1431.986] (-1430.782) (-1432.607) -- 0:00:40
      363500 -- [-1433.903] (-1431.862) (-1434.190) (-1433.216) * (-1433.343) (-1431.824) (-1430.416) [-1432.597] -- 0:00:40
      364000 -- (-1430.658) (-1431.350) [-1432.915] (-1431.350) * (-1439.119) [-1434.094] (-1432.762) (-1433.635) -- 0:00:40
      364500 -- (-1433.705) (-1431.744) (-1433.837) [-1429.984] * [-1431.592] (-1435.571) (-1430.772) (-1434.922) -- 0:00:40
      365000 -- (-1435.002) (-1431.985) (-1434.187) [-1431.356] * (-1436.205) (-1433.440) [-1430.906] (-1431.611) -- 0:00:40

      Average standard deviation of split frequencies: 0.017047

      365500 -- [-1431.523] (-1432.957) (-1434.044) (-1432.363) * (-1435.898) (-1434.462) [-1433.190] (-1431.877) -- 0:00:39
      366000 -- (-1433.174) [-1433.208] (-1436.870) (-1432.303) * (-1435.395) (-1435.471) (-1431.599) [-1433.419] -- 0:00:39
      366500 -- (-1432.755) (-1431.299) (-1433.476) [-1437.517] * (-1435.564) (-1432.976) (-1432.195) [-1432.441] -- 0:00:39
      367000 -- (-1432.756) [-1431.601] (-1430.790) (-1434.478) * (-1433.369) (-1435.228) [-1433.315] (-1432.104) -- 0:00:39
      367500 -- (-1433.921) (-1431.352) [-1432.613] (-1430.912) * (-1434.033) (-1435.124) [-1431.693] (-1432.184) -- 0:00:39
      368000 -- [-1432.634] (-1432.455) (-1433.586) (-1433.880) * (-1432.483) (-1433.049) [-1434.317] (-1430.624) -- 0:00:39
      368500 -- (-1433.302) (-1434.580) [-1430.152] (-1433.896) * (-1434.258) (-1432.971) (-1435.616) [-1437.017] -- 0:00:39
      369000 -- (-1430.846) (-1435.941) [-1430.311] (-1432.992) * (-1439.715) [-1431.065] (-1434.069) (-1437.035) -- 0:00:39
      369500 -- (-1434.665) (-1432.366) [-1432.551] (-1433.942) * (-1430.705) (-1430.058) [-1430.389] (-1433.136) -- 0:00:39
      370000 -- [-1430.836] (-1431.912) (-1431.590) (-1430.889) * (-1433.921) [-1432.299] (-1430.785) (-1432.458) -- 0:00:39

      Average standard deviation of split frequencies: 0.016758

      370500 -- [-1434.711] (-1432.935) (-1431.883) (-1440.692) * (-1433.414) (-1432.946) (-1431.488) [-1432.611] -- 0:00:39
      371000 -- (-1431.041) (-1431.192) [-1432.217] (-1434.053) * (-1432.570) (-1432.897) [-1431.376] (-1431.281) -- 0:00:38
      371500 -- (-1430.197) (-1431.240) (-1432.752) [-1435.561] * (-1432.597) (-1433.413) [-1431.254] (-1431.640) -- 0:00:38
      372000 -- [-1430.359] (-1431.371) (-1435.448) (-1434.896) * (-1430.724) (-1432.215) [-1433.121] (-1432.395) -- 0:00:38
      372500 -- (-1432.264) (-1430.194) [-1432.193] (-1432.456) * (-1430.716) (-1431.870) [-1440.270] (-1432.583) -- 0:00:40
      373000 -- (-1433.357) (-1432.102) (-1432.777) [-1432.018] * (-1430.807) [-1431.174] (-1431.379) (-1433.864) -- 0:00:40
      373500 -- [-1432.770] (-1432.895) (-1432.784) (-1432.868) * [-1433.331] (-1430.974) (-1433.012) (-1432.142) -- 0:00:40
      374000 -- (-1430.934) (-1431.688) [-1433.207] (-1433.293) * (-1431.966) (-1432.013) (-1434.474) [-1430.914] -- 0:00:40
      374500 -- (-1431.256) (-1431.293) (-1437.022) [-1434.503] * (-1431.518) [-1432.024] (-1438.791) (-1435.233) -- 0:00:40
      375000 -- (-1432.850) [-1430.712] (-1432.023) (-1430.652) * [-1431.624] (-1432.882) (-1432.296) (-1433.061) -- 0:00:40

      Average standard deviation of split frequencies: 0.016741

      375500 -- (-1437.366) (-1430.676) (-1433.857) [-1433.501] * (-1431.248) (-1434.855) (-1431.953) [-1436.944] -- 0:00:39
      376000 -- (-1438.223) (-1430.267) (-1432.525) [-1431.371] * (-1430.182) (-1432.672) [-1432.232] (-1433.832) -- 0:00:39
      376500 -- (-1435.385) (-1430.310) (-1431.841) [-1431.550] * [-1435.079] (-1432.148) (-1433.174) (-1431.781) -- 0:00:39
      377000 -- (-1431.372) (-1433.387) (-1432.640) [-1432.369] * (-1436.121) (-1432.010) (-1432.269) [-1431.903] -- 0:00:39
      377500 -- [-1431.087] (-1432.969) (-1431.319) (-1437.111) * (-1434.577) (-1438.142) [-1432.287] (-1434.054) -- 0:00:39
      378000 -- (-1432.279) (-1434.300) (-1431.231) [-1433.147] * (-1430.152) (-1432.354) (-1434.077) [-1434.630] -- 0:00:39
      378500 -- (-1435.173) (-1433.896) [-1430.930] (-1432.107) * (-1430.497) (-1431.735) [-1431.918] (-1436.625) -- 0:00:39
      379000 -- (-1431.142) (-1432.258) [-1430.749] (-1430.769) * (-1430.595) (-1431.539) [-1433.361] (-1436.483) -- 0:00:39
      379500 -- (-1433.885) (-1434.874) (-1431.311) [-1431.292] * (-1432.396) (-1436.118) (-1434.181) [-1432.004] -- 0:00:39
      380000 -- (-1432.063) (-1431.489) (-1434.088) [-1431.471] * (-1431.485) [-1432.169] (-1435.936) (-1431.214) -- 0:00:39

      Average standard deviation of split frequencies: 0.016463

      380500 -- (-1431.651) (-1433.359) (-1434.167) [-1431.068] * (-1433.131) [-1432.261] (-1431.543) (-1433.169) -- 0:00:39
      381000 -- (-1433.015) (-1434.107) [-1434.771] (-1432.330) * (-1431.004) (-1432.627) (-1432.719) [-1431.258] -- 0:00:38
      381500 -- (-1434.059) [-1433.508] (-1432.849) (-1435.232) * [-1431.759] (-1434.668) (-1432.781) (-1430.403) -- 0:00:38
      382000 -- [-1432.460] (-1433.062) (-1432.788) (-1434.047) * [-1430.636] (-1435.476) (-1430.631) (-1433.612) -- 0:00:38
      382500 -- [-1430.846] (-1432.173) (-1436.691) (-1432.465) * (-1431.540) (-1431.575) (-1431.006) [-1430.432] -- 0:00:38
      383000 -- (-1430.417) (-1436.071) (-1434.892) [-1432.175] * (-1432.948) (-1431.829) (-1431.523) [-1431.417] -- 0:00:38
      383500 -- (-1431.894) [-1430.377] (-1434.684) (-1431.317) * (-1431.491) (-1432.452) (-1431.123) [-1431.073] -- 0:00:38
      384000 -- (-1431.426) (-1431.141) (-1430.087) [-1430.977] * [-1432.042] (-1434.331) (-1430.757) (-1434.248) -- 0:00:38
      384500 -- (-1430.422) [-1431.697] (-1431.755) (-1431.991) * [-1431.671] (-1431.805) (-1432.310) (-1431.553) -- 0:00:38
      385000 -- [-1430.146] (-1430.926) (-1430.781) (-1432.145) * (-1431.083) (-1432.469) (-1436.734) [-1431.948] -- 0:00:38

      Average standard deviation of split frequencies: 0.016738

      385500 -- (-1430.805) (-1430.821) [-1432.252] (-1433.342) * (-1431.744) [-1433.865] (-1433.540) (-1430.565) -- 0:00:38
      386000 -- [-1430.175] (-1430.577) (-1431.831) (-1435.256) * [-1432.567] (-1434.354) (-1432.531) (-1432.936) -- 0:00:38
      386500 -- (-1430.166) (-1431.168) [-1432.986] (-1431.601) * [-1432.424] (-1433.529) (-1431.279) (-1433.689) -- 0:00:38
      387000 -- (-1430.057) [-1431.165] (-1433.563) (-1431.323) * (-1431.608) (-1432.690) [-1433.408] (-1433.131) -- 0:00:38
      387500 -- (-1433.529) [-1431.726] (-1430.857) (-1431.091) * (-1430.368) (-1434.368) [-1437.742] (-1439.281) -- 0:00:37
      388000 -- (-1432.404) [-1430.975] (-1434.014) (-1431.143) * (-1430.919) (-1430.945) (-1442.444) [-1433.618] -- 0:00:37
      388500 -- (-1434.642) [-1432.278] (-1431.525) (-1431.083) * (-1430.693) [-1431.894] (-1433.422) (-1432.820) -- 0:00:39
      389000 -- (-1433.235) (-1434.494) (-1433.004) [-1431.979] * (-1432.243) [-1431.966] (-1431.799) (-1434.333) -- 0:00:39
      389500 -- [-1431.565] (-1431.209) (-1431.308) (-1432.321) * [-1431.571] (-1433.531) (-1431.367) (-1433.247) -- 0:00:39
      390000 -- [-1431.309] (-1430.770) (-1432.501) (-1433.128) * (-1433.434) (-1433.046) [-1431.653] (-1432.835) -- 0:00:39

      Average standard deviation of split frequencies: 0.015829

      390500 -- (-1432.575) (-1431.059) (-1430.820) [-1432.361] * [-1431.186] (-1434.341) (-1434.602) (-1430.303) -- 0:00:39
      391000 -- (-1433.277) (-1431.738) [-1433.307] (-1430.438) * (-1435.776) [-1433.674] (-1432.946) (-1430.303) -- 0:00:38
      391500 -- (-1432.672) (-1433.263) [-1430.577] (-1434.792) * (-1432.430) (-1432.471) [-1433.469] (-1430.610) -- 0:00:38
      392000 -- [-1432.062] (-1434.490) (-1431.391) (-1433.057) * (-1432.254) (-1433.255) [-1431.958] (-1432.519) -- 0:00:38
      392500 -- (-1431.452) [-1432.779] (-1434.892) (-1433.486) * (-1431.094) (-1433.760) [-1432.168] (-1432.068) -- 0:00:38
      393000 -- (-1431.640) (-1432.747) [-1430.409] (-1433.166) * [-1431.580] (-1437.275) (-1431.750) (-1433.026) -- 0:00:38
      393500 -- (-1432.597) (-1430.750) (-1431.160) [-1432.726] * (-1432.847) [-1433.718] (-1431.977) (-1434.586) -- 0:00:38
      394000 -- (-1432.293) (-1430.851) (-1431.821) [-1432.160] * (-1431.813) [-1433.800] (-1432.648) (-1431.112) -- 0:00:38
      394500 -- (-1431.939) [-1433.860] (-1435.583) (-1430.688) * [-1434.090] (-1433.717) (-1434.124) (-1433.636) -- 0:00:38
      395000 -- (-1434.242) (-1432.774) (-1434.334) [-1437.791] * [-1431.240] (-1431.201) (-1433.659) (-1434.668) -- 0:00:38

      Average standard deviation of split frequencies: 0.015685

      395500 -- (-1432.865) (-1434.764) [-1435.804] (-1430.758) * [-1433.729] (-1432.232) (-1434.402) (-1432.186) -- 0:00:38
      396000 -- (-1434.062) (-1433.407) [-1434.809] (-1433.358) * [-1430.751] (-1432.556) (-1436.848) (-1430.674) -- 0:00:38
      396500 -- [-1431.711] (-1430.519) (-1431.684) (-1431.766) * [-1432.451] (-1431.795) (-1433.149) (-1432.859) -- 0:00:38
      397000 -- (-1430.204) [-1432.002] (-1431.416) (-1431.202) * (-1432.343) (-1431.045) [-1431.546] (-1438.516) -- 0:00:37
      397500 -- (-1430.580) (-1432.014) (-1431.958) [-1431.616] * (-1435.288) [-1431.337] (-1433.251) (-1431.311) -- 0:00:37
      398000 -- [-1430.444] (-1431.741) (-1430.958) (-1431.066) * (-1435.116) (-1432.862) (-1432.326) [-1431.717] -- 0:00:37
      398500 -- (-1430.262) (-1433.714) (-1430.796) [-1430.406] * (-1435.076) [-1434.225] (-1435.709) (-1431.124) -- 0:00:37
      399000 -- (-1430.633) (-1436.086) [-1433.369] (-1433.688) * (-1433.815) [-1433.321] (-1434.202) (-1430.397) -- 0:00:37
      399500 -- [-1433.888] (-1436.264) (-1434.612) (-1435.741) * (-1430.390) (-1431.377) (-1433.889) [-1431.794] -- 0:00:37
      400000 -- (-1435.714) (-1431.495) [-1433.032] (-1438.634) * (-1431.834) (-1431.355) (-1433.498) [-1432.052] -- 0:00:37

      Average standard deviation of split frequencies: 0.014880

      400500 -- (-1431.643) [-1431.659] (-1435.136) (-1434.371) * (-1432.436) [-1430.839] (-1431.875) (-1431.401) -- 0:00:37
      401000 -- (-1430.900) (-1431.673) (-1436.025) [-1433.715] * (-1430.797) (-1432.709) (-1431.220) [-1432.941] -- 0:00:37
      401500 -- (-1430.781) (-1431.682) [-1432.183] (-1433.477) * [-1436.166] (-1435.203) (-1431.689) (-1430.672) -- 0:00:37
      402000 -- [-1433.332] (-1430.291) (-1432.275) (-1430.893) * (-1431.634) [-1431.057] (-1431.200) (-1431.055) -- 0:00:37
      402500 -- (-1431.659) [-1430.727] (-1431.213) (-1431.579) * (-1431.835) [-1434.093] (-1432.054) (-1432.078) -- 0:00:37
      403000 -- (-1431.466) [-1430.934] (-1430.310) (-1434.306) * (-1436.944) [-1431.235] (-1431.717) (-1434.232) -- 0:00:37
      403500 -- (-1430.151) (-1430.756) [-1430.363] (-1435.690) * (-1431.011) [-1433.970] (-1433.468) (-1433.456) -- 0:00:36
      404000 -- (-1432.790) [-1431.523] (-1430.876) (-1433.427) * [-1433.013] (-1433.240) (-1438.702) (-1430.964) -- 0:00:36
      404500 -- (-1433.251) (-1431.578) (-1431.227) [-1431.614] * (-1431.987) (-1432.811) [-1431.475] (-1431.268) -- 0:00:38
      405000 -- (-1433.203) (-1431.998) [-1433.497] (-1430.713) * [-1432.813] (-1431.043) (-1431.082) (-1431.956) -- 0:00:38

      Average standard deviation of split frequencies: 0.015299

      405500 -- (-1432.432) (-1432.483) (-1436.488) [-1430.577] * (-1433.690) [-1431.436] (-1435.667) (-1431.337) -- 0:00:38
      406000 -- (-1432.670) (-1432.778) (-1435.967) [-1430.854] * (-1431.705) [-1434.845] (-1432.760) (-1432.331) -- 0:00:38
      406500 -- [-1431.391] (-1433.858) (-1432.673) (-1431.787) * (-1430.325) [-1437.731] (-1433.229) (-1433.983) -- 0:00:37
      407000 -- (-1430.974) [-1435.737] (-1433.337) (-1430.670) * [-1431.093] (-1433.271) (-1432.185) (-1434.706) -- 0:00:37
      407500 -- (-1431.582) (-1432.398) [-1431.930] (-1430.399) * [-1431.104] (-1431.572) (-1430.514) (-1432.056) -- 0:00:37
      408000 -- (-1431.339) (-1434.442) [-1433.368] (-1430.166) * [-1430.315] (-1430.561) (-1432.101) (-1433.785) -- 0:00:37
      408500 -- (-1433.271) [-1432.516] (-1434.673) (-1437.409) * (-1433.517) [-1434.169] (-1430.317) (-1433.397) -- 0:00:37
      409000 -- (-1432.090) (-1430.944) [-1433.279] (-1430.680) * [-1433.133] (-1433.209) (-1435.694) (-1431.912) -- 0:00:37
      409500 -- (-1431.798) (-1431.222) (-1431.490) [-1431.095] * (-1433.154) (-1432.025) [-1432.341] (-1432.812) -- 0:00:37
      410000 -- (-1435.058) [-1431.897] (-1429.764) (-1434.185) * (-1433.829) (-1435.730) (-1431.487) [-1433.776] -- 0:00:37

      Average standard deviation of split frequencies: 0.014923

      410500 -- (-1430.937) (-1431.337) [-1431.794] (-1436.250) * (-1431.436) (-1431.422) [-1431.487] (-1434.770) -- 0:00:37
      411000 -- (-1431.168) (-1431.419) [-1432.681] (-1431.122) * (-1432.724) [-1430.769] (-1432.112) (-1436.279) -- 0:00:37
      411500 -- (-1432.789) (-1434.512) [-1431.555] (-1431.075) * (-1431.932) (-1431.359) [-1431.693] (-1433.831) -- 0:00:37
      412000 -- (-1432.701) (-1436.806) (-1430.857) [-1430.882] * (-1436.061) [-1431.337] (-1431.091) (-1431.475) -- 0:00:37
      412500 -- (-1432.304) (-1437.587) (-1430.285) [-1434.668] * (-1434.368) (-1431.440) [-1432.881] (-1430.564) -- 0:00:37
      413000 -- (-1433.545) (-1436.529) [-1430.430] (-1434.488) * (-1432.016) (-1432.948) (-1434.773) [-1430.784] -- 0:00:36
      413500 -- (-1435.086) (-1436.237) [-1430.712] (-1430.394) * (-1431.982) (-1432.520) (-1433.467) [-1432.123] -- 0:00:36
      414000 -- [-1432.373] (-1431.545) (-1431.958) (-1431.166) * [-1433.151] (-1432.059) (-1431.223) (-1434.772) -- 0:00:36
      414500 -- (-1432.062) (-1431.068) (-1431.906) [-1431.887] * (-1430.851) (-1430.463) [-1433.422] (-1436.572) -- 0:00:36
      415000 -- (-1430.706) (-1432.812) (-1434.615) [-1430.854] * [-1430.983] (-1431.230) (-1430.846) (-1432.813) -- 0:00:36

      Average standard deviation of split frequencies: 0.014465

      415500 -- [-1430.768] (-1431.518) (-1437.750) (-1432.089) * (-1430.743) [-1430.920] (-1431.699) (-1433.318) -- 0:00:36
      416000 -- [-1431.221] (-1431.575) (-1435.083) (-1430.941) * [-1430.857] (-1433.194) (-1432.391) (-1435.565) -- 0:00:36
      416500 -- (-1430.816) (-1430.393) (-1430.370) [-1432.647] * [-1431.224] (-1433.339) (-1432.069) (-1433.571) -- 0:00:36
      417000 -- (-1431.319) [-1433.887] (-1430.505) (-1430.986) * (-1430.930) (-1431.532) [-1431.901] (-1435.855) -- 0:00:36
      417500 -- (-1431.064) [-1433.524] (-1434.279) (-1436.277) * [-1432.242] (-1432.470) (-1431.247) (-1437.390) -- 0:00:36
      418000 -- [-1430.576] (-1431.345) (-1431.690) (-1433.622) * (-1433.559) (-1440.192) (-1430.208) [-1433.082] -- 0:00:36
      418500 -- (-1431.055) [-1433.480] (-1435.381) (-1431.148) * (-1431.088) (-1433.452) [-1432.364] (-1430.622) -- 0:00:36
      419000 -- (-1430.385) (-1431.447) [-1436.906] (-1431.041) * (-1431.484) (-1432.250) (-1432.704) [-1431.674] -- 0:00:36
      419500 -- [-1430.170] (-1431.784) (-1434.869) (-1431.731) * (-1431.340) (-1435.874) (-1436.867) [-1433.087] -- 0:00:35
      420000 -- (-1433.484) [-1434.857] (-1437.182) (-1433.004) * (-1435.701) (-1431.752) (-1432.285) [-1434.316] -- 0:00:35

      Average standard deviation of split frequencies: 0.014502

      420500 -- (-1430.325) [-1432.519] (-1433.704) (-1431.682) * (-1432.905) (-1432.493) [-1432.891] (-1435.930) -- 0:00:37
      421000 -- (-1430.399) (-1431.927) [-1432.821] (-1431.082) * [-1433.328] (-1431.493) (-1435.653) (-1440.790) -- 0:00:37
      421500 -- [-1431.488] (-1431.340) (-1431.970) (-1433.186) * (-1434.017) [-1430.176] (-1434.751) (-1431.338) -- 0:00:37
      422000 -- [-1431.329] (-1433.052) (-1430.635) (-1431.810) * (-1434.018) [-1430.123] (-1431.130) (-1431.354) -- 0:00:36
      422500 -- [-1431.839] (-1435.660) (-1434.102) (-1431.363) * (-1431.235) (-1430.186) (-1431.180) [-1431.426] -- 0:00:36
      423000 -- (-1431.096) [-1433.243] (-1433.044) (-1430.801) * (-1430.505) (-1431.920) [-1431.116] (-1431.988) -- 0:00:36
      423500 -- (-1431.214) (-1434.115) [-1431.395] (-1438.483) * (-1431.439) [-1433.096] (-1430.908) (-1430.869) -- 0:00:36
      424000 -- [-1431.859] (-1436.262) (-1431.843) (-1431.759) * (-1430.720) (-1431.700) [-1431.702] (-1431.232) -- 0:00:36
      424500 -- (-1432.503) (-1431.327) [-1432.756] (-1433.974) * (-1432.503) [-1430.257] (-1432.418) (-1431.113) -- 0:00:36
      425000 -- (-1430.658) [-1432.700] (-1431.673) (-1431.403) * (-1430.540) (-1430.929) (-1433.479) [-1430.474] -- 0:00:36

      Average standard deviation of split frequencies: 0.013995

      425500 -- (-1430.312) (-1433.301) [-1432.585] (-1431.368) * (-1431.943) (-1430.929) [-1430.830] (-1433.621) -- 0:00:36
      426000 -- (-1432.781) (-1432.206) [-1433.134] (-1430.964) * [-1429.953] (-1430.438) (-1431.831) (-1434.528) -- 0:00:36
      426500 -- (-1430.101) [-1430.818] (-1433.081) (-1432.603) * [-1430.951] (-1431.076) (-1433.520) (-1431.722) -- 0:00:36
      427000 -- (-1434.754) [-1429.996] (-1435.115) (-1432.027) * (-1430.572) [-1432.789] (-1433.954) (-1431.609) -- 0:00:36
      427500 -- (-1433.388) [-1432.656] (-1434.569) (-1431.693) * (-1430.718) [-1432.515] (-1432.849) (-1431.572) -- 0:00:36
      428000 -- (-1434.500) [-1433.741] (-1434.696) (-1432.541) * (-1430.778) (-1432.489) (-1434.976) [-1431.633] -- 0:00:36
      428500 -- (-1432.594) (-1437.316) [-1433.631] (-1437.673) * (-1433.772) [-1430.869] (-1431.681) (-1431.003) -- 0:00:36
      429000 -- (-1432.697) [-1434.781] (-1431.377) (-1437.930) * [-1433.592] (-1434.723) (-1432.507) (-1431.373) -- 0:00:35
      429500 -- (-1430.567) (-1435.173) [-1431.354] (-1438.417) * (-1431.903) (-1431.545) [-1431.424] (-1432.928) -- 0:00:35
      430000 -- [-1433.419] (-1431.244) (-1432.054) (-1434.101) * (-1432.680) [-1432.528] (-1431.417) (-1433.593) -- 0:00:35

      Average standard deviation of split frequencies: 0.013393

      430500 -- [-1431.988] (-1433.446) (-1432.899) (-1433.256) * (-1430.879) [-1430.763] (-1432.564) (-1431.285) -- 0:00:35
      431000 -- [-1432.596] (-1432.146) (-1431.598) (-1435.488) * [-1432.246] (-1432.114) (-1431.793) (-1434.049) -- 0:00:35
      431500 -- [-1431.065] (-1431.041) (-1431.494) (-1434.762) * (-1432.994) [-1433.150] (-1433.952) (-1435.571) -- 0:00:35
      432000 -- [-1432.794] (-1433.212) (-1431.392) (-1433.753) * (-1430.264) [-1432.101] (-1434.021) (-1435.320) -- 0:00:35
      432500 -- (-1432.795) (-1430.967) (-1432.028) [-1432.181] * (-1432.069) (-1431.924) [-1434.259] (-1434.326) -- 0:00:35
      433000 -- [-1433.554] (-1431.684) (-1432.593) (-1431.716) * [-1433.094] (-1431.656) (-1434.723) (-1430.392) -- 0:00:35
      433500 -- (-1431.489) (-1433.210) (-1432.923) [-1431.348] * (-1433.923) (-1433.147) [-1432.745] (-1431.868) -- 0:00:35
      434000 -- (-1431.504) [-1432.245] (-1433.302) (-1430.790) * (-1432.774) (-1433.256) (-1431.627) [-1434.458] -- 0:00:35
      434500 -- (-1433.089) (-1432.415) (-1432.392) [-1430.529] * [-1431.598] (-1434.062) (-1432.813) (-1434.727) -- 0:00:35
      435000 -- (-1432.584) (-1433.948) (-1433.336) [-1431.453] * (-1432.736) (-1433.350) [-1431.621] (-1433.864) -- 0:00:35

      Average standard deviation of split frequencies: 0.013292

      435500 -- [-1433.833] (-1439.345) (-1434.990) (-1432.621) * (-1432.821) (-1432.660) (-1430.460) [-1432.258] -- 0:00:34
      436000 -- (-1433.452) (-1434.919) (-1433.646) [-1431.209] * (-1431.914) [-1432.912] (-1431.779) (-1430.562) -- 0:00:34
      436500 -- (-1431.244) (-1433.402) (-1431.446) [-1434.690] * (-1431.498) (-1431.477) (-1434.438) [-1430.565] -- 0:00:36
      437000 -- (-1432.741) (-1432.228) [-1431.618] (-1435.132) * (-1432.059) (-1430.873) (-1434.405) [-1430.876] -- 0:00:36
      437500 -- [-1433.179] (-1432.435) (-1432.677) (-1434.807) * (-1431.936) (-1431.807) (-1437.078) [-1432.233] -- 0:00:36
      438000 -- (-1432.234) [-1433.777] (-1430.480) (-1440.425) * [-1437.525] (-1432.677) (-1434.712) (-1431.996) -- 0:00:35
      438500 -- (-1432.964) (-1433.309) (-1430.387) [-1437.379] * (-1432.627) (-1434.149) (-1431.858) [-1433.378] -- 0:00:35
      439000 -- (-1435.462) [-1430.988] (-1432.260) (-1435.640) * (-1431.743) (-1434.175) (-1434.368) [-1430.867] -- 0:00:35
      439500 -- [-1437.852] (-1431.118) (-1439.817) (-1434.374) * (-1430.757) (-1432.100) (-1432.442) [-1431.099] -- 0:00:35
      440000 -- (-1435.305) (-1431.189) [-1435.193] (-1432.653) * (-1430.433) (-1431.668) [-1433.818] (-1431.704) -- 0:00:35

      Average standard deviation of split frequencies: 0.012522

      440500 -- (-1434.685) [-1431.918] (-1432.824) (-1434.042) * (-1432.620) [-1432.838] (-1432.916) (-1432.911) -- 0:00:35
      441000 -- (-1433.332) (-1432.037) [-1434.377] (-1435.088) * [-1432.392] (-1432.336) (-1432.909) (-1433.563) -- 0:00:35
      441500 -- (-1430.851) [-1431.882] (-1431.188) (-1435.257) * (-1431.991) [-1430.944] (-1431.980) (-1430.640) -- 0:00:35
      442000 -- (-1435.185) (-1431.666) [-1432.914] (-1431.616) * (-1431.748) [-1432.568] (-1434.075) (-1430.640) -- 0:00:35
      442500 -- (-1433.215) (-1430.750) (-1432.570) [-1431.891] * [-1435.778] (-1431.751) (-1435.425) (-1432.212) -- 0:00:35
      443000 -- (-1431.657) (-1430.711) [-1433.408] (-1436.177) * (-1434.492) (-1432.171) (-1436.195) [-1434.159] -- 0:00:35
      443500 -- (-1432.450) (-1430.560) [-1431.510] (-1432.281) * [-1430.830] (-1432.242) (-1430.692) (-1431.099) -- 0:00:35
      444000 -- (-1434.441) [-1429.989] (-1431.935) (-1434.055) * [-1431.124] (-1432.401) (-1430.398) (-1430.423) -- 0:00:35
      444500 -- (-1431.888) [-1429.946] (-1432.623) (-1431.519) * (-1430.572) (-1433.715) [-1433.145] (-1432.428) -- 0:00:34
      445000 -- (-1431.867) [-1429.946] (-1431.977) (-1430.134) * [-1431.465] (-1431.132) (-1440.449) (-1431.913) -- 0:00:34

      Average standard deviation of split frequencies: 0.012497

      445500 -- (-1430.533) [-1430.583] (-1433.801) (-1430.683) * [-1432.326] (-1431.006) (-1435.310) (-1433.502) -- 0:00:34
      446000 -- (-1431.669) (-1430.953) [-1433.066] (-1430.890) * (-1431.821) (-1430.213) [-1432.123] (-1433.231) -- 0:00:34
      446500 -- [-1432.612] (-1430.843) (-1434.451) (-1431.483) * (-1433.924) (-1432.041) [-1430.711] (-1430.724) -- 0:00:34
      447000 -- (-1434.776) [-1430.751] (-1434.570) (-1431.020) * (-1432.221) (-1432.250) [-1431.272] (-1433.312) -- 0:00:34
      447500 -- [-1432.987] (-1431.586) (-1430.732) (-1431.342) * (-1434.170) (-1436.164) [-1430.792] (-1431.471) -- 0:00:34
      448000 -- (-1434.203) (-1433.618) [-1430.046] (-1432.763) * (-1430.947) (-1431.206) [-1432.923] (-1433.084) -- 0:00:34
      448500 -- (-1430.657) (-1431.322) [-1430.817] (-1432.407) * (-1434.760) [-1431.752] (-1432.170) (-1431.941) -- 0:00:34
      449000 -- (-1431.875) (-1431.859) (-1430.221) [-1433.783] * (-1433.487) [-1430.932] (-1432.785) (-1430.713) -- 0:00:34
      449500 -- (-1432.386) (-1432.908) [-1430.452] (-1436.891) * (-1435.987) [-1430.667] (-1431.689) (-1432.812) -- 0:00:34
      450000 -- (-1431.351) (-1432.135) [-1430.445] (-1431.596) * (-1434.632) (-1435.083) (-1432.536) [-1430.535] -- 0:00:34

      Average standard deviation of split frequencies: 0.013291

      450500 -- (-1433.457) [-1430.711] (-1432.995) (-1431.749) * (-1433.852) [-1432.619] (-1432.045) (-1430.286) -- 0:00:34
      451000 -- (-1430.936) (-1435.967) (-1431.385) [-1432.539] * [-1431.784] (-1430.540) (-1430.996) (-1431.245) -- 0:00:34
      451500 -- [-1430.030] (-1433.118) (-1434.426) (-1436.235) * (-1436.485) (-1434.659) (-1430.294) [-1431.785] -- 0:00:34
      452000 -- (-1432.748) [-1433.810] (-1432.621) (-1436.029) * [-1432.171] (-1430.571) (-1431.255) (-1430.155) -- 0:00:33
      452500 -- (-1433.012) [-1432.444] (-1436.343) (-1430.909) * (-1433.082) (-1430.686) (-1432.803) [-1434.285] -- 0:00:35
      453000 -- (-1431.052) (-1432.767) (-1433.739) [-1434.204] * (-1433.058) (-1430.816) (-1432.815) [-1432.694] -- 0:00:35
      453500 -- (-1431.946) (-1432.282) (-1442.338) [-1430.717] * [-1430.860] (-1436.231) (-1431.120) (-1430.879) -- 0:00:34
      454000 -- [-1430.081] (-1433.543) (-1438.825) (-1430.768) * (-1432.239) [-1432.124] (-1433.753) (-1431.342) -- 0:00:34
      454500 -- [-1432.575] (-1435.718) (-1431.124) (-1430.510) * [-1431.730] (-1433.395) (-1432.616) (-1431.656) -- 0:00:34
      455000 -- (-1435.065) (-1436.743) [-1431.992] (-1430.538) * (-1430.781) [-1431.343] (-1433.733) (-1432.070) -- 0:00:34

      Average standard deviation of split frequencies: 0.014108

      455500 -- (-1437.866) (-1433.557) (-1434.392) [-1431.869] * (-1432.445) (-1431.672) [-1431.161] (-1436.270) -- 0:00:34
      456000 -- (-1437.739) (-1430.569) [-1432.835] (-1432.150) * (-1432.187) (-1434.523) (-1431.710) [-1432.685] -- 0:00:34
      456500 -- (-1432.707) (-1430.126) (-1435.385) [-1431.360] * (-1431.795) (-1430.835) (-1431.734) [-1432.030] -- 0:00:34
      457000 -- (-1433.397) (-1430.253) [-1432.524] (-1430.402) * [-1431.366] (-1430.878) (-1430.710) (-1432.536) -- 0:00:34
      457500 -- [-1431.286] (-1430.510) (-1434.086) (-1431.473) * (-1431.527) (-1432.967) (-1431.234) [-1431.323] -- 0:00:34
      458000 -- (-1431.759) (-1431.592) (-1432.920) [-1433.060] * (-1433.544) (-1434.982) [-1431.481] (-1437.255) -- 0:00:34
      458500 -- [-1431.046] (-1433.093) (-1435.794) (-1433.023) * (-1432.639) (-1431.804) [-1430.944] (-1431.940) -- 0:00:34
      459000 -- (-1430.892) (-1433.592) (-1433.369) [-1431.413] * (-1430.493) (-1431.287) (-1431.452) [-1430.440] -- 0:00:34
      459500 -- (-1431.463) (-1432.930) (-1432.722) [-1432.241] * (-1431.290) [-1434.269] (-1432.316) (-1431.716) -- 0:00:34
      460000 -- (-1431.343) (-1433.194) (-1430.698) [-1433.233] * (-1434.115) (-1434.329) (-1431.712) [-1431.644] -- 0:00:34

      Average standard deviation of split frequencies: 0.014266

      460500 -- [-1433.426] (-1433.593) (-1430.182) (-1430.613) * [-1433.612] (-1433.978) (-1433.636) (-1432.209) -- 0:00:33
      461000 -- (-1430.289) [-1433.326] (-1431.451) (-1430.268) * (-1435.751) (-1434.810) (-1433.531) [-1432.058] -- 0:00:33
      461500 -- [-1430.100] (-1430.185) (-1431.036) (-1431.755) * [-1434.722] (-1435.669) (-1432.613) (-1431.950) -- 0:00:33
      462000 -- (-1430.711) [-1431.692] (-1437.962) (-1431.758) * [-1434.019] (-1431.980) (-1434.108) (-1433.843) -- 0:00:33
      462500 -- (-1433.135) (-1430.132) (-1435.183) [-1430.228] * [-1432.133] (-1436.246) (-1432.842) (-1432.494) -- 0:00:33
      463000 -- (-1432.327) (-1433.455) [-1435.365] (-1430.892) * (-1432.059) [-1431.070] (-1435.263) (-1431.568) -- 0:00:33
      463500 -- [-1438.265] (-1430.923) (-1430.970) (-1431.247) * [-1431.093] (-1432.416) (-1432.215) (-1434.490) -- 0:00:33
      464000 -- (-1435.583) (-1430.483) [-1435.491] (-1430.749) * (-1432.092) (-1435.261) [-1431.391] (-1435.842) -- 0:00:33
      464500 -- (-1430.368) (-1433.698) (-1432.686) [-1431.867] * (-1432.783) (-1430.771) (-1430.411) [-1432.401] -- 0:00:33
      465000 -- (-1432.621) [-1431.335] (-1431.035) (-1433.421) * [-1433.851] (-1431.492) (-1432.749) (-1431.250) -- 0:00:33

      Average standard deviation of split frequencies: 0.013746

      465500 -- (-1431.908) (-1431.514) [-1435.165] (-1438.755) * (-1432.744) (-1430.013) [-1432.640] (-1430.981) -- 0:00:33
      466000 -- (-1434.393) [-1432.045] (-1431.380) (-1431.227) * (-1432.355) (-1432.547) [-1432.304] (-1431.476) -- 0:00:33
      466500 -- (-1432.451) (-1430.926) [-1431.273] (-1436.952) * (-1438.219) (-1431.815) [-1431.986] (-1431.134) -- 0:00:33
      467000 -- (-1430.675) (-1433.231) [-1435.001] (-1430.595) * (-1434.503) [-1434.815] (-1432.698) (-1432.235) -- 0:00:33
      467500 -- (-1431.229) (-1434.515) (-1437.641) [-1431.655] * (-1433.058) [-1432.435] (-1434.690) (-1433.840) -- 0:00:33
      468000 -- (-1431.898) (-1430.774) (-1434.762) [-1431.681] * [-1430.772] (-1436.021) (-1432.026) (-1430.955) -- 0:00:32
      468500 -- (-1433.908) [-1430.931] (-1431.513) (-1431.001) * (-1432.392) (-1436.436) [-1430.048] (-1431.662) -- 0:00:34
      469000 -- (-1433.797) (-1433.174) [-1431.666] (-1431.305) * [-1432.403] (-1431.772) (-1432.604) (-1433.446) -- 0:00:33
      469500 -- (-1433.403) (-1432.609) (-1430.860) [-1431.644] * (-1430.481) [-1431.185] (-1433.672) (-1432.068) -- 0:00:33
      470000 -- (-1433.109) [-1432.397] (-1431.268) (-1430.785) * [-1431.212] (-1434.386) (-1435.799) (-1435.022) -- 0:00:33

      Average standard deviation of split frequencies: 0.013492

      470500 -- (-1433.487) (-1432.467) (-1437.992) [-1430.879] * (-1431.676) (-1435.660) (-1433.902) [-1432.801] -- 0:00:33
      471000 -- (-1433.867) (-1432.931) (-1434.072) [-1431.721] * (-1431.453) (-1434.656) [-1431.705] (-1433.197) -- 0:00:33
      471500 -- (-1432.340) [-1430.117] (-1431.542) (-1431.312) * (-1433.654) [-1437.908] (-1430.985) (-1430.675) -- 0:00:33
      472000 -- (-1430.671) [-1430.146]