--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:17:11 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/phhB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -390.66          -399.17
2       -390.60          -393.54
--------------------------------------
TOTAL     -390.63          -398.49
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896065    0.088902    0.378410    1.502819    0.868862   1415.48   1458.24    1.000
r(A<->C){all}   0.165019    0.019367    0.000122    0.449940    0.131654    142.65    186.04    1.003
r(A<->G){all}   0.159674    0.018150    0.000044    0.424713    0.122250    220.86    269.34    1.004
r(A<->T){all}   0.161734    0.018749    0.000033    0.434258    0.120526    190.06    257.26    1.000
r(C<->G){all}   0.169458    0.021540    0.000003    0.461421    0.128683    166.17    202.90    1.000
r(C<->T){all}   0.174571    0.021843    0.000093    0.465460    0.135446    211.14    250.35    1.000
r(G<->T){all}   0.169543    0.019047    0.000001    0.441900    0.133601     77.06    181.53    1.000
pi(A){all}      0.261786    0.000679    0.212504    0.314393    0.260734   1103.31   1136.90    1.001
pi(C){all}      0.283467    0.000729    0.230692    0.336275    0.282847   1236.95   1323.64    1.000
pi(G){all}      0.251990    0.000664    0.200828    0.299555    0.251770   1088.57   1250.66    1.000
pi(T){all}      0.202756    0.000576    0.158407    0.250571    0.202047   1346.26   1382.47    1.000
alpha{1,2}      0.433836    0.237591    0.000195    1.440011    0.258625   1247.64   1320.03    1.000
alpha{3}        0.463890    0.237626    0.000415    1.479485    0.293922   1130.15   1161.26    1.000
pinvar{all}     0.994280    0.000045    0.981676    0.999995    0.996463   1354.51   1357.29    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-370.571107
Model 2: PositiveSelection	-370.571121
Model 0: one-ratio	-370.571128
Model 7: beta	-370.571107
Model 8: beta&w>1	-370.571098


Model 0 vs 1	4.200000000764703E-5

Model 2 vs 1	2.8000000042993634E-5

Model 8 vs 7	1.799999995455437E-5
>C1
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C2
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C3
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C4
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C5
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C6
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=94 

C1              MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C2              MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C3              MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C4              MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C5              MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C6              MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
                **************************************************

C1              TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C2              TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C3              TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C4              TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C5              TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C6              TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
                ********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   94 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   94 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2820]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2820]--->[2820]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.452 Mb, Max= 30.617 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C2              MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C3              MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C4              MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C5              MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C6              MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
                **************************************************

C1              TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C2              TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C3              TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C4              TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C5              TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C6              TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
                ********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
C2              ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
C3              ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
C4              ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
C5              ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
C6              ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
                **************************************************

C1              CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
C2              CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
C3              CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
C4              CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
C5              CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
C6              CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
                **************************************************

C1              CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
C2              CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
C3              CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
C4              CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
C5              CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
C6              CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
                **************************************************

C1              ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
C2              ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
C3              ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
C4              ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
C5              ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
C6              ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
                **************************************************

C1              CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
C2              CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
C3              CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
C4              CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
C5              CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
C6              CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
                **************************************************

C1              TGGCACGCGATATCGACAGGCTCATCGGGGAC
C2              TGGCACGCGATATCGACAGGCTCATCGGGGAC
C3              TGGCACGCGATATCGACAGGCTCATCGGGGAC
C4              TGGCACGCGATATCGACAGGCTCATCGGGGAC
C5              TGGCACGCGATATCGACAGGCTCATCGGGGAC
C6              TGGCACGCGATATCGACAGGCTCATCGGGGAC
                ********************************



>C1
ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
TGGCACGCGATATCGACAGGCTCATCGGGGAC
>C2
ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
TGGCACGCGATATCGACAGGCTCATCGGGGAC
>C3
ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
TGGCACGCGATATCGACAGGCTCATCGGGGAC
>C4
ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
TGGCACGCGATATCGACAGGCTCATCGGGGAC
>C5
ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
TGGCACGCGATATCGACAGGCTCATCGGGGAC
>C6
ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
TGGCACGCGATATCGACAGGCTCATCGGGGAC
>C1
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C2
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C3
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C4
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C5
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C6
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 282 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579785342
      Setting output file names to "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 70596102
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9635301982
      Seed = 567445176
      Swapseed = 1579785342
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -631.129485 -- -24.965149
         Chain 2 -- -631.129485 -- -24.965149
         Chain 3 -- -631.129485 -- -24.965149
         Chain 4 -- -631.129485 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -631.129521 -- -24.965149
         Chain 2 -- -631.129521 -- -24.965149
         Chain 3 -- -631.129521 -- -24.965149
         Chain 4 -- -631.129485 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-631.129] (-631.129) (-631.129) (-631.129) * [-631.130] (-631.130) (-631.130) (-631.129) 
        500 -- (-400.803) (-399.487) (-405.952) [-401.019] * (-405.182) (-400.687) (-401.971) [-392.784] -- 0:00:00
       1000 -- [-396.370] (-411.304) (-407.345) (-398.791) * (-400.314) (-399.214) (-400.293) [-400.376] -- 0:00:00
       1500 -- [-398.073] (-404.423) (-399.064) (-395.813) * (-407.610) (-404.892) [-393.703] (-397.994) -- 0:00:00
       2000 -- (-399.517) [-398.614] (-396.632) (-400.123) * (-409.228) (-401.787) [-402.421] (-398.229) -- 0:00:00
       2500 -- (-397.874) (-405.155) (-395.842) [-396.746] * (-397.008) (-406.254) [-394.325] (-399.823) -- 0:00:00
       3000 -- (-401.156) (-400.171) [-395.300] (-399.252) * (-400.230) [-398.891] (-402.886) (-398.707) -- 0:00:00
       3500 -- (-401.754) (-400.089) [-395.136] (-403.508) * (-404.547) [-399.143] (-405.273) (-398.920) -- 0:00:00
       4000 -- (-410.280) (-400.355) (-410.552) [-401.343] * (-399.864) (-404.209) (-399.881) [-402.405] -- 0:00:00
       4500 -- (-406.116) (-401.037) [-398.274] (-410.259) * [-398.226] (-408.376) (-405.652) (-398.865) -- 0:00:00
       5000 -- (-398.368) [-403.381] (-397.672) (-402.364) * [-402.783] (-404.301) (-396.624) (-401.899) -- 0:00:00

      Average standard deviation of split frequencies: 0.070711

       5500 -- (-403.592) [-395.838] (-401.912) (-398.484) * [-395.293] (-402.753) (-396.326) (-397.873) -- 0:00:00
       6000 -- (-404.968) (-397.963) (-405.858) [-400.634] * (-392.808) (-398.240) [-398.767] (-404.637) -- 0:00:00
       6500 -- (-400.761) [-399.437] (-401.587) (-404.190) * (-404.229) (-400.014) [-396.187] (-403.715) -- 0:00:00
       7000 -- (-408.330) (-398.206) [-403.862] (-398.607) * (-400.303) (-406.636) [-405.037] (-402.091) -- 0:02:21
       7500 -- (-398.026) [-398.352] (-398.645) (-409.723) * (-401.416) [-400.617] (-408.274) (-399.248) -- 0:02:12
       8000 -- (-395.611) (-410.313) [-401.466] (-400.972) * (-400.246) (-417.274) (-408.251) [-397.795] -- 0:02:04
       8500 -- (-399.554) (-403.455) (-394.108) [-399.285] * (-403.512) (-391.759) [-399.328] (-407.971) -- 0:01:56
       9000 -- (-400.191) (-402.558) (-399.694) [-401.028] * (-406.034) (-394.421) (-394.730) [-394.447] -- 0:01:50
       9500 -- [-406.397] (-403.964) (-410.269) (-406.734) * (-393.257) [-390.230] (-396.142) (-397.505) -- 0:01:44
      10000 -- (-402.146) (-394.800) (-395.702) [-396.200] * (-399.516) (-391.744) (-393.176) [-401.675] -- 0:01:39

      Average standard deviation of split frequencies: 0.081410

      10500 -- (-405.306) (-411.408) [-404.378] (-398.135) * (-403.832) (-393.293) [-391.165] (-402.699) -- 0:01:34
      11000 -- (-408.171) (-398.823) (-398.174) [-402.669] * (-401.076) (-390.306) (-390.183) [-396.404] -- 0:01:29
      11500 -- (-403.222) [-396.813] (-396.528) (-396.543) * (-398.564) (-392.611) [-393.085] (-398.490) -- 0:01:25
      12000 -- [-399.233] (-406.613) (-405.282) (-397.439) * (-402.396) [-394.492] (-390.478) (-398.054) -- 0:01:22
      12500 -- (-396.358) (-393.923) [-403.218] (-403.681) * (-408.186) (-391.224) (-392.177) [-403.083] -- 0:01:19
      13000 -- (-399.404) [-394.744] (-399.909) (-398.648) * (-411.144) (-393.740) [-391.278] (-402.271) -- 0:01:15
      13500 -- (-398.174) (-399.070) [-397.036] (-396.605) * (-403.128) [-389.398] (-391.162) (-402.520) -- 0:01:13
      14000 -- [-402.198] (-400.997) (-408.753) (-399.661) * [-406.046] (-391.202) (-389.590) (-408.404) -- 0:01:10
      14500 -- [-398.402] (-398.559) (-395.346) (-400.026) * (-399.392) (-394.878) [-389.732] (-401.688) -- 0:01:07
      15000 -- (-400.175) [-396.003] (-396.140) (-400.493) * (-400.407) (-393.232) (-391.012) [-402.036] -- 0:01:05

      Average standard deviation of split frequencies: 0.069780

      15500 -- (-401.204) [-396.790] (-406.519) (-405.131) * [-402.981] (-391.003) (-390.239) (-415.436) -- 0:01:03
      16000 -- (-405.607) (-415.674) [-397.541] (-396.892) * (-401.506) (-389.935) [-390.247] (-413.225) -- 0:01:01
      16500 -- (-403.411) (-399.988) [-397.388] (-406.141) * (-404.992) (-391.550) [-391.193] (-392.602) -- 0:00:59
      17000 -- [-400.041] (-401.859) (-401.096) (-405.856) * (-404.838) [-389.648] (-391.927) (-390.396) -- 0:00:57
      17500 -- [-395.940] (-403.999) (-397.338) (-397.837) * (-403.297) [-391.322] (-391.511) (-389.778) -- 0:00:56
      18000 -- [-397.534] (-417.049) (-403.317) (-405.855) * (-407.149) (-395.351) [-393.518] (-390.073) -- 0:00:54
      18500 -- (-402.062) [-406.103] (-400.235) (-400.865) * [-400.885] (-391.612) (-396.600) (-390.782) -- 0:00:53
      19000 -- (-400.750) (-403.570) (-404.722) [-402.253] * (-402.941) (-391.355) (-402.241) [-389.841] -- 0:00:51
      19500 -- (-409.499) (-398.841) (-400.106) [-398.501] * (-403.553) (-391.441) (-390.890) [-389.553] -- 0:00:50
      20000 -- (-398.762) [-391.056] (-398.792) (-404.951) * (-407.095) (-390.252) [-390.611] (-391.471) -- 0:00:49

      Average standard deviation of split frequencies: 0.059559

      20500 -- (-399.016) (-392.926) (-403.496) [-400.271] * [-397.961] (-390.301) (-397.134) (-390.048) -- 0:00:47
      21000 -- [-399.516] (-390.626) (-401.030) (-400.819) * (-407.876) (-397.015) (-390.576) [-394.506] -- 0:00:46
      21500 -- [-395.717] (-392.381) (-398.724) (-404.989) * [-403.178] (-389.446) (-391.114) (-392.043) -- 0:00:45
      22000 -- [-395.487] (-394.378) (-409.932) (-396.208) * [-403.939] (-391.731) (-395.664) (-392.022) -- 0:00:44
      22500 -- (-401.485) (-394.941) (-415.250) [-401.096] * (-419.220) [-391.713] (-390.814) (-390.958) -- 0:01:26
      23000 -- [-395.636] (-402.666) (-404.663) (-403.793) * (-412.473) (-391.453) [-390.319] (-391.888) -- 0:01:24
      23500 -- (-405.268) [-395.165] (-400.453) (-397.985) * (-416.707) [-391.369] (-395.428) (-394.517) -- 0:01:23
      24000 -- (-400.489) [-390.857] (-404.771) (-401.424) * (-405.879) (-389.618) [-390.510] (-392.707) -- 0:01:21
      24500 -- (-400.654) (-390.672) (-399.939) [-398.630] * (-391.197) [-389.351] (-390.243) (-390.339) -- 0:01:19
      25000 -- [-398.144] (-390.475) (-409.492) (-409.416) * (-390.268) [-389.197] (-390.605) (-389.988) -- 0:01:18

      Average standard deviation of split frequencies: 0.034535

      25500 -- (-394.539) (-392.207) (-404.225) [-397.197] * (-392.831) [-389.767] (-395.890) (-390.861) -- 0:01:16
      26000 -- (-408.662) (-396.206) [-404.752] (-409.253) * (-391.410) (-395.389) [-391.512] (-396.975) -- 0:01:14
      26500 -- (-403.570) (-392.947) (-406.250) [-399.982] * [-391.924] (-391.324) (-391.971) (-392.115) -- 0:01:13
      27000 -- (-404.247) (-392.939) (-416.735) [-401.102] * (-390.337) (-390.428) [-392.259] (-392.993) -- 0:01:12
      27500 -- (-398.905) (-392.029) (-398.606) [-395.772] * (-391.607) (-389.578) [-391.658] (-389.953) -- 0:01:10
      28000 -- [-396.653] (-392.374) (-394.182) (-400.019) * (-390.456) [-390.261] (-391.400) (-391.073) -- 0:01:09
      28500 -- (-398.230) (-390.680) [-392.914] (-415.949) * [-390.865] (-392.133) (-392.525) (-391.027) -- 0:01:08
      29000 -- (-396.047) [-393.155] (-389.376) (-402.637) * [-392.251] (-394.003) (-393.129) (-390.605) -- 0:01:06
      29500 -- (-404.609) (-389.973) (-391.338) [-402.194] * [-392.617] (-393.433) (-391.674) (-391.540) -- 0:01:05
      30000 -- (-399.145) (-391.783) [-389.336] (-401.787) * [-390.277] (-392.640) (-390.269) (-392.506) -- 0:01:04

      Average standard deviation of split frequencies: 0.038025

      30500 -- (-401.830) [-389.655] (-390.687) (-412.473) * (-391.457) (-391.177) (-389.626) [-391.167] -- 0:01:03
      31000 -- (-402.178) (-391.321) [-389.992] (-401.470) * [-391.936] (-397.950) (-390.507) (-394.326) -- 0:01:02
      31500 -- (-404.253) (-393.187) (-394.757) [-396.999] * (-394.079) (-394.656) (-390.341) [-391.152] -- 0:01:01
      32000 -- [-395.530] (-391.628) (-391.814) (-401.535) * [-390.287] (-391.942) (-391.769) (-391.414) -- 0:01:00
      32500 -- [-396.664] (-391.202) (-391.042) (-404.811) * (-389.450) (-393.856) [-392.510] (-389.928) -- 0:00:59
      33000 -- [-401.704] (-397.080) (-392.224) (-404.934) * (-391.551) [-390.925] (-390.734) (-390.522) -- 0:00:58
      33500 -- (-398.008) (-392.701) [-390.734] (-403.238) * (-392.465) [-392.558] (-391.356) (-389.295) -- 0:00:57
      34000 -- (-398.014) (-393.392) [-389.393] (-400.403) * (-393.801) (-397.707) (-391.101) [-392.026] -- 0:00:56
      34500 -- (-402.313) (-391.551) [-388.884] (-393.907) * [-391.211] (-393.537) (-393.038) (-393.817) -- 0:00:55
      35000 -- [-401.821] (-390.800) (-391.038) (-407.594) * [-389.548] (-395.364) (-392.471) (-391.758) -- 0:00:55

      Average standard deviation of split frequencies: 0.031703

      35500 -- [-399.381] (-391.252) (-390.730) (-398.164) * (-390.742) [-393.481] (-394.455) (-392.291) -- 0:00:54
      36000 -- (-405.848) [-392.794] (-391.013) (-407.624) * (-390.375) (-393.085) (-391.838) [-390.601] -- 0:00:53
      36500 -- [-400.710] (-390.760) (-389.461) (-389.523) * [-390.025] (-393.916) (-390.600) (-391.389) -- 0:00:52
      37000 -- (-399.651) [-391.057] (-391.091) (-390.945) * [-389.902] (-393.296) (-390.819) (-393.082) -- 0:00:52
      37500 -- (-410.060) (-392.095) [-389.861] (-389.619) * (-390.541) (-392.714) [-391.119] (-389.571) -- 0:00:51
      38000 -- (-404.138) (-389.688) [-390.471] (-390.749) * (-391.612) [-390.540] (-390.990) (-391.687) -- 0:00:50
      38500 -- (-407.298) (-389.888) (-391.761) [-390.477] * (-390.306) [-389.600] (-392.419) (-394.303) -- 0:00:49
      39000 -- (-402.494) [-390.890] (-391.274) (-391.200) * (-392.063) (-389.606) [-390.919] (-390.265) -- 0:01:13
      39500 -- [-399.226] (-392.555) (-396.089) (-392.002) * (-394.782) [-389.969] (-392.575) (-391.206) -- 0:01:12
      40000 -- [-401.901] (-389.452) (-390.550) (-390.250) * [-390.764] (-391.795) (-394.833) (-391.518) -- 0:01:12

      Average standard deviation of split frequencies: 0.029895

      40500 -- (-405.101) (-393.661) [-392.521] (-392.858) * (-391.040) [-389.549] (-390.904) (-393.610) -- 0:01:11
      41000 -- (-403.894) (-395.660) [-395.108] (-396.030) * (-389.120) (-390.336) (-391.411) [-390.067] -- 0:01:10
      41500 -- (-421.008) (-391.366) [-390.484] (-392.418) * (-391.210) [-389.942] (-389.415) (-390.927) -- 0:01:09
      42000 -- (-411.179) (-391.111) [-391.273] (-390.836) * [-393.070] (-391.516) (-390.228) (-394.824) -- 0:01:08
      42500 -- (-400.429) (-391.143) (-389.556) [-397.017] * (-391.255) (-393.802) (-389.652) [-391.618] -- 0:01:07
      43000 -- (-391.713) [-390.591] (-391.346) (-396.329) * (-397.178) [-391.815] (-396.192) (-391.932) -- 0:01:06
      43500 -- [-393.182] (-391.840) (-391.681) (-392.679) * (-394.846) (-393.705) (-392.345) [-393.007] -- 0:01:05
      44000 -- (-392.309) [-392.474] (-391.118) (-390.382) * [-392.345] (-391.932) (-392.254) (-390.743) -- 0:01:05
      44500 -- (-393.963) (-399.756) [-390.558] (-392.454) * (-392.844) [-392.094] (-392.886) (-391.415) -- 0:01:04
      45000 -- (-392.204) (-391.447) [-392.876] (-392.522) * (-392.212) (-390.428) [-390.319] (-391.227) -- 0:01:03

      Average standard deviation of split frequencies: 0.024400

      45500 -- [-392.774] (-391.898) (-389.647) (-392.171) * (-390.952) (-391.521) (-389.365) [-392.744] -- 0:01:02
      46000 -- (-394.181) [-392.819] (-391.697) (-391.190) * [-390.552] (-395.109) (-390.503) (-390.334) -- 0:01:02
      46500 -- (-394.215) [-391.576] (-392.218) (-390.840) * (-393.826) (-389.986) (-390.395) [-389.389] -- 0:01:01
      47000 -- (-391.992) (-391.197) (-393.031) [-390.748] * (-390.731) (-390.147) [-390.385] (-395.227) -- 0:01:00
      47500 -- [-390.517] (-390.544) (-392.891) (-391.597) * [-390.011] (-389.796) (-391.137) (-390.295) -- 0:01:00
      48000 -- (-389.750) (-390.272) (-390.273) [-390.933] * [-389.894] (-395.005) (-393.331) (-392.435) -- 0:00:59
      48500 -- (-390.491) (-395.632) [-392.746] (-393.657) * (-390.569) (-392.953) (-393.647) [-393.369] -- 0:00:58
      49000 -- [-390.060] (-392.372) (-392.103) (-389.938) * (-390.300) [-391.186] (-389.751) (-391.286) -- 0:00:58
      49500 -- [-392.018] (-393.798) (-390.927) (-390.911) * (-392.074) (-391.894) (-391.037) [-389.452] -- 0:00:57
      50000 -- (-395.225) [-391.396] (-398.490) (-392.262) * (-393.583) (-392.844) [-391.338] (-389.742) -- 0:00:57

      Average standard deviation of split frequencies: 0.024106

      50500 -- (-393.056) (-390.097) [-395.489] (-391.412) * (-390.744) [-393.677] (-390.985) (-392.644) -- 0:00:56
      51000 -- (-389.477) [-389.966] (-393.672) (-392.611) * (-389.261) [-391.839] (-389.374) (-391.906) -- 0:00:55
      51500 -- (-389.447) [-389.477] (-389.980) (-391.963) * (-389.836) (-393.579) (-390.333) [-391.907] -- 0:00:55
      52000 -- (-393.977) (-391.636) (-393.804) [-391.791] * (-390.493) (-392.589) [-392.174] (-390.030) -- 0:00:54
      52500 -- (-390.278) (-391.916) [-389.693] (-389.078) * (-391.046) (-389.830) (-390.222) [-390.206] -- 0:00:54
      53000 -- (-391.157) (-390.163) (-389.086) [-389.965] * (-390.818) [-390.152] (-393.236) (-391.269) -- 0:00:53
      53500 -- (-389.631) (-391.117) [-390.400] (-390.721) * (-389.955) (-392.455) (-389.266) [-391.104] -- 0:00:53
      54000 -- [-390.918] (-393.007) (-392.687) (-390.140) * (-392.134) (-390.285) (-391.188) [-391.319] -- 0:00:52
      54500 -- (-389.822) (-390.820) [-390.947] (-390.634) * (-392.461) (-393.177) (-390.693) [-390.519] -- 0:00:52
      55000 -- [-390.135] (-389.455) (-391.172) (-390.021) * [-395.717] (-393.120) (-392.877) (-396.261) -- 0:00:51

      Average standard deviation of split frequencies: 0.021245

      55500 -- [-393.913] (-392.733) (-392.139) (-391.013) * (-393.043) (-394.215) (-397.060) [-395.255] -- 0:00:51
      56000 -- (-392.674) [-395.245] (-389.606) (-394.074) * (-389.415) (-392.849) (-393.663) [-393.774] -- 0:01:07
      56500 -- (-390.076) (-394.809) [-392.897] (-390.772) * [-393.059] (-396.235) (-392.388) (-393.389) -- 0:01:06
      57000 -- [-391.367] (-391.880) (-393.459) (-394.575) * [-391.135] (-396.808) (-391.973) (-393.320) -- 0:01:06
      57500 -- (-391.196) (-393.390) [-391.516] (-389.998) * [-390.727] (-395.295) (-391.483) (-393.567) -- 0:01:05
      58000 -- [-389.035] (-393.251) (-389.559) (-390.430) * (-392.904) [-393.123] (-391.600) (-392.990) -- 0:01:04
      58500 -- (-391.682) (-392.982) [-389.964] (-390.002) * [-390.133] (-390.605) (-389.992) (-390.647) -- 0:01:04
      59000 -- (-391.909) [-390.229] (-391.441) (-389.390) * [-389.609] (-393.914) (-390.219) (-389.684) -- 0:01:03
      59500 -- (-393.347) [-389.041] (-391.979) (-391.827) * (-391.070) (-392.069) (-392.665) [-389.497] -- 0:01:03
      60000 -- (-390.718) (-396.284) [-390.433] (-391.357) * (-392.035) (-391.081) [-392.612] (-391.242) -- 0:01:02

      Average standard deviation of split frequencies: 0.027585

      60500 -- (-397.789) (-391.434) [-391.368] (-389.153) * (-393.202) [-391.710] (-391.208) (-394.451) -- 0:01:02
      61000 -- (-396.719) (-391.319) (-394.022) [-390.851] * (-391.571) (-393.161) (-392.434) [-390.371] -- 0:01:01
      61500 -- [-394.270] (-389.554) (-391.485) (-390.690) * (-391.686) [-390.462] (-398.157) (-393.257) -- 0:01:01
      62000 -- (-389.765) (-389.837) [-391.935] (-392.586) * (-390.476) [-391.592] (-392.693) (-393.828) -- 0:01:00
      62500 -- (-391.871) (-390.856) [-391.835] (-393.150) * (-390.671) [-393.146] (-390.239) (-393.574) -- 0:01:00
      63000 -- (-390.231) (-389.772) (-389.510) [-391.951] * (-390.759) (-389.966) [-391.075] (-393.320) -- 0:00:59
      63500 -- [-390.862] (-392.129) (-390.239) (-390.201) * (-392.161) [-392.230] (-390.610) (-391.637) -- 0:00:58
      64000 -- (-391.161) [-390.012] (-392.351) (-393.854) * [-389.832] (-392.209) (-390.107) (-392.084) -- 0:00:58
      64500 -- (-391.314) [-390.202] (-391.277) (-391.622) * (-390.650) [-392.139] (-389.764) (-391.136) -- 0:00:58
      65000 -- [-391.881] (-390.168) (-393.660) (-392.075) * (-392.590) [-390.385] (-390.842) (-392.158) -- 0:00:57

      Average standard deviation of split frequencies: 0.021752

      65500 -- (-389.895) (-391.346) [-395.516] (-390.640) * (-390.412) (-392.833) [-392.180] (-392.181) -- 0:00:57
      66000 -- (-392.181) (-390.435) (-396.350) [-391.605] * (-394.500) (-390.763) (-391.134) [-391.231] -- 0:00:56
      66500 -- (-391.452) [-390.665] (-390.880) (-391.782) * (-393.613) (-390.736) (-390.383) [-391.771] -- 0:00:56
      67000 -- (-389.986) [-394.304] (-391.643) (-393.511) * (-389.904) (-389.494) [-389.388] (-390.970) -- 0:00:55
      67500 -- [-390.200] (-394.989) (-391.538) (-395.469) * [-392.102] (-389.441) (-392.584) (-390.490) -- 0:00:55
      68000 -- [-390.495] (-392.257) (-390.437) (-391.491) * (-392.220) [-389.330] (-390.542) (-393.534) -- 0:00:54
      68500 -- [-391.726] (-390.715) (-389.418) (-389.589) * (-391.671) (-389.720) (-390.928) [-390.132] -- 0:00:54
      69000 -- [-390.841] (-391.606) (-389.160) (-398.959) * (-392.425) (-393.471) (-390.499) [-395.107] -- 0:00:53
      69500 -- (-392.400) (-391.733) [-390.128] (-389.298) * (-391.792) [-390.903] (-391.836) (-392.497) -- 0:00:53
      70000 -- (-389.989) (-389.816) (-390.031) [-389.633] * (-392.246) [-389.659] (-389.459) (-390.135) -- 0:00:53

      Average standard deviation of split frequencies: 0.021753

      70500 -- (-393.751) (-389.920) [-389.980] (-389.764) * [-389.837] (-389.633) (-392.846) (-392.023) -- 0:00:52
      71000 -- (-394.249) [-389.922] (-389.479) (-390.297) * (-390.106) [-390.127] (-393.528) (-390.974) -- 0:00:52
      71500 -- (-399.369) [-390.660] (-393.015) (-390.478) * (-392.070) (-389.408) [-391.499] (-392.852) -- 0:00:51
      72000 -- (-390.045) (-392.191) (-392.284) [-392.130] * (-392.996) (-390.721) (-389.627) [-393.759] -- 0:00:51
      72500 -- (-392.353) (-393.152) (-393.691) [-392.551] * [-391.535] (-390.437) (-389.436) (-392.961) -- 0:00:51
      73000 -- [-390.979] (-395.024) (-394.647) (-389.549) * [-396.734] (-390.621) (-389.620) (-389.959) -- 0:01:03
      73500 -- [-389.296] (-393.107) (-392.196) (-392.226) * (-392.449) (-391.667) [-390.424] (-390.289) -- 0:01:03
      74000 -- (-391.523) [-390.006] (-391.498) (-395.231) * (-390.354) (-390.755) [-390.249] (-390.415) -- 0:01:02
      74500 -- (-392.113) (-389.503) [-389.281] (-389.275) * [-393.109] (-393.369) (-393.035) (-390.548) -- 0:01:02
      75000 -- (-390.358) (-389.726) (-389.424) [-391.816] * (-390.205) (-398.812) (-390.707) [-389.399] -- 0:01:01

      Average standard deviation of split frequencies: 0.022152

      75500 -- (-391.875) (-392.559) [-389.981] (-394.070) * (-390.516) (-393.255) (-391.398) [-389.906] -- 0:01:01
      76000 -- (-390.551) (-390.753) [-389.483] (-391.241) * (-390.207) (-394.586) [-390.463] (-389.607) -- 0:01:00
      76500 -- (-391.651) (-391.208) [-391.795] (-389.293) * [-393.388] (-390.684) (-390.926) (-391.099) -- 0:01:00
      77000 -- (-390.847) [-390.961] (-395.333) (-390.888) * (-394.800) [-390.086] (-391.466) (-390.305) -- 0:00:59
      77500 -- (-391.798) [-393.962] (-393.670) (-392.579) * [-393.038] (-394.393) (-389.481) (-390.416) -- 0:00:59
      78000 -- (-391.109) (-389.364) (-396.696) [-399.763] * (-390.750) [-390.683] (-390.838) (-389.971) -- 0:00:59
      78500 -- (-389.364) (-390.309) (-401.656) [-393.149] * (-390.736) (-394.451) [-389.312] (-392.673) -- 0:00:58
      79000 -- (-395.134) (-389.961) [-393.442] (-392.900) * [-391.548] (-391.958) (-392.343) (-393.478) -- 0:00:58
      79500 -- (-389.969) (-392.059) [-390.657] (-389.803) * (-390.450) (-390.448) [-396.602] (-393.983) -- 0:00:57
      80000 -- (-391.964) (-396.544) [-391.194] (-393.471) * [-389.984] (-392.951) (-394.857) (-389.051) -- 0:00:57

      Average standard deviation of split frequencies: 0.023991

      80500 -- (-391.291) (-400.917) [-390.448] (-391.548) * [-390.000] (-391.332) (-389.952) (-395.148) -- 0:00:57
      81000 -- (-397.029) (-392.576) (-393.871) [-393.556] * [-393.607] (-394.668) (-390.282) (-393.459) -- 0:00:56
      81500 -- (-391.925) (-391.305) (-392.512) [-392.144] * (-389.494) (-389.555) (-390.885) [-392.683] -- 0:00:56
      82000 -- [-390.164] (-389.811) (-399.371) (-391.229) * (-389.546) (-390.424) [-390.959] (-391.211) -- 0:00:55
      82500 -- (-392.037) (-400.800) [-395.237] (-391.795) * [-392.448] (-390.512) (-391.152) (-391.172) -- 0:00:55
      83000 -- [-391.385] (-393.763) (-397.495) (-393.866) * (-391.161) [-390.551] (-390.338) (-392.044) -- 0:00:55
      83500 -- (-390.515) (-395.784) (-393.014) [-390.178] * (-392.657) (-391.300) [-390.501] (-392.253) -- 0:00:54
      84000 -- (-392.161) [-391.699] (-402.137) (-389.394) * (-395.721) (-395.398) [-390.535] (-390.823) -- 0:00:54
      84500 -- (-390.456) (-390.923) (-393.793) [-389.072] * (-392.124) (-392.232) [-391.461] (-393.055) -- 0:00:54
      85000 -- (-390.718) (-394.793) (-390.027) [-389.994] * (-391.124) (-391.953) (-390.724) [-391.907] -- 0:00:53

      Average standard deviation of split frequencies: 0.020195

      85500 -- (-391.271) (-394.929) (-391.183) [-393.651] * (-391.747) (-394.335) [-392.517] (-391.211) -- 0:00:53
      86000 -- (-394.198) (-391.539) (-390.942) [-393.526] * (-395.173) (-392.980) (-391.085) [-391.670] -- 0:00:53
      86500 -- (-390.244) (-390.865) [-390.824] (-392.193) * (-391.516) (-398.329) (-390.562) [-391.213] -- 0:00:52
      87000 -- (-392.339) (-390.351) (-393.297) [-390.521] * (-392.550) (-395.362) (-393.005) [-390.339] -- 0:00:52
      87500 -- [-390.670] (-390.216) (-391.298) (-393.731) * (-391.916) (-398.324) [-393.143] (-390.458) -- 0:00:52
      88000 -- [-389.906] (-392.486) (-391.793) (-396.608) * (-391.835) [-392.656] (-389.422) (-390.309) -- 0:00:51
      88500 -- (-392.828) [-391.624] (-393.306) (-391.066) * [-392.270] (-389.700) (-391.501) (-392.618) -- 0:00:51
      89000 -- (-389.327) (-390.268) [-393.556] (-393.247) * (-391.686) [-391.168] (-393.846) (-392.763) -- 0:00:51
      89500 -- (-394.497) (-390.109) (-389.523) [-393.323] * (-391.715) [-391.362] (-392.574) (-390.387) -- 0:00:50
      90000 -- [-390.446] (-391.240) (-391.483) (-394.992) * (-391.460) (-388.987) [-390.005] (-391.320) -- 0:00:50

      Average standard deviation of split frequencies: 0.020524

      90500 -- [-390.126] (-389.600) (-397.443) (-391.407) * (-391.494) (-392.852) (-389.532) [-390.720] -- 0:01:00
      91000 -- (-392.981) (-391.563) [-392.916] (-394.603) * (-393.518) (-392.557) (-389.325) [-391.529] -- 0:00:59
      91500 -- (-395.102) (-391.144) (-395.650) [-391.981] * [-394.520] (-392.102) (-394.002) (-390.988) -- 0:00:59
      92000 -- [-390.301] (-391.144) (-393.525) (-392.738) * (-392.633) (-389.625) [-392.118] (-390.832) -- 0:00:59
      92500 -- (-390.401) (-393.078) (-395.446) [-390.609] * (-390.869) (-391.510) (-389.754) [-389.652] -- 0:00:58
      93000 -- (-389.793) (-392.190) (-393.322) [-389.591] * (-390.504) (-390.673) [-391.425] (-390.809) -- 0:00:58
      93500 -- (-390.193) (-391.325) [-391.224] (-397.464) * [-390.520] (-393.968) (-390.896) (-390.489) -- 0:00:58
      94000 -- [-389.784] (-396.686) (-390.457) (-389.867) * (-392.808) [-392.314] (-390.094) (-389.792) -- 0:00:57
      94500 -- (-391.468) [-390.373] (-396.938) (-392.498) * [-392.180] (-394.143) (-391.309) (-394.222) -- 0:00:57
      95000 -- (-390.996) [-389.962] (-397.050) (-394.503) * (-392.580) [-390.469] (-391.425) (-392.747) -- 0:00:57

      Average standard deviation of split frequencies: 0.018608

      95500 -- (-393.669) (-398.427) (-398.680) [-392.204] * (-392.818) (-390.804) [-391.305] (-391.449) -- 0:00:56
      96000 -- [-391.542] (-398.398) (-391.147) (-390.108) * (-390.236) (-391.460) (-391.746) [-391.997] -- 0:00:56
      96500 -- (-392.917) (-398.160) [-392.242] (-389.967) * (-394.360) [-389.953] (-389.723) (-392.966) -- 0:00:56
      97000 -- [-390.772] (-395.753) (-394.924) (-394.034) * (-390.591) (-390.957) (-391.551) [-393.624] -- 0:00:55
      97500 -- (-393.429) [-392.101] (-389.787) (-395.734) * [-393.785] (-391.110) (-389.458) (-392.762) -- 0:00:55
      98000 -- (-389.876) [-392.619] (-390.177) (-395.310) * (-394.593) [-390.631] (-397.946) (-392.293) -- 0:00:55
      98500 -- (-390.579) (-392.143) [-390.240] (-393.630) * [-389.978] (-392.884) (-394.277) (-391.033) -- 0:00:54
      99000 -- (-390.112) (-391.131) (-391.677) [-392.435] * (-396.938) (-389.793) (-393.451) [-391.732] -- 0:00:54
      99500 -- (-390.277) (-391.066) (-390.196) [-392.596] * (-394.235) (-390.219) (-392.535) [-389.568] -- 0:00:54
      100000 -- (-393.061) (-392.401) (-390.868) [-391.649] * (-392.872) [-391.703] (-392.333) (-389.802) -- 0:00:54

      Average standard deviation of split frequencies: 0.017253

      100500 -- (-393.358) (-389.641) [-390.328] (-391.268) * (-395.041) [-395.111] (-392.912) (-390.140) -- 0:00:53
      101000 -- [-390.270] (-392.806) (-389.879) (-395.802) * (-393.616) [-390.962] (-394.596) (-391.475) -- 0:00:53
      101500 -- (-391.391) [-391.252] (-392.635) (-391.372) * (-390.379) (-389.944) (-398.220) [-390.485] -- 0:00:53
      102000 -- (-390.152) (-391.662) (-393.914) [-390.310] * (-389.786) (-391.945) (-390.100) [-393.998] -- 0:00:52
      102500 -- (-391.598) (-390.255) (-391.579) [-390.522] * (-393.733) (-390.549) [-393.257] (-389.969) -- 0:00:52
      103000 -- (-391.085) [-394.855] (-391.354) (-391.577) * (-391.509) (-391.798) [-395.113] (-391.024) -- 0:00:52
      103500 -- (-392.494) (-392.097) (-391.991) [-390.730] * (-392.908) (-391.185) (-391.872) [-392.722] -- 0:00:51
      104000 -- (-392.156) (-393.536) (-392.525) [-390.008] * (-391.547) [-392.786] (-391.841) (-390.322) -- 0:00:51
      104500 -- (-390.823) [-390.582] (-390.192) (-391.138) * (-389.478) (-389.922) (-391.098) [-390.629] -- 0:00:51
      105000 -- [-391.099] (-393.169) (-394.234) (-391.180) * (-390.885) (-393.030) [-391.205] (-392.542) -- 0:00:51

      Average standard deviation of split frequencies: 0.018234

      105500 -- [-393.235] (-389.834) (-393.903) (-390.198) * (-391.691) (-393.262) (-389.479) [-391.004] -- 0:00:50
      106000 -- (-391.358) (-391.788) [-391.980] (-389.574) * (-391.892) [-392.565] (-391.597) (-391.075) -- 0:00:50
      106500 -- [-390.795] (-392.545) (-391.376) (-392.638) * (-391.359) [-391.541] (-391.425) (-390.670) -- 0:00:50
      107000 -- (-390.241) [-390.937] (-392.257) (-389.684) * (-395.355) [-393.972] (-391.381) (-391.110) -- 0:00:58
      107500 -- (-391.681) (-391.185) (-390.684) [-390.036] * (-390.636) (-391.407) (-390.710) [-389.787] -- 0:00:58
      108000 -- (-391.956) (-392.252) [-391.050] (-392.076) * (-393.435) [-392.783] (-392.905) (-392.638) -- 0:00:57
      108500 -- (-394.781) (-395.443) [-389.751] (-395.500) * (-390.482) (-391.140) (-391.273) [-390.452] -- 0:00:57
      109000 -- (-391.440) (-392.688) (-392.713) [-396.582] * (-390.070) [-390.042] (-392.475) (-391.465) -- 0:00:57
      109500 -- [-389.591] (-389.803) (-390.764) (-390.617) * (-390.698) [-390.624] (-390.810) (-392.562) -- 0:00:56
      110000 -- [-389.371] (-391.726) (-390.146) (-401.316) * (-390.439) [-391.834] (-391.975) (-390.466) -- 0:00:56

      Average standard deviation of split frequencies: 0.019281

      110500 -- (-390.138) (-391.987) [-390.007] (-398.399) * (-390.649) (-391.540) [-389.518] (-389.488) -- 0:00:56
      111000 -- [-391.110] (-391.206) (-390.757) (-393.439) * (-392.487) [-394.513] (-389.823) (-390.400) -- 0:00:56
      111500 -- (-394.601) (-391.400) (-390.294) [-392.464] * (-389.114) (-390.035) [-390.249] (-391.132) -- 0:00:55
      112000 -- (-391.049) [-392.511] (-389.926) (-391.849) * [-389.114] (-391.897) (-389.945) (-392.255) -- 0:00:55
      112500 -- [-391.245] (-392.939) (-391.766) (-395.669) * (-388.994) (-391.327) (-392.123) [-392.145] -- 0:00:55
      113000 -- (-390.537) (-390.171) (-393.481) [-389.607] * (-389.586) (-393.270) (-390.148) [-393.951] -- 0:00:54
      113500 -- (-390.499) [-390.277] (-396.374) (-393.300) * [-390.025] (-390.169) (-389.558) (-393.059) -- 0:00:54
      114000 -- [-391.632] (-394.164) (-390.365) (-392.601) * [-389.660] (-393.527) (-390.264) (-390.919) -- 0:00:54
      114500 -- (-389.694) (-394.860) [-389.643] (-391.888) * [-390.240] (-393.068) (-391.645) (-393.158) -- 0:00:54
      115000 -- (-392.617) (-391.627) (-390.089) [-390.523] * (-390.785) [-390.598] (-389.927) (-393.628) -- 0:00:53

      Average standard deviation of split frequencies: 0.019416

      115500 -- [-391.653] (-390.393) (-389.921) (-392.035) * (-394.762) [-391.053] (-393.378) (-394.961) -- 0:00:53
      116000 -- [-390.881] (-393.708) (-390.356) (-389.173) * (-393.675) (-391.962) (-395.862) [-391.593] -- 0:00:53
      116500 -- (-389.597) [-389.622] (-389.872) (-391.812) * (-390.372) (-391.724) (-390.770) [-389.360] -- 0:00:53
      117000 -- (-390.465) (-393.900) [-392.754] (-393.195) * [-391.487] (-392.220) (-392.849) (-390.066) -- 0:00:52
      117500 -- (-392.402) (-390.835) [-392.194] (-395.533) * (-390.803) (-390.400) (-394.619) [-392.329] -- 0:00:52
      118000 -- (-393.320) [-389.357] (-389.126) (-391.423) * (-389.662) (-390.533) [-390.973] (-390.993) -- 0:00:52
      118500 -- [-391.535] (-392.335) (-390.178) (-394.697) * (-394.677) (-391.211) [-390.569] (-392.484) -- 0:00:52
      119000 -- (-391.261) (-393.277) [-391.080] (-390.820) * (-395.820) (-391.995) [-389.830] (-391.508) -- 0:00:51
      119500 -- (-391.203) (-392.662) (-390.563) [-392.063] * (-392.091) (-390.903) [-392.852] (-392.334) -- 0:00:51
      120000 -- (-394.754) (-391.790) [-393.647] (-393.395) * [-395.915] (-391.649) (-391.705) (-391.099) -- 0:00:51

      Average standard deviation of split frequencies: 0.018068

      120500 -- (-392.178) (-391.154) (-399.518) [-391.161] * (-392.339) (-390.830) [-390.887] (-390.587) -- 0:00:51
      121000 -- (-390.707) [-391.414] (-392.509) (-391.073) * (-395.456) (-392.649) (-389.484) [-390.033] -- 0:00:50
      121500 -- [-390.796] (-390.080) (-392.449) (-389.470) * [-392.463] (-395.387) (-389.664) (-389.949) -- 0:00:50
      122000 -- (-391.461) (-390.885) (-392.937) [-394.208] * (-390.274) (-393.137) [-391.917] (-390.657) -- 0:00:50
      122500 -- (-391.554) [-391.834] (-392.536) (-390.836) * (-390.969) (-390.542) [-389.361] (-396.187) -- 0:00:50
      123000 -- [-390.148] (-389.809) (-394.817) (-391.031) * (-391.981) (-390.515) (-389.301) [-391.441] -- 0:00:49
      123500 -- [-393.781] (-391.544) (-393.359) (-390.455) * (-395.464) (-389.944) (-389.236) [-389.900] -- 0:00:49
      124000 -- [-391.521] (-391.332) (-395.662) (-397.649) * (-392.492) (-390.212) (-391.427) [-391.079] -- 0:00:56
      124500 -- (-391.458) (-393.156) [-392.480] (-393.935) * [-391.443] (-389.986) (-389.939) (-391.194) -- 0:00:56
      125000 -- [-391.495] (-392.303) (-391.109) (-398.449) * (-390.162) (-391.478) [-391.459] (-392.258) -- 0:00:56

      Average standard deviation of split frequencies: 0.019241

      125500 -- [-389.415] (-392.237) (-389.910) (-394.801) * (-395.517) (-389.525) [-391.265] (-390.301) -- 0:00:55
      126000 -- (-393.630) (-389.582) [-389.105] (-392.304) * (-391.694) (-390.681) [-391.933] (-389.493) -- 0:00:55
      126500 -- [-396.919] (-391.568) (-389.316) (-393.521) * (-390.582) (-390.389) [-389.546] (-390.899) -- 0:00:55
      127000 -- (-392.163) [-391.598] (-389.913) (-392.688) * (-390.798) (-390.497) (-390.531) [-390.469] -- 0:00:54
      127500 -- (-390.316) [-392.238] (-390.095) (-390.030) * (-389.060) (-393.274) [-391.179] (-389.552) -- 0:00:54
      128000 -- (-390.552) [-391.897] (-392.619) (-392.295) * (-397.523) (-390.499) (-393.241) [-391.303] -- 0:00:54
      128500 -- (-396.046) [-394.178] (-390.467) (-390.152) * [-393.017] (-391.507) (-392.727) (-392.581) -- 0:00:54
      129000 -- (-392.187) [-389.795] (-391.537) (-392.614) * (-394.254) (-392.352) (-390.072) [-391.123] -- 0:00:54
      129500 -- (-390.394) (-390.076) (-392.731) [-389.870] * (-395.878) (-389.751) (-389.979) [-389.720] -- 0:00:53
      130000 -- (-392.076) (-390.831) [-390.844] (-392.522) * (-393.094) [-389.725] (-389.753) (-390.936) -- 0:00:53

      Average standard deviation of split frequencies: 0.018897

      130500 -- (-392.871) (-390.356) [-389.651] (-391.665) * (-393.225) (-389.394) (-391.487) [-391.661] -- 0:00:53
      131000 -- (-392.354) (-391.303) (-391.275) [-393.985] * (-390.302) [-390.062] (-392.221) (-395.380) -- 0:00:53
      131500 -- (-391.624) (-389.696) [-389.669] (-390.663) * (-389.909) (-391.046) [-389.915] (-389.763) -- 0:00:52
      132000 -- (-393.279) (-389.359) (-391.142) [-391.772] * (-390.732) (-391.742) [-389.533] (-389.942) -- 0:00:52
      132500 -- (-392.505) (-390.996) [-391.937] (-390.602) * (-390.526) [-391.347] (-392.809) (-390.892) -- 0:00:52
      133000 -- (-389.502) [-392.015] (-391.654) (-390.483) * [-389.742] (-392.514) (-397.863) (-389.732) -- 0:00:52
      133500 -- (-390.902) (-391.233) (-396.267) [-389.933] * [-392.252] (-391.066) (-391.001) (-395.399) -- 0:00:51
      134000 -- [-390.758] (-389.069) (-389.581) (-391.159) * (-389.655) (-390.284) (-390.524) [-393.377] -- 0:00:51
      134500 -- (-394.776) (-391.750) [-393.835] (-392.849) * (-391.498) (-390.313) (-390.932) [-390.461] -- 0:00:51
      135000 -- (-390.827) (-397.351) (-391.852) [-390.280] * (-391.463) [-390.201] (-389.948) (-392.199) -- 0:00:51

      Average standard deviation of split frequencies: 0.017149

      135500 -- [-391.784] (-394.318) (-390.957) (-390.920) * [-390.973] (-392.798) (-389.788) (-389.687) -- 0:00:51
      136000 -- [-389.860] (-391.873) (-394.053) (-390.192) * [-394.643] (-390.643) (-392.419) (-393.531) -- 0:00:50
      136500 -- (-390.395) (-393.871) (-393.850) [-390.109] * (-393.384) (-392.689) [-392.134] (-393.456) -- 0:00:50
      137000 -- [-389.648] (-391.221) (-392.316) (-392.898) * (-391.330) [-392.489] (-391.773) (-392.413) -- 0:00:50
      137500 -- (-391.831) (-390.869) (-392.553) [-394.001] * (-390.855) (-390.833) (-390.744) [-390.485] -- 0:00:50
      138000 -- (-392.220) [-392.483] (-395.463) (-391.850) * (-395.122) (-390.668) (-391.863) [-395.430] -- 0:00:49
      138500 -- (-390.344) (-389.676) (-389.881) [-389.710] * (-398.947) (-392.681) (-396.043) [-391.880] -- 0:00:49
      139000 -- [-389.296] (-393.425) (-390.456) (-390.989) * (-392.372) [-391.754] (-393.138) (-390.513) -- 0:00:49
      139500 -- (-392.585) [-393.911] (-392.138) (-392.875) * [-393.786] (-393.611) (-390.212) (-393.440) -- 0:00:49
      140000 -- (-396.671) (-395.623) [-390.146] (-391.291) * (-393.456) (-390.186) (-393.430) [-391.234] -- 0:00:49

      Average standard deviation of split frequencies: 0.018167

      140500 -- [-390.321] (-390.880) (-390.096) (-392.539) * (-395.475) (-389.536) (-389.566) [-390.118] -- 0:00:48
      141000 -- (-392.929) [-392.485] (-392.110) (-389.975) * (-391.715) [-390.256] (-391.069) (-391.080) -- 0:00:48
      141500 -- (-392.364) (-390.838) (-392.054) [-390.117] * (-391.445) (-393.898) (-394.642) [-392.421] -- 0:00:54
      142000 -- (-392.921) (-390.277) (-389.989) [-390.120] * [-391.584] (-395.910) (-392.368) (-396.220) -- 0:00:54
      142500 -- [-390.907] (-392.142) (-393.114) (-389.253) * (-389.698) (-392.199) [-391.904] (-389.557) -- 0:00:54
      143000 -- (-391.802) (-390.197) (-392.748) [-390.104] * [-392.667] (-390.022) (-392.811) (-389.185) -- 0:00:53
      143500 -- [-393.546] (-389.679) (-393.439) (-390.108) * [-390.472] (-391.016) (-391.723) (-390.384) -- 0:00:53
      144000 -- (-390.036) (-394.359) [-391.093] (-392.807) * (-392.366) [-392.880] (-391.121) (-392.512) -- 0:00:53
      144500 -- (-389.938) (-391.870) [-392.717] (-390.529) * [-390.187] (-392.583) (-391.468) (-389.946) -- 0:00:53
      145000 -- (-395.801) [-390.530] (-393.578) (-391.189) * (-390.509) (-391.416) [-391.877] (-391.752) -- 0:00:53

      Average standard deviation of split frequencies: 0.017113

      145500 -- (-400.145) (-392.186) (-392.905) [-393.294] * (-390.109) [-392.011] (-389.796) (-392.868) -- 0:00:52
      146000 -- (-390.665) (-391.578) [-391.671] (-395.043) * (-391.821) (-392.492) [-391.214] (-394.579) -- 0:00:52
      146500 -- (-390.968) (-389.481) [-391.000] (-390.765) * (-392.473) (-391.171) (-393.962) [-389.808] -- 0:00:52
      147000 -- [-390.696] (-391.239) (-391.529) (-390.750) * (-392.648) [-394.049] (-391.359) (-390.808) -- 0:00:52
      147500 -- (-391.744) (-390.709) (-390.538) [-391.125] * (-391.391) (-390.168) (-390.354) [-394.652] -- 0:00:52
      148000 -- (-392.408) [-393.746] (-389.674) (-391.172) * (-389.764) [-390.237] (-391.065) (-392.494) -- 0:00:51
      148500 -- (-393.338) (-392.941) (-390.052) [-393.645] * [-394.500] (-389.926) (-391.042) (-392.172) -- 0:00:51
      149000 -- (-389.312) (-390.188) [-393.149] (-391.736) * (-391.719) (-391.007) (-391.197) [-390.918] -- 0:00:51
      149500 -- (-395.149) [-392.001] (-390.921) (-392.638) * (-391.106) [-389.351] (-392.512) (-391.691) -- 0:00:51
      150000 -- (-392.403) [-390.584] (-397.072) (-392.349) * (-390.209) (-389.571) (-393.943) [-392.753] -- 0:00:51

      Average standard deviation of split frequencies: 0.015175

      150500 -- (-391.573) [-389.701] (-391.159) (-396.453) * [-391.045] (-391.271) (-390.781) (-391.024) -- 0:00:50
      151000 -- [-390.830] (-389.816) (-391.308) (-392.222) * (-391.126) (-389.328) [-390.733] (-393.656) -- 0:00:50
      151500 -- (-392.016) (-389.341) [-391.821] (-396.494) * (-392.208) (-389.846) [-393.488] (-390.811) -- 0:00:50
      152000 -- [-392.913] (-390.705) (-390.750) (-395.454) * (-392.436) (-393.627) [-391.395] (-390.239) -- 0:00:50
      152500 -- (-389.998) [-390.994] (-389.897) (-390.179) * (-390.676) (-390.087) [-391.002] (-394.181) -- 0:00:50
      153000 -- (-392.244) [-390.399] (-390.035) (-392.131) * [-390.856] (-392.546) (-391.986) (-391.662) -- 0:00:49
      153500 -- (-389.949) [-391.819] (-393.590) (-390.891) * (-392.366) [-391.770] (-393.080) (-393.644) -- 0:00:49
      154000 -- [-391.565] (-394.684) (-392.553) (-394.222) * (-391.129) [-391.893] (-389.253) (-392.157) -- 0:00:49
      154500 -- (-392.018) (-390.847) [-391.054] (-391.868) * [-390.146] (-391.912) (-393.404) (-397.456) -- 0:00:49
      155000 -- (-393.123) (-391.254) (-390.438) [-391.230] * (-392.349) (-395.487) [-394.561] (-393.763) -- 0:00:49

      Average standard deviation of split frequencies: 0.013201

      155500 -- (-390.860) [-389.550] (-389.933) (-393.003) * (-391.781) (-390.204) [-393.567] (-390.592) -- 0:00:48
      156000 -- (-391.872) (-389.513) (-390.478) [-391.168] * (-393.715) (-390.400) [-391.821] (-392.309) -- 0:00:48
      156500 -- (-390.226) (-391.306) [-392.170] (-395.456) * [-389.854] (-390.437) (-394.990) (-390.752) -- 0:00:48
      157000 -- (-390.710) [-391.709] (-392.382) (-389.874) * [-390.459] (-391.179) (-390.777) (-389.037) -- 0:00:48
      157500 -- (-392.985) [-391.285] (-394.892) (-391.699) * (-389.901) (-391.282) [-390.109] (-394.784) -- 0:00:48
      158000 -- (-393.385) [-389.638] (-396.331) (-392.519) * (-390.714) (-394.813) [-396.924] (-389.861) -- 0:00:47
      158500 -- (-392.120) (-389.532) [-392.530] (-395.653) * (-391.655) (-395.198) (-392.512) [-389.330] -- 0:00:53
      159000 -- (-391.839) (-392.257) [-391.289] (-392.335) * (-390.045) (-390.597) [-390.256] (-391.694) -- 0:00:52
      159500 -- [-391.711] (-391.230) (-390.435) (-390.443) * (-393.564) [-389.989] (-391.334) (-389.191) -- 0:00:52
      160000 -- (-390.932) [-389.836] (-389.282) (-392.836) * [-392.089] (-394.589) (-390.125) (-390.452) -- 0:00:52

      Average standard deviation of split frequencies: 0.014377

      160500 -- (-391.437) [-392.002] (-394.388) (-394.671) * [-393.104] (-392.105) (-393.562) (-389.852) -- 0:00:52
      161000 -- [-393.150] (-389.995) (-390.099) (-392.043) * [-390.948] (-390.330) (-390.452) (-393.546) -- 0:00:52
      161500 -- [-390.115] (-391.103) (-392.055) (-392.586) * (-394.400) (-393.216) (-389.816) [-391.294] -- 0:00:51
      162000 -- [-391.159] (-389.909) (-390.115) (-394.246) * (-391.780) (-394.476) (-389.751) [-390.346] -- 0:00:51
      162500 -- (-390.909) (-390.931) (-390.499) [-391.771] * [-391.266] (-390.822) (-389.771) (-394.966) -- 0:00:51
      163000 -- [-392.159] (-390.031) (-391.024) (-391.172) * (-392.219) (-389.653) (-393.044) [-392.822] -- 0:00:51
      163500 -- (-399.199) [-390.803] (-389.950) (-392.276) * (-390.533) (-391.770) [-389.372] (-391.059) -- 0:00:51
      164000 -- (-389.901) (-395.228) (-392.303) [-391.236] * (-390.199) (-390.901) (-397.804) [-391.403] -- 0:00:50
      164500 -- (-391.135) [-390.934] (-389.673) (-392.343) * (-394.174) [-392.911] (-394.766) (-390.557) -- 0:00:50
      165000 -- (-390.251) (-392.926) (-389.942) [-391.471] * (-390.693) [-390.924] (-392.727) (-393.004) -- 0:00:50

      Average standard deviation of split frequencies: 0.013773

      165500 -- (-392.416) (-392.192) [-389.735] (-391.126) * (-391.984) [-390.790] (-390.470) (-391.806) -- 0:00:50
      166000 -- (-390.490) [-392.511] (-397.950) (-391.921) * [-389.061] (-390.059) (-392.574) (-392.448) -- 0:00:50
      166500 -- [-389.187] (-391.048) (-391.393) (-393.630) * (-392.250) [-389.336] (-392.639) (-392.147) -- 0:00:50
      167000 -- (-392.055) (-392.041) [-390.092] (-392.995) * (-389.623) (-394.189) (-392.825) [-390.172] -- 0:00:49
      167500 -- [-391.890] (-389.915) (-390.127) (-391.844) * (-389.441) (-392.714) [-391.526] (-389.586) -- 0:00:49
      168000 -- (-389.166) (-392.224) [-393.488] (-393.583) * (-392.061) [-392.084] (-389.142) (-389.556) -- 0:00:49
      168500 -- (-394.310) (-389.616) (-390.109) [-390.359] * (-391.883) (-390.503) (-394.475) [-394.386] -- 0:00:49
      169000 -- [-390.502] (-391.666) (-390.199) (-395.211) * [-390.172] (-392.216) (-389.248) (-394.291) -- 0:00:49
      169500 -- [-390.274] (-391.655) (-391.321) (-393.737) * (-389.346) [-389.529] (-391.983) (-391.424) -- 0:00:48
      170000 -- (-390.462) (-391.223) [-394.641] (-391.622) * (-390.936) (-393.065) (-391.181) [-390.983] -- 0:00:48

      Average standard deviation of split frequencies: 0.014885

      170500 -- (-390.674) [-395.707] (-392.265) (-389.602) * (-390.857) (-389.894) [-392.172] (-390.167) -- 0:00:48
      171000 -- [-390.305] (-393.138) (-389.648) (-391.988) * (-390.941) (-392.838) (-394.486) [-390.523] -- 0:00:48
      171500 -- [-390.847] (-390.462) (-392.844) (-391.867) * (-391.188) (-392.517) (-389.274) [-391.785] -- 0:00:48
      172000 -- (-394.221) (-390.372) (-395.080) [-391.893] * (-390.815) [-392.532] (-391.420) (-392.915) -- 0:00:48
      172500 -- (-395.103) (-390.231) [-395.344] (-391.104) * (-395.516) (-391.508) [-394.106] (-394.764) -- 0:00:47
      173000 -- [-392.000] (-392.200) (-391.175) (-390.937) * (-392.994) [-393.077] (-390.927) (-392.056) -- 0:00:47
      173500 -- (-395.042) (-391.951) (-390.359) [-391.321] * (-390.478) (-390.287) (-393.794) [-390.253] -- 0:00:47
      174000 -- (-390.786) (-391.045) [-389.635] (-396.814) * [-389.657] (-390.831) (-392.788) (-391.842) -- 0:00:47
      174500 -- [-389.526] (-390.802) (-392.807) (-390.108) * [-393.990] (-393.860) (-392.102) (-393.177) -- 0:00:47
      175000 -- (-389.177) (-393.530) (-392.437) [-390.352] * [-389.560] (-390.459) (-390.076) (-390.566) -- 0:00:47

      Average standard deviation of split frequencies: 0.014865

      175500 -- (-396.683) (-390.323) (-390.203) [-395.154] * (-389.452) (-389.900) [-390.971] (-389.920) -- 0:00:51
      176000 -- (-392.478) (-391.609) [-391.351] (-390.268) * (-390.041) (-392.521) [-393.413] (-390.712) -- 0:00:51
      176500 -- [-391.101] (-390.875) (-389.766) (-390.792) * (-393.175) [-392.042] (-393.281) (-392.373) -- 0:00:51
      177000 -- (-389.624) [-391.206] (-394.982) (-392.045) * [-393.004] (-391.412) (-393.648) (-390.440) -- 0:00:51
      177500 -- (-392.328) [-392.327] (-390.437) (-390.007) * (-391.076) (-389.787) [-391.954] (-390.038) -- 0:00:50
      178000 -- (-392.933) (-389.610) [-389.970] (-390.800) * (-392.205) (-393.993) [-389.975] (-396.432) -- 0:00:50
      178500 -- (-393.152) (-389.390) [-389.200] (-392.390) * (-389.549) (-392.598) [-389.323] (-389.557) -- 0:00:50
      179000 -- (-391.108) [-390.542] (-390.528) (-397.588) * [-390.232] (-395.061) (-395.429) (-392.552) -- 0:00:50
      179500 -- [-391.306] (-392.173) (-389.927) (-390.979) * (-390.981) [-389.966] (-391.607) (-390.897) -- 0:00:50
      180000 -- (-390.971) (-390.711) [-390.858] (-394.167) * [-396.389] (-391.342) (-390.150) (-390.990) -- 0:00:50

      Average standard deviation of split frequencies: 0.013792

      180500 -- (-394.969) (-391.729) (-391.724) [-390.976] * (-392.267) (-395.921) [-391.148] (-391.963) -- 0:00:49
      181000 -- (-391.557) [-397.776] (-394.110) (-392.310) * (-392.653) [-390.559] (-390.003) (-390.557) -- 0:00:49
      181500 -- [-389.255] (-391.061) (-390.689) (-389.817) * [-389.718] (-390.447) (-389.927) (-389.447) -- 0:00:49
      182000 -- [-390.073] (-389.907) (-391.949) (-390.781) * [-393.990] (-390.526) (-389.543) (-391.037) -- 0:00:49
      182500 -- [-392.934] (-389.789) (-392.164) (-391.893) * [-392.483] (-394.773) (-390.702) (-392.491) -- 0:00:49
      183000 -- (-394.022) (-390.345) [-391.305] (-389.428) * [-390.351] (-392.022) (-391.900) (-391.244) -- 0:00:49
      183500 -- (-390.832) (-392.989) [-390.381] (-391.369) * (-391.552) (-394.260) [-390.908] (-391.658) -- 0:00:48
      184000 -- (-390.064) [-389.447] (-390.004) (-389.685) * (-390.537) (-390.070) [-389.638] (-390.783) -- 0:00:48
      184500 -- (-391.417) (-389.216) [-393.792] (-393.655) * (-390.900) (-390.957) (-391.359) [-392.823] -- 0:00:48
      185000 -- [-391.599] (-390.559) (-391.581) (-395.264) * [-391.658] (-390.897) (-391.888) (-390.648) -- 0:00:48

      Average standard deviation of split frequencies: 0.013879

      185500 -- [-393.540] (-391.051) (-391.844) (-392.980) * [-392.051] (-392.107) (-392.243) (-393.667) -- 0:00:48
      186000 -- (-391.137) [-389.972] (-391.492) (-391.549) * [-393.751] (-392.977) (-392.491) (-391.403) -- 0:00:48
      186500 -- [-394.573] (-393.552) (-392.090) (-391.745) * (-391.595) (-391.472) [-394.523] (-391.364) -- 0:00:47
      187000 -- (-391.216) [-393.241] (-392.801) (-391.606) * (-390.542) (-392.544) (-395.875) [-391.872] -- 0:00:47
      187500 -- (-389.799) (-389.455) [-390.145] (-391.250) * (-391.480) [-390.243] (-395.850) (-390.092) -- 0:00:47
      188000 -- (-392.773) [-391.362] (-391.530) (-392.607) * (-391.937) (-390.866) (-392.880) [-390.468] -- 0:00:47
      188500 -- (-401.186) (-390.823) [-389.023] (-390.911) * (-390.201) (-391.055) [-389.999] (-390.306) -- 0:00:47
      189000 -- (-392.126) [-390.526] (-389.062) (-389.465) * (-392.629) (-392.072) (-389.927) [-389.911] -- 0:00:47
      189500 -- (-392.029) (-389.914) [-390.679] (-390.070) * (-392.134) (-390.617) [-390.673] (-391.171) -- 0:00:47
      190000 -- [-394.705] (-391.129) (-391.425) (-390.114) * (-392.489) [-392.464] (-390.010) (-390.570) -- 0:00:46

      Average standard deviation of split frequencies: 0.015355

      190500 -- (-391.105) (-390.881) [-390.250] (-389.939) * (-393.090) (-390.810) [-390.953] (-389.413) -- 0:00:46
      191000 -- (-395.275) [-392.548] (-390.976) (-391.819) * [-390.730] (-393.471) (-391.815) (-390.936) -- 0:00:46
      191500 -- [-390.259] (-394.557) (-392.749) (-389.595) * (-390.098) (-390.399) (-390.632) [-389.990] -- 0:00:46
      192000 -- (-391.443) (-390.761) [-389.594] (-389.796) * (-388.945) [-390.302] (-390.616) (-399.450) -- 0:00:50
      192500 -- [-390.961] (-393.192) (-389.877) (-397.094) * (-393.987) (-392.031) (-390.089) [-391.336] -- 0:00:50
      193000 -- (-397.080) (-394.147) (-392.882) [-399.665] * [-389.490] (-391.643) (-389.436) (-390.847) -- 0:00:50
      193500 -- (-391.893) (-390.213) [-389.350] (-393.774) * (-393.533) (-390.565) [-390.296] (-390.206) -- 0:00:50
      194000 -- [-392.300] (-394.901) (-392.255) (-390.408) * [-390.316] (-392.830) (-392.629) (-394.815) -- 0:00:49
      194500 -- [-390.203] (-395.190) (-392.208) (-390.401) * (-389.528) (-391.118) [-391.752] (-390.537) -- 0:00:49
      195000 -- (-391.516) [-390.034] (-392.257) (-391.140) * (-391.053) (-393.969) (-390.479) [-390.889] -- 0:00:49

      Average standard deviation of split frequencies: 0.015697

      195500 -- (-393.220) (-390.920) [-391.255] (-390.547) * (-391.447) (-391.172) (-396.176) [-390.392] -- 0:00:49
      196000 -- (-394.226) (-392.513) [-392.639] (-392.031) * (-393.677) (-395.991) (-396.008) [-389.401] -- 0:00:49
      196500 -- [-391.845] (-393.639) (-389.307) (-391.151) * (-397.087) [-392.295] (-392.861) (-391.746) -- 0:00:49
      197000 -- (-389.893) (-390.675) (-392.939) [-395.026] * [-390.484] (-393.240) (-390.875) (-391.484) -- 0:00:48
      197500 -- (-389.598) (-389.416) [-391.578] (-392.531) * [-389.611] (-389.885) (-392.180) (-390.567) -- 0:00:48
      198000 -- (-390.469) (-391.521) (-390.125) [-391.639] * (-391.656) (-392.019) [-392.574] (-393.314) -- 0:00:48
      198500 -- [-390.897] (-393.180) (-389.964) (-390.964) * (-394.185) (-391.893) (-390.575) [-392.219] -- 0:00:48
      199000 -- (-390.622) (-392.013) [-390.517] (-389.740) * [-390.372] (-392.595) (-393.608) (-389.607) -- 0:00:48
      199500 -- (-390.196) [-391.163] (-390.432) (-394.056) * [-390.577] (-391.736) (-394.440) (-389.813) -- 0:00:48
      200000 -- (-391.238) (-392.222) (-392.358) [-394.095] * (-391.308) [-390.348] (-390.566) (-396.492) -- 0:00:48

      Average standard deviation of split frequencies: 0.017227

      200500 -- (-390.691) (-390.362) [-390.241] (-393.144) * (-390.474) (-390.538) [-390.977] (-390.590) -- 0:00:47
      201000 -- (-391.870) (-391.003) [-391.199] (-392.811) * (-393.563) [-389.755] (-390.993) (-393.648) -- 0:00:47
      201500 -- (-394.767) [-393.636] (-392.097) (-395.276) * (-392.209) (-389.187) [-389.245] (-390.477) -- 0:00:47
      202000 -- (-394.678) (-389.686) [-389.319] (-392.555) * [-392.091] (-390.212) (-389.480) (-395.214) -- 0:00:47
      202500 -- [-393.000] (-392.093) (-389.643) (-390.718) * [-391.736] (-392.945) (-390.167) (-390.395) -- 0:00:47
      203000 -- (-391.767) [-390.060] (-389.787) (-391.087) * (-395.146) (-392.908) [-395.507] (-392.685) -- 0:00:47
      203500 -- [-390.203] (-390.528) (-392.084) (-391.908) * [-391.104] (-391.757) (-393.402) (-389.437) -- 0:00:46
      204000 -- [-389.652] (-391.983) (-390.486) (-392.488) * (-393.160) (-390.380) [-394.884] (-390.969) -- 0:00:46
      204500 -- (-392.547) (-391.289) [-390.135] (-394.129) * (-389.941) (-390.006) [-395.621] (-392.332) -- 0:00:46
      205000 -- (-389.242) (-389.932) (-389.933) [-393.183] * [-392.395] (-389.760) (-391.401) (-389.905) -- 0:00:46

      Average standard deviation of split frequencies: 0.015778

      205500 -- (-389.445) (-391.783) [-391.484] (-390.830) * [-392.108] (-392.329) (-389.938) (-389.955) -- 0:00:46
      206000 -- (-391.632) (-391.012) [-389.272] (-390.634) * (-390.965) [-389.501] (-393.151) (-391.392) -- 0:00:46
      206500 -- (-391.464) (-392.008) [-389.906] (-392.599) * (-391.126) (-391.726) (-391.816) [-391.352] -- 0:00:46
      207000 -- (-390.243) (-393.383) (-391.174) [-390.970] * [-393.739] (-392.646) (-390.636) (-393.615) -- 0:00:45
      207500 -- (-394.786) (-390.928) [-390.199] (-390.482) * [-392.370] (-390.110) (-391.118) (-391.426) -- 0:00:45
      208000 -- (-391.916) (-393.232) (-390.074) [-390.551] * [-391.466] (-389.864) (-391.506) (-390.804) -- 0:00:45
      208500 -- (-391.616) (-393.659) (-390.716) [-391.021] * [-389.632] (-390.209) (-392.273) (-390.129) -- 0:00:45
      209000 -- [-393.317] (-390.103) (-390.709) (-394.224) * (-394.186) (-391.178) [-396.166] (-392.245) -- 0:00:49
      209500 -- (-391.582) [-390.838] (-393.947) (-395.199) * (-390.964) [-392.698] (-395.075) (-393.308) -- 0:00:49
      210000 -- (-392.377) [-390.981] (-392.629) (-391.399) * (-393.021) [-389.196] (-393.899) (-391.066) -- 0:00:48

      Average standard deviation of split frequencies: 0.020007

      210500 -- [-391.359] (-391.451) (-389.285) (-392.142) * [-389.869] (-390.128) (-391.753) (-391.837) -- 0:00:48
      211000 -- (-390.917) [-391.710] (-391.207) (-391.950) * (-389.604) (-390.605) [-391.719] (-389.972) -- 0:00:48
      211500 -- (-395.633) (-392.143) (-392.358) [-389.817] * (-391.131) (-391.316) (-392.405) [-390.030] -- 0:00:48
      212000 -- (-391.224) [-390.529] (-393.814) (-392.522) * (-389.568) (-390.207) [-391.776] (-394.970) -- 0:00:48
      212500 -- [-389.544] (-389.722) (-391.436) (-390.822) * (-390.866) (-391.280) (-394.001) [-395.947] -- 0:00:48
      213000 -- (-394.428) (-392.216) [-391.765] (-391.471) * (-390.382) [-391.578] (-392.317) (-392.681) -- 0:00:48
      213500 -- (-389.411) [-391.764] (-390.956) (-393.798) * [-391.031] (-392.465) (-390.185) (-396.110) -- 0:00:47
      214000 -- (-390.473) [-390.991] (-393.487) (-396.439) * (-390.615) (-392.131) [-390.342] (-398.239) -- 0:00:47
      214500 -- (-390.566) (-390.638) [-390.294] (-398.208) * [-389.945] (-392.909) (-392.866) (-392.836) -- 0:00:47
      215000 -- (-392.041) (-392.234) (-390.402) [-393.463] * [-390.452] (-390.149) (-390.213) (-392.338) -- 0:00:47

      Average standard deviation of split frequencies: 0.018308

      215500 -- (-391.282) (-393.031) (-389.598) [-390.396] * (-390.357) [-393.863] (-390.467) (-392.666) -- 0:00:47
      216000 -- (-392.762) (-390.949) [-391.638] (-391.947) * [-389.568] (-392.439) (-389.613) (-391.208) -- 0:00:47
      216500 -- (-391.237) (-389.963) [-390.759] (-391.781) * [-389.452] (-391.466) (-391.692) (-390.672) -- 0:00:47
      217000 -- [-389.900] (-390.866) (-390.266) (-391.260) * (-391.544) (-391.114) (-391.796) [-389.832] -- 0:00:46
      217500 -- (-398.680) (-390.787) (-393.067) [-391.267] * (-392.694) (-391.292) (-390.705) [-390.517] -- 0:00:46
      218000 -- (-390.938) (-391.186) (-389.726) [-390.517] * [-393.843] (-389.289) (-392.317) (-390.992) -- 0:00:46
      218500 -- (-397.811) (-391.756) [-391.538] (-391.314) * (-389.396) (-391.121) [-389.133] (-391.372) -- 0:00:46
      219000 -- (-392.387) [-389.578] (-391.727) (-389.882) * (-392.137) [-391.299] (-392.816) (-389.394) -- 0:00:46
      219500 -- (-393.182) [-389.872] (-390.272) (-397.759) * (-393.346) (-390.874) (-391.415) [-390.656] -- 0:00:46
      220000 -- [-391.480] (-392.522) (-390.334) (-390.514) * (-397.049) [-392.515] (-389.289) (-389.946) -- 0:00:46

      Average standard deviation of split frequencies: 0.018472

      220500 -- (-391.690) (-390.654) (-392.345) [-391.435] * [-391.678] (-392.068) (-390.906) (-389.648) -- 0:00:45
      221000 -- (-392.100) (-391.729) (-390.614) [-392.019] * (-391.112) (-393.471) (-392.437) [-391.528] -- 0:00:45
      221500 -- (-389.750) (-390.613) (-394.435) [-391.036] * (-390.744) [-390.577] (-390.578) (-391.247) -- 0:00:45
      222000 -- (-390.207) [-390.742] (-390.948) (-389.651) * (-390.519) [-390.393] (-390.851) (-396.412) -- 0:00:45
      222500 -- (-393.526) (-390.123) (-392.573) [-391.777] * [-390.444] (-389.826) (-392.506) (-392.065) -- 0:00:45
      223000 -- (-392.096) (-393.293) [-390.537] (-391.524) * [-392.328] (-390.532) (-394.661) (-390.982) -- 0:00:45
      223500 -- (-392.968) (-391.592) [-394.402] (-390.813) * [-392.018] (-395.690) (-390.228) (-389.943) -- 0:00:45
      224000 -- (-391.347) [-392.054] (-390.371) (-393.206) * (-391.144) [-395.442] (-393.291) (-390.996) -- 0:00:45
      224500 -- (-390.128) (-395.542) (-392.160) [-391.043] * (-391.812) (-389.739) [-389.244] (-391.577) -- 0:00:44
      225000 -- [-392.131] (-389.782) (-394.212) (-391.676) * [-392.322] (-393.184) (-390.000) (-391.922) -- 0:00:44

      Average standard deviation of split frequencies: 0.017785

      225500 -- (-390.786) (-392.233) (-392.712) [-392.681] * (-391.138) [-390.609] (-390.304) (-394.660) -- 0:00:44
      226000 -- (-394.399) (-392.348) [-392.342] (-391.343) * [-389.508] (-389.480) (-390.748) (-394.158) -- 0:00:47
      226500 -- (-392.802) [-389.943] (-392.699) (-392.793) * (-390.542) (-393.610) (-389.475) [-391.910] -- 0:00:47
      227000 -- (-389.946) [-391.893] (-392.617) (-390.607) * (-391.892) (-392.067) (-390.610) [-390.339] -- 0:00:47
      227500 -- (-392.151) (-390.064) [-389.679] (-392.980) * (-391.525) [-390.130] (-391.415) (-390.442) -- 0:00:47
      228000 -- (-391.338) [-393.263] (-390.093) (-392.313) * (-396.780) (-390.884) [-389.999] (-391.183) -- 0:00:47
      228500 -- (-393.345) [-391.718] (-391.377) (-393.359) * [-391.585] (-390.901) (-392.235) (-389.670) -- 0:00:47
      229000 -- (-391.187) [-390.700] (-392.113) (-389.720) * [-390.583] (-390.538) (-389.122) (-390.038) -- 0:00:47
      229500 -- (-393.863) (-390.856) (-391.427) [-389.167] * [-389.845] (-389.391) (-392.206) (-390.873) -- 0:00:47
      230000 -- (-392.538) (-389.710) (-390.106) [-390.502] * [-389.726] (-392.093) (-393.254) (-390.485) -- 0:00:46

      Average standard deviation of split frequencies: 0.017882

      230500 -- (-390.651) (-390.244) (-389.920) [-389.801] * (-389.470) (-392.697) (-389.809) [-391.827] -- 0:00:46
      231000 -- (-392.118) (-390.177) (-390.903) [-395.692] * (-389.605) [-392.426] (-391.398) (-390.993) -- 0:00:46
      231500 -- [-390.905] (-390.019) (-391.833) (-392.428) * [-390.043] (-393.489) (-390.828) (-389.625) -- 0:00:46
      232000 -- [-394.716] (-391.869) (-393.401) (-391.716) * [-390.353] (-390.591) (-390.666) (-391.024) -- 0:00:46
      232500 -- (-396.616) (-389.155) [-390.530] (-390.792) * (-391.057) [-389.968] (-397.363) (-390.982) -- 0:00:46
      233000 -- [-392.250] (-390.811) (-390.080) (-395.080) * (-391.644) [-391.036] (-392.674) (-391.835) -- 0:00:46
      233500 -- (-391.540) (-392.092) (-390.492) [-391.718] * (-390.943) (-390.689) [-390.893] (-393.008) -- 0:00:45
      234000 -- (-389.658) [-391.706] (-393.929) (-394.485) * (-390.324) (-393.622) (-392.337) [-396.918] -- 0:00:45
      234500 -- (-393.401) (-392.530) [-393.053] (-393.189) * (-391.605) (-389.799) [-393.765] (-392.143) -- 0:00:45
      235000 -- [-393.657] (-390.973) (-393.456) (-390.558) * [-389.541] (-397.625) (-393.676) (-391.276) -- 0:00:45

      Average standard deviation of split frequencies: 0.018976

      235500 -- (-393.010) (-391.225) (-395.746) [-391.308] * (-391.308) (-390.309) [-389.626] (-395.788) -- 0:00:45
      236000 -- (-389.263) [-390.264] (-393.458) (-394.663) * (-392.173) (-393.551) [-391.065] (-396.306) -- 0:00:45
      236500 -- [-389.409] (-390.569) (-393.231) (-390.496) * (-389.477) (-390.220) (-393.096) [-391.459] -- 0:00:45
      237000 -- [-389.164] (-390.141) (-392.711) (-390.642) * (-389.452) (-389.322) (-392.629) [-391.618] -- 0:00:45
      237500 -- [-390.550] (-390.469) (-390.773) (-389.407) * (-389.058) (-392.792) (-390.472) [-390.648] -- 0:00:44
      238000 -- [-390.288] (-391.045) (-389.662) (-393.452) * [-388.987] (-390.853) (-393.310) (-390.695) -- 0:00:44
      238500 -- (-390.078) [-389.642] (-391.391) (-393.600) * [-389.869] (-390.077) (-395.635) (-390.237) -- 0:00:44
      239000 -- (-391.484) (-389.695) [-390.151] (-392.039) * (-390.618) (-389.825) (-396.593) [-391.403] -- 0:00:44
      239500 -- (-392.736) (-389.750) [-390.553] (-393.756) * [-393.713] (-391.498) (-394.323) (-394.047) -- 0:00:44
      240000 -- (-394.545) [-390.147] (-389.996) (-389.957) * (-391.348) (-390.575) (-396.730) [-390.092] -- 0:00:44

      Average standard deviation of split frequencies: 0.018173

      240500 -- (-393.490) (-391.196) (-391.109) [-396.152] * (-391.117) (-392.279) [-392.704] (-389.477) -- 0:00:44
      241000 -- (-391.433) (-392.207) [-391.277] (-391.509) * (-391.394) [-391.185] (-397.014) (-390.417) -- 0:00:44
      241500 -- (-390.762) (-390.614) (-397.424) [-390.453] * (-392.282) [-389.617] (-391.348) (-391.320) -- 0:00:43
      242000 -- (-389.260) (-393.939) (-390.019) [-390.825] * [-390.583] (-395.091) (-389.716) (-391.909) -- 0:00:43
      242500 -- (-392.461) [-390.533] (-392.807) (-396.688) * (-396.046) (-391.940) [-390.787] (-392.631) -- 0:00:43
      243000 -- (-393.591) [-392.478] (-393.016) (-390.349) * [-392.433] (-394.115) (-393.240) (-390.191) -- 0:00:46
      243500 -- (-391.210) (-389.670) (-390.680) [-392.420] * (-393.287) [-391.805] (-396.511) (-388.962) -- 0:00:46
      244000 -- (-392.854) (-390.284) [-390.381] (-390.539) * (-392.548) [-391.150] (-392.920) (-389.716) -- 0:00:46
      244500 -- (-393.268) (-389.546) (-389.907) [-391.059] * [-390.367] (-392.205) (-390.920) (-390.163) -- 0:00:46
      245000 -- (-390.287) [-389.803] (-393.427) (-391.459) * (-391.421) [-395.783] (-391.243) (-391.538) -- 0:00:46

      Average standard deviation of split frequencies: 0.016608

      245500 -- (-390.587) (-389.897) [-392.268] (-391.984) * (-390.003) (-391.509) [-390.906] (-390.134) -- 0:00:46
      246000 -- (-390.240) [-389.570] (-395.395) (-391.493) * [-389.423] (-392.989) (-392.466) (-392.940) -- 0:00:45
      246500 -- [-392.895] (-391.746) (-391.684) (-390.543) * (-392.919) (-390.365) [-391.149] (-391.639) -- 0:00:45
      247000 -- (-396.939) [-389.365] (-390.421) (-391.510) * [-389.393] (-390.257) (-391.499) (-389.893) -- 0:00:45
      247500 -- (-390.941) (-390.065) (-390.517) [-390.781] * (-389.517) [-391.775] (-392.213) (-390.570) -- 0:00:45
      248000 -- (-389.599) [-391.423] (-392.414) (-390.707) * [-390.753] (-391.412) (-398.718) (-389.932) -- 0:00:45
      248500 -- (-390.585) [-391.081] (-391.804) (-395.681) * (-391.075) (-393.256) [-390.754] (-390.081) -- 0:00:45
      249000 -- (-390.186) (-390.278) [-391.238] (-392.869) * (-393.895) [-393.149] (-391.408) (-393.989) -- 0:00:45
      249500 -- (-390.571) (-392.511) [-390.758] (-392.492) * (-389.730) (-391.787) [-390.879] (-390.768) -- 0:00:45
      250000 -- [-391.142] (-391.043) (-390.322) (-389.985) * (-393.989) [-389.632] (-391.306) (-390.436) -- 0:00:45

      Average standard deviation of split frequencies: 0.016233

      250500 -- (-396.522) (-390.156) [-393.613] (-391.564) * [-391.459] (-390.535) (-389.618) (-389.941) -- 0:00:44
      251000 -- (-399.717) (-389.397) [-391.365] (-390.520) * [-389.868] (-389.944) (-389.582) (-388.955) -- 0:00:44
      251500 -- [-396.630] (-390.499) (-390.606) (-390.499) * (-402.091) (-391.313) [-392.154] (-395.061) -- 0:00:44
      252000 -- (-392.402) [-390.645] (-389.707) (-393.493) * (-390.605) [-391.049] (-393.698) (-392.486) -- 0:00:44
      252500 -- (-392.559) (-392.656) (-395.029) [-395.733] * (-390.771) (-390.691) (-396.647) [-392.222] -- 0:00:44
      253000 -- [-389.515] (-389.863) (-390.921) (-390.654) * (-390.876) (-391.651) (-391.278) [-390.431] -- 0:00:44
      253500 -- (-391.150) (-390.555) [-390.211] (-389.556) * (-393.081) (-390.629) [-390.859] (-389.694) -- 0:00:44
      254000 -- [-395.205] (-390.026) (-390.718) (-390.767) * [-392.019] (-390.332) (-390.517) (-389.542) -- 0:00:44
      254500 -- (-395.634) (-390.767) (-391.755) [-389.655] * (-391.776) (-392.575) [-394.774] (-390.429) -- 0:00:43
      255000 -- [-391.303] (-391.137) (-390.783) (-391.330) * (-389.694) [-391.039] (-393.454) (-393.278) -- 0:00:43

      Average standard deviation of split frequencies: 0.015410

      255500 -- (-391.762) (-392.787) [-394.147] (-394.182) * (-393.033) (-396.716) [-393.448] (-394.375) -- 0:00:43
      256000 -- (-392.484) (-392.636) [-390.107] (-392.144) * (-395.543) (-392.381) (-390.880) [-395.147] -- 0:00:43
      256500 -- [-392.442] (-394.872) (-389.856) (-392.582) * (-397.967) (-392.528) (-392.575) [-391.964] -- 0:00:43
      257000 -- [-394.353] (-397.881) (-391.162) (-391.034) * (-391.425) (-391.625) [-391.816] (-390.431) -- 0:00:43
      257500 -- (-397.064) (-395.855) [-391.831] (-391.680) * (-389.902) [-390.760] (-395.442) (-391.071) -- 0:00:43
      258000 -- (-400.401) [-392.651] (-394.289) (-390.864) * (-393.215) (-390.890) [-394.437] (-393.214) -- 0:00:43
      258500 -- (-391.863) (-391.492) [-389.010] (-393.393) * (-390.214) [-392.273] (-392.807) (-391.496) -- 0:00:43
      259000 -- (-389.859) (-390.595) [-391.829] (-392.641) * (-391.253) (-391.503) (-391.700) [-390.084] -- 0:00:42
      259500 -- (-394.098) [-390.781] (-389.486) (-394.351) * (-392.775) (-389.560) [-390.638] (-390.312) -- 0:00:42
      260000 -- (-396.145) (-391.267) [-389.409] (-390.892) * (-390.906) (-391.297) (-392.562) [-390.709] -- 0:00:45

      Average standard deviation of split frequencies: 0.014087

      260500 -- (-391.486) (-390.022) [-390.240] (-395.146) * [-390.404] (-390.927) (-391.255) (-391.984) -- 0:00:45
      261000 -- (-390.519) (-389.340) [-389.911] (-392.537) * (-389.238) [-390.163] (-390.969) (-391.255) -- 0:00:45
      261500 -- (-390.408) [-389.984] (-391.711) (-389.790) * [-394.130] (-394.774) (-390.149) (-395.446) -- 0:00:45
      262000 -- (-394.288) (-391.428) (-391.848) [-390.389] * (-390.924) (-395.386) [-390.028] (-389.872) -- 0:00:45
      262500 -- (-391.105) (-392.192) (-389.084) [-392.184] * (-392.059) [-394.367] (-391.797) (-391.205) -- 0:00:44
      263000 -- (-391.657) (-390.484) [-390.771] (-390.128) * (-392.822) (-393.615) (-391.745) [-389.832] -- 0:00:44
      263500 -- (-390.331) (-392.630) (-390.273) [-391.303] * (-391.572) (-391.018) (-389.554) [-389.063] -- 0:00:44
      264000 -- (-390.206) (-393.227) [-389.515] (-390.266) * [-391.136] (-391.348) (-390.458) (-393.289) -- 0:00:44
      264500 -- [-389.655] (-391.606) (-393.282) (-391.678) * (-390.439) (-391.762) (-390.189) [-389.298] -- 0:00:44
      265000 -- (-393.402) (-392.993) [-390.503] (-394.513) * (-391.388) (-390.790) [-389.930] (-389.834) -- 0:00:44

      Average standard deviation of split frequencies: 0.012898

      265500 -- (-391.301) [-389.538] (-397.294) (-390.798) * [-391.051] (-391.527) (-392.085) (-391.714) -- 0:00:44
      266000 -- (-392.527) (-390.357) (-394.921) [-389.824] * (-390.477) (-390.700) (-394.500) [-391.457] -- 0:00:44
      266500 -- (-391.817) [-390.144] (-394.651) (-392.368) * (-390.511) (-391.704) (-390.454) [-390.571] -- 0:00:44
      267000 -- [-390.335] (-391.464) (-393.110) (-390.935) * (-389.904) (-393.666) [-390.283] (-391.483) -- 0:00:43
      267500 -- (-390.753) (-393.834) (-393.331) [-390.052] * [-389.659] (-391.156) (-389.621) (-393.059) -- 0:00:43
      268000 -- (-390.645) [-392.500] (-394.209) (-392.167) * [-390.759] (-390.541) (-391.365) (-389.262) -- 0:00:43
      268500 -- (-390.369) [-392.668] (-392.901) (-389.339) * (-392.181) (-391.232) [-392.446] (-389.234) -- 0:00:43
      269000 -- [-390.946] (-392.471) (-392.563) (-390.931) * (-391.283) [-389.767] (-392.098) (-392.321) -- 0:00:43
      269500 -- (-394.672) (-390.553) [-392.886] (-390.328) * [-389.984] (-391.512) (-393.010) (-391.138) -- 0:00:43
      270000 -- (-391.029) (-390.256) (-390.542) [-390.616] * [-389.971] (-389.965) (-390.867) (-391.811) -- 0:00:43

      Average standard deviation of split frequencies: 0.012288

      270500 -- (-391.986) [-390.806] (-389.795) (-390.478) * (-391.636) (-391.974) (-390.325) [-391.812] -- 0:00:43
      271000 -- (-394.278) (-391.414) [-390.554] (-390.899) * (-390.132) [-392.417] (-391.742) (-392.622) -- 0:00:43
      271500 -- (-393.646) (-389.395) [-393.083] (-391.303) * (-391.514) (-391.860) [-390.693] (-392.957) -- 0:00:42
      272000 -- (-392.849) [-389.174] (-394.108) (-390.839) * [-392.125] (-395.605) (-392.485) (-392.930) -- 0:00:42
      272500 -- (-391.116) (-390.942) (-394.009) [-390.259] * (-392.718) [-389.995] (-392.448) (-390.982) -- 0:00:42
      273000 -- (-390.580) (-391.281) (-391.147) [-392.607] * [-390.716] (-394.943) (-390.817) (-391.187) -- 0:00:42
      273500 -- (-389.947) (-389.945) [-393.515] (-391.936) * (-392.833) [-392.941] (-392.351) (-392.954) -- 0:00:42
      274000 -- [-390.112] (-391.346) (-392.231) (-394.272) * (-393.299) (-389.903) [-391.818] (-392.564) -- 0:00:42
      274500 -- (-392.146) [-393.929] (-393.318) (-391.241) * (-395.434) (-394.419) (-391.520) [-389.442] -- 0:00:42
      275000 -- (-392.840) (-392.927) [-393.433] (-394.262) * (-390.874) [-389.775] (-390.480) (-390.127) -- 0:00:42

      Average standard deviation of split frequencies: 0.013569

      275500 -- (-391.892) (-391.059) (-389.165) [-391.094] * [-390.671] (-391.443) (-393.842) (-390.151) -- 0:00:42
      276000 -- [-390.501] (-393.153) (-389.283) (-399.263) * (-390.531) (-392.504) [-391.887] (-390.388) -- 0:00:41
      276500 -- (-392.033) [-392.877] (-393.220) (-393.708) * (-389.622) [-390.399] (-394.787) (-391.299) -- 0:00:44
      277000 -- (-395.545) [-392.942] (-391.855) (-393.987) * (-389.498) [-389.406] (-392.734) (-393.660) -- 0:00:44
      277500 -- (-393.729) (-394.333) [-389.889] (-390.536) * (-390.043) [-390.015] (-393.124) (-394.035) -- 0:00:44
      278000 -- (-394.002) [-391.584] (-392.457) (-390.337) * (-391.546) (-389.719) (-391.585) [-390.746] -- 0:00:44
      278500 -- [-391.423] (-390.907) (-392.929) (-392.690) * [-390.032] (-392.892) (-389.478) (-390.172) -- 0:00:44
      279000 -- (-394.889) (-392.663) [-390.168] (-392.692) * (-393.502) (-389.415) (-391.325) [-389.982] -- 0:00:43
      279500 -- (-394.403) [-391.092] (-391.238) (-391.068) * [-392.000] (-391.281) (-390.859) (-389.820) -- 0:00:43
      280000 -- (-390.892) [-393.211] (-392.982) (-390.253) * (-389.754) (-393.361) [-391.626] (-390.465) -- 0:00:43

      Average standard deviation of split frequencies: 0.012844

      280500 -- (-391.375) [-390.734] (-391.638) (-394.928) * [-393.406] (-392.127) (-395.507) (-394.640) -- 0:00:43
      281000 -- (-390.325) (-394.612) [-393.409] (-389.631) * [-392.391] (-399.553) (-390.369) (-391.114) -- 0:00:43
      281500 -- (-390.129) [-392.069] (-393.620) (-392.278) * (-393.262) (-397.535) (-391.790) [-390.585] -- 0:00:43
      282000 -- [-390.425] (-390.585) (-393.948) (-388.966) * (-390.516) (-390.861) [-392.614] (-395.275) -- 0:00:43
      282500 -- (-389.766) [-393.266] (-398.991) (-390.915) * (-394.107) (-392.668) (-391.319) [-390.900] -- 0:00:43
      283000 -- [-392.538] (-390.741) (-392.593) (-391.654) * (-394.884) (-391.310) [-390.531] (-390.952) -- 0:00:43
      283500 -- (-391.429) (-390.378) [-390.415] (-390.809) * (-391.124) (-393.020) [-390.083] (-390.167) -- 0:00:42
      284000 -- (-390.775) (-391.558) [-394.227] (-389.678) * (-391.470) [-391.128] (-393.021) (-391.082) -- 0:00:42
      284500 -- (-391.303) (-392.736) (-397.427) [-390.912] * (-389.682) (-392.183) (-390.229) [-390.273] -- 0:00:42
      285000 -- (-390.436) (-391.676) (-389.424) [-392.785] * (-392.716) (-392.615) (-390.597) [-389.665] -- 0:00:42

      Average standard deviation of split frequencies: 0.012604

      285500 -- (-390.439) [-391.809] (-390.131) (-390.717) * [-390.243] (-391.581) (-391.001) (-390.939) -- 0:00:42
      286000 -- (-391.838) (-392.931) (-389.575) [-393.403] * (-393.985) (-392.348) (-389.388) [-392.920] -- 0:00:42
      286500 -- (-391.024) [-393.313] (-392.171) (-390.721) * [-395.762] (-394.615) (-392.617) (-391.943) -- 0:00:42
      287000 -- [-389.453] (-389.292) (-389.503) (-390.786) * [-392.111] (-398.844) (-396.366) (-392.399) -- 0:00:42
      287500 -- (-390.354) [-393.656] (-391.572) (-394.676) * (-391.920) (-393.269) [-391.609] (-392.471) -- 0:00:42
      288000 -- (-390.400) (-390.286) (-389.883) [-392.193] * (-399.968) [-393.403] (-394.012) (-391.553) -- 0:00:42
      288500 -- (-390.379) (-391.982) (-389.792) [-390.634] * (-390.736) (-394.409) (-389.634) [-391.489] -- 0:00:41
      289000 -- (-390.337) (-394.459) [-394.078] (-389.662) * [-391.756] (-390.692) (-392.284) (-392.933) -- 0:00:41
      289500 -- (-391.121) (-390.307) (-391.857) [-390.859] * (-392.873) (-389.557) (-392.606) [-389.884] -- 0:00:41
      290000 -- (-399.719) (-391.135) (-390.673) [-390.201] * (-391.749) (-389.092) [-390.267] (-389.832) -- 0:00:41

      Average standard deviation of split frequencies: 0.013065

      290500 -- (-391.348) (-394.342) (-390.101) [-391.212] * (-390.732) (-390.426) [-390.714] (-389.571) -- 0:00:41
      291000 -- (-393.458) [-389.370] (-392.919) (-393.638) * [-389.449] (-390.291) (-389.388) (-396.081) -- 0:00:41
      291500 -- (-391.368) (-390.268) [-392.644] (-394.274) * [-390.262] (-391.152) (-390.638) (-392.142) -- 0:00:41
      292000 -- (-393.291) [-389.720] (-391.005) (-390.599) * [-389.616] (-397.058) (-392.544) (-391.002) -- 0:00:41
      292500 -- (-396.674) (-391.205) (-394.839) [-396.179] * (-394.745) (-392.233) (-391.514) [-394.914] -- 0:00:41
      293000 -- (-389.231) [-389.264] (-395.177) (-390.736) * (-390.549) (-393.069) (-392.757) [-391.877] -- 0:00:41
      293500 -- (-396.565) (-391.516) [-393.056] (-393.290) * (-392.442) (-392.331) (-391.997) [-390.390] -- 0:00:43
      294000 -- (-394.124) (-394.006) (-390.633) [-390.299] * (-390.294) (-391.027) [-394.538] (-392.858) -- 0:00:43
      294500 -- (-394.168) [-391.956] (-391.235) (-390.156) * (-392.293) (-391.512) [-394.420] (-393.906) -- 0:00:43
      295000 -- (-389.550) [-391.455] (-392.127) (-390.086) * (-393.419) (-390.061) (-390.178) [-390.446] -- 0:00:43

      Average standard deviation of split frequencies: 0.012243

      295500 -- (-392.720) (-390.440) [-395.893] (-392.139) * [-391.557] (-391.249) (-389.995) (-393.459) -- 0:00:42
      296000 -- (-391.980) (-390.703) (-391.447) [-390.959] * (-390.119) [-390.075] (-395.428) (-398.380) -- 0:00:42
      296500 -- (-391.972) (-392.784) (-392.639) [-389.799] * (-390.715) (-392.072) (-390.330) [-390.398] -- 0:00:42
      297000 -- (-389.817) (-389.714) [-390.135] (-395.994) * (-391.966) (-395.025) (-390.604) [-391.450] -- 0:00:42
      297500 -- (-390.860) [-391.031] (-393.052) (-389.937) * (-391.797) (-391.289) (-389.677) [-391.238] -- 0:00:42
      298000 -- (-393.685) [-391.345] (-393.076) (-393.587) * [-391.390] (-394.564) (-392.350) (-391.303) -- 0:00:42
      298500 -- [-390.006] (-392.137) (-392.970) (-393.533) * [-392.268] (-392.423) (-390.574) (-391.151) -- 0:00:42
      299000 -- (-390.179) [-392.332] (-390.546) (-389.426) * (-391.318) [-392.778] (-397.227) (-393.182) -- 0:00:42
      299500 -- [-390.846] (-391.050) (-390.981) (-390.576) * (-391.036) (-391.033) [-389.372] (-391.975) -- 0:00:42
      300000 -- (-390.280) (-395.135) (-389.876) [-389.951] * (-395.542) (-389.469) [-390.614] (-391.176) -- 0:00:42

      Average standard deviation of split frequencies: 0.012347

      300500 -- (-392.404) (-390.899) [-391.638] (-391.192) * [-391.240] (-397.534) (-389.945) (-390.398) -- 0:00:41
      301000 -- (-392.105) [-394.671] (-390.989) (-389.920) * [-392.449] (-392.199) (-390.437) (-392.717) -- 0:00:41
      301500 -- (-393.507) (-397.948) [-390.210] (-392.437) * (-397.899) (-391.349) [-391.627] (-390.814) -- 0:00:41
      302000 -- (-391.605) (-393.703) (-391.793) [-390.230] * (-393.110) (-390.490) (-390.682) [-390.038] -- 0:00:41
      302500 -- (-390.352) (-393.700) (-392.824) [-394.272] * [-390.187] (-391.061) (-391.259) (-391.068) -- 0:00:41
      303000 -- (-389.791) (-390.162) [-390.843] (-398.246) * (-391.324) [-390.126] (-390.017) (-393.851) -- 0:00:41
      303500 -- (-395.284) [-390.126] (-392.744) (-392.086) * (-390.475) [-389.949] (-391.373) (-393.150) -- 0:00:41
      304000 -- (-394.267) [-391.986] (-392.458) (-392.038) * [-390.541] (-390.937) (-389.631) (-392.269) -- 0:00:41
      304500 -- [-392.029] (-389.924) (-391.145) (-389.382) * [-391.826] (-394.395) (-392.025) (-392.107) -- 0:00:41
      305000 -- [-393.991] (-392.322) (-391.754) (-399.144) * [-391.490] (-391.085) (-392.382) (-395.453) -- 0:00:41

      Average standard deviation of split frequencies: 0.012486

      305500 -- [-389.873] (-390.535) (-393.941) (-396.502) * (-393.449) [-392.302] (-390.779) (-389.872) -- 0:00:40
      306000 -- [-391.304] (-391.166) (-391.250) (-391.016) * (-391.799) (-389.623) (-392.399) [-389.884] -- 0:00:40
      306500 -- (-394.335) [-389.676] (-390.310) (-389.372) * (-391.569) (-394.330) [-391.571] (-393.227) -- 0:00:40
      307000 -- (-390.042) [-390.167] (-391.898) (-393.951) * [-391.471] (-391.548) (-392.282) (-393.578) -- 0:00:40
      307500 -- (-389.752) (-394.147) [-393.845] (-392.030) * [-389.358] (-394.150) (-392.599) (-391.867) -- 0:00:40
      308000 -- [-396.366] (-397.846) (-392.830) (-393.372) * [-391.883] (-391.803) (-392.251) (-389.395) -- 0:00:40
      308500 -- (-391.579) [-393.682] (-389.573) (-393.303) * (-396.292) [-390.596] (-389.446) (-390.379) -- 0:00:40
      309000 -- (-393.093) (-391.869) (-392.399) [-390.682] * (-391.317) (-393.173) (-390.793) [-390.493] -- 0:00:40
      309500 -- (-393.762) (-390.723) [-397.299] (-390.077) * [-389.804] (-395.162) (-396.275) (-391.105) -- 0:00:40
      310000 -- (-392.197) (-390.312) [-391.364] (-391.899) * (-390.375) (-391.401) [-395.104] (-390.701) -- 0:00:40

      Average standard deviation of split frequencies: 0.013741

      310500 -- [-390.181] (-391.592) (-392.848) (-392.437) * [-392.198] (-399.300) (-390.715) (-392.618) -- 0:00:42
      311000 -- (-391.416) (-390.602) (-392.568) [-391.994] * [-390.135] (-392.963) (-395.912) (-391.601) -- 0:00:42
      311500 -- (-389.519) (-392.080) (-390.328) [-390.282] * [-393.515] (-391.013) (-393.936) (-393.186) -- 0:00:41
      312000 -- (-391.905) (-390.330) (-394.044) [-390.257] * (-394.083) (-390.550) (-391.201) [-389.591] -- 0:00:41
      312500 -- (-390.864) [-390.914] (-392.651) (-390.185) * (-391.284) [-391.092] (-392.162) (-391.966) -- 0:00:41
      313000 -- (-390.171) (-391.793) (-392.018) [-392.519] * (-391.501) (-391.336) (-395.824) [-394.052] -- 0:00:41
      313500 -- (-393.948) (-396.754) (-392.737) [-391.089] * (-393.840) (-389.377) (-396.221) [-391.146] -- 0:00:41
      314000 -- (-395.565) (-389.755) [-389.674] (-391.217) * (-391.964) (-391.093) [-393.953] (-390.615) -- 0:00:41
      314500 -- [-393.520] (-390.740) (-389.791) (-391.647) * (-391.215) (-391.923) (-390.461) [-393.291] -- 0:00:41
      315000 -- (-389.272) [-390.785] (-391.432) (-391.808) * (-395.924) (-391.709) (-389.911) [-389.231] -- 0:00:41

      Average standard deviation of split frequencies: 0.012461

      315500 -- (-391.197) [-390.228] (-391.875) (-392.199) * (-389.277) (-389.241) (-392.381) [-392.096] -- 0:00:41
      316000 -- (-390.163) (-391.574) (-392.403) [-390.082] * (-390.150) (-389.148) [-394.339] (-390.414) -- 0:00:41
      316500 -- [-389.157] (-389.518) (-394.681) (-391.617) * [-390.725] (-389.253) (-390.894) (-390.767) -- 0:00:41
      317000 -- [-389.520] (-390.808) (-393.135) (-392.100) * (-391.274) [-393.054] (-389.615) (-393.050) -- 0:00:40
      317500 -- [-391.342] (-390.126) (-389.268) (-391.874) * (-391.642) (-391.403) (-390.181) [-391.815] -- 0:00:40
      318000 -- (-390.173) [-391.831] (-400.356) (-392.332) * [-392.955] (-394.138) (-394.945) (-392.662) -- 0:00:40
      318500 -- (-391.245) (-392.214) (-394.353) [-390.854] * (-392.273) [-395.735] (-391.034) (-392.473) -- 0:00:40
      319000 -- (-391.449) (-390.703) [-392.941] (-390.872) * (-391.999) (-389.921) (-389.789) [-391.208] -- 0:00:40
      319500 -- (-392.020) [-392.077] (-389.940) (-389.257) * (-391.889) [-390.368] (-392.647) (-391.684) -- 0:00:40
      320000 -- [-393.503] (-390.075) (-390.940) (-390.715) * (-391.923) (-389.762) [-389.356] (-391.634) -- 0:00:40

      Average standard deviation of split frequencies: 0.012822

      320500 -- (-393.832) (-391.055) [-392.948] (-390.827) * (-395.864) (-391.694) [-391.948] (-390.104) -- 0:00:40
      321000 -- (-389.767) (-390.435) (-390.115) [-392.525] * [-389.946] (-389.832) (-392.412) (-396.577) -- 0:00:40
      321500 -- (-391.823) (-389.244) [-392.243] (-389.759) * (-391.784) (-390.383) [-391.645] (-396.974) -- 0:00:40
      322000 -- [-392.987] (-390.679) (-390.350) (-391.435) * (-390.683) [-391.083] (-391.494) (-393.016) -- 0:00:40
      322500 -- (-394.338) (-392.006) [-393.016] (-389.448) * (-390.005) (-390.504) [-391.769] (-389.396) -- 0:00:39
      323000 -- (-389.632) [-391.128] (-390.765) (-391.676) * (-390.979) (-394.872) [-391.399] (-390.310) -- 0:00:39
      323500 -- (-391.257) (-390.078) (-392.126) [-391.010] * (-393.323) (-393.101) [-393.416] (-390.780) -- 0:00:39
      324000 -- (-390.450) (-390.502) (-390.733) [-388.979] * (-390.844) (-393.586) [-391.300] (-395.383) -- 0:00:39
      324500 -- [-391.303] (-391.677) (-390.904) (-391.872) * (-392.559) [-389.883] (-391.809) (-393.192) -- 0:00:39
      325000 -- (-390.623) [-390.718] (-391.900) (-393.989) * (-395.785) [-391.710] (-391.351) (-389.253) -- 0:00:39

      Average standard deviation of split frequencies: 0.011653

      325500 -- (-390.126) (-389.897) [-394.363] (-390.918) * (-389.143) [-390.397] (-392.134) (-391.173) -- 0:00:39
      326000 -- (-389.590) (-389.386) (-397.321) [-395.122] * (-391.609) (-391.467) [-391.750] (-390.402) -- 0:00:39
      326500 -- [-391.660] (-392.019) (-393.219) (-390.774) * [-391.264] (-392.931) (-394.064) (-394.449) -- 0:00:39
      327000 -- (-390.801) (-394.631) (-390.818) [-391.119] * (-394.028) (-393.665) (-391.985) [-392.430] -- 0:00:39
      327500 -- (-391.539) [-389.411] (-391.605) (-391.437) * [-392.877] (-391.202) (-390.505) (-393.704) -- 0:00:41
      328000 -- [-390.352] (-389.191) (-389.257) (-389.784) * [-394.251] (-390.401) (-392.080) (-390.453) -- 0:00:40
      328500 -- [-390.857] (-393.198) (-394.177) (-391.604) * (-389.190) (-390.203) (-394.558) [-389.111] -- 0:00:40
      329000 -- [-390.603] (-390.460) (-395.823) (-389.966) * [-389.205] (-392.410) (-392.799) (-390.815) -- 0:00:40
      329500 -- (-389.936) (-390.887) [-391.437] (-390.922) * (-389.298) (-393.577) [-392.013] (-390.435) -- 0:00:40
      330000 -- (-390.145) [-390.701] (-389.897) (-391.058) * (-393.245) [-391.814] (-395.336) (-394.156) -- 0:00:40

      Average standard deviation of split frequencies: 0.011740

      330500 -- (-390.669) (-389.441) [-390.466] (-395.623) * (-393.227) (-391.296) [-390.748] (-390.780) -- 0:00:40
      331000 -- (-391.612) (-390.798) [-391.992] (-390.854) * [-389.194] (-391.912) (-390.296) (-389.820) -- 0:00:40
      331500 -- (-395.043) (-389.961) (-396.907) [-390.549] * (-390.507) [-391.286] (-391.421) (-393.768) -- 0:00:40
      332000 -- (-390.284) (-391.400) (-391.482) [-392.321] * (-394.135) [-390.172] (-389.650) (-392.386) -- 0:00:40
      332500 -- (-390.652) (-391.422) (-389.397) [-393.505] * (-390.196) (-392.376) [-389.158] (-392.628) -- 0:00:40
      333000 -- (-391.525) (-390.591) (-390.358) [-390.206] * (-393.511) [-390.928] (-391.691) (-390.696) -- 0:00:40
      333500 -- (-393.460) (-391.132) [-389.761] (-392.447) * (-394.430) (-389.885) (-392.474) [-392.757] -- 0:00:39
      334000 -- (-391.192) (-391.776) (-391.674) [-392.035] * (-394.428) (-390.432) [-391.757] (-394.405) -- 0:00:39
      334500 -- (-389.490) [-390.199] (-390.405) (-395.322) * (-395.208) (-389.737) (-391.801) [-394.017] -- 0:00:39
      335000 -- (-389.818) (-393.337) (-389.650) [-390.050] * (-389.523) (-390.392) (-392.784) [-389.851] -- 0:00:39

      Average standard deviation of split frequencies: 0.011692

      335500 -- (-392.600) (-390.499) (-390.715) [-390.599] * (-396.562) (-390.174) [-392.723] (-393.345) -- 0:00:39
      336000 -- (-390.652) [-390.033] (-394.792) (-391.094) * (-391.963) [-391.189] (-391.695) (-390.613) -- 0:00:39
      336500 -- (-389.856) [-392.052] (-391.451) (-389.462) * (-390.430) (-392.033) (-390.117) [-390.460] -- 0:00:39
      337000 -- (-394.273) (-390.499) (-390.728) [-391.614] * (-390.186) [-390.237] (-390.599) (-391.063) -- 0:00:39
      337500 -- (-394.015) [-392.790] (-391.056) (-392.873) * [-391.020] (-390.309) (-391.707) (-392.373) -- 0:00:39
      338000 -- [-390.101] (-390.269) (-390.257) (-394.042) * (-390.789) (-391.843) [-392.451] (-391.320) -- 0:00:39
      338500 -- [-389.696] (-390.388) (-392.423) (-390.742) * (-389.220) [-390.850] (-391.563) (-391.045) -- 0:00:39
      339000 -- [-390.876] (-391.215) (-392.210) (-392.869) * (-389.948) (-395.698) (-391.998) [-390.093] -- 0:00:38
      339500 -- (-389.733) (-390.931) (-393.669) [-391.219] * (-391.111) (-390.527) (-396.343) [-394.286] -- 0:00:38
      340000 -- (-393.648) (-391.796) (-393.884) [-391.338] * [-390.651] (-391.813) (-391.801) (-392.337) -- 0:00:38

      Average standard deviation of split frequencies: 0.012608

      340500 -- (-391.793) [-391.144] (-391.395) (-391.983) * (-391.465) [-393.330] (-392.411) (-395.899) -- 0:00:38
      341000 -- (-395.046) [-391.123] (-392.893) (-389.856) * [-391.539] (-389.857) (-391.622) (-392.164) -- 0:00:38
      341500 -- (-391.043) [-391.046] (-391.412) (-391.035) * (-391.771) (-392.845) [-392.260] (-392.920) -- 0:00:38
      342000 -- (-394.533) (-390.041) (-393.719) [-390.988] * (-389.135) (-391.371) [-397.630] (-390.897) -- 0:00:38
      342500 -- (-393.876) (-391.125) (-390.382) [-391.503] * [-390.119] (-391.882) (-396.439) (-390.028) -- 0:00:38
      343000 -- [-395.522] (-393.383) (-390.349) (-390.068) * (-394.369) [-391.600] (-389.515) (-398.001) -- 0:00:38
      343500 -- (-395.358) (-391.908) [-390.242] (-390.132) * (-391.488) (-394.484) [-389.922] (-389.814) -- 0:00:38
      344000 -- [-390.947] (-391.638) (-393.425) (-392.316) * (-391.508) [-391.715] (-390.718) (-394.670) -- 0:00:38
      344500 -- [-394.096] (-393.850) (-394.187) (-391.885) * (-390.883) [-390.145] (-390.476) (-389.955) -- 0:00:39
      345000 -- (-390.740) (-392.503) (-392.224) [-389.653] * (-394.389) [-390.520] (-392.235) (-393.547) -- 0:00:39

      Average standard deviation of split frequencies: 0.012792

      345500 -- (-389.288) (-396.791) (-393.112) [-392.899] * (-395.083) [-389.847] (-392.629) (-389.517) -- 0:00:39
      346000 -- [-391.358] (-391.502) (-392.394) (-392.143) * (-392.604) (-390.854) [-394.133] (-394.844) -- 0:00:39
      346500 -- (-391.552) [-391.166] (-392.332) (-391.325) * (-389.880) [-395.021] (-394.335) (-392.861) -- 0:00:39
      347000 -- (-391.992) (-390.832) (-390.660) [-392.191] * (-390.702) [-390.130] (-390.862) (-390.837) -- 0:00:39
      347500 -- (-390.952) (-395.081) (-394.651) [-390.507] * (-391.660) (-391.537) [-390.945] (-391.722) -- 0:00:39
      348000 -- (-391.880) (-393.250) (-393.839) [-392.578] * (-391.490) [-389.949] (-390.150) (-391.000) -- 0:00:39
      348500 -- [-392.004] (-392.853) (-392.363) (-398.618) * (-389.871) [-389.973] (-391.753) (-389.202) -- 0:00:39
      349000 -- [-393.948] (-390.530) (-389.879) (-390.985) * (-389.978) [-389.539] (-395.294) (-390.408) -- 0:00:39
      349500 -- (-390.017) [-389.959] (-390.436) (-390.009) * (-389.677) [-391.480] (-393.317) (-393.913) -- 0:00:39
      350000 -- [-390.681] (-389.937) (-394.016) (-389.476) * (-392.459) (-390.216) (-397.056) [-391.402] -- 0:00:39

      Average standard deviation of split frequencies: 0.012877

      350500 -- (-393.434) (-390.459) [-390.684] (-389.992) * (-391.493) (-391.546) (-392.053) [-389.014] -- 0:00:38
      351000 -- (-394.084) (-390.327) [-395.680] (-393.604) * (-391.169) [-390.546] (-392.382) (-390.581) -- 0:00:38
      351500 -- (-391.993) [-391.159] (-393.361) (-392.751) * [-390.325] (-393.174) (-391.742) (-389.143) -- 0:00:38
      352000 -- (-390.320) (-391.575) [-392.311] (-393.192) * (-390.149) [-391.668] (-389.293) (-389.224) -- 0:00:38
      352500 -- [-389.520] (-397.194) (-395.024) (-393.558) * (-389.246) (-392.685) [-390.381] (-394.162) -- 0:00:38
      353000 -- (-390.628) (-393.689) (-393.722) [-393.614] * (-390.383) (-393.129) (-393.637) [-390.149] -- 0:00:38
      353500 -- (-390.734) (-390.954) (-394.785) [-392.051] * [-390.549] (-392.676) (-390.375) (-393.827) -- 0:00:38
      354000 -- [-390.414] (-395.486) (-397.001) (-389.544) * [-391.432] (-393.541) (-389.497) (-390.973) -- 0:00:38
      354500 -- (-392.052) (-393.096) [-392.324] (-390.532) * (-393.130) [-392.935] (-389.019) (-395.957) -- 0:00:38
      355000 -- (-392.141) (-390.790) (-389.406) [-389.364] * [-391.951] (-392.519) (-390.724) (-394.588) -- 0:00:38

      Average standard deviation of split frequencies: 0.012506

      355500 -- (-389.779) (-391.169) (-393.144) [-390.700] * (-395.440) (-390.834) (-390.930) [-392.536] -- 0:00:38
      356000 -- (-392.614) (-389.705) (-393.268) [-391.397] * (-390.808) [-395.417] (-391.258) (-390.094) -- 0:00:37
      356500 -- (-392.359) (-391.649) [-392.162] (-390.941) * (-393.581) [-390.094] (-393.794) (-390.981) -- 0:00:37
      357000 -- (-389.907) [-390.610] (-390.343) (-390.674) * (-389.222) (-392.020) (-391.269) [-391.356] -- 0:00:37
      357500 -- [-389.926] (-390.112) (-390.859) (-389.735) * [-390.061] (-391.444) (-390.347) (-392.694) -- 0:00:37
      358000 -- (-392.916) (-390.730) [-390.856] (-394.435) * (-391.276) [-392.332] (-390.917) (-393.836) -- 0:00:37
      358500 -- (-392.344) [-393.066] (-392.013) (-393.942) * (-390.501) (-390.219) (-390.459) [-394.470] -- 0:00:37
      359000 -- (-391.384) (-390.311) [-395.178] (-390.805) * (-395.726) (-393.656) (-389.981) [-392.028] -- 0:00:37
      359500 -- [-391.456] (-392.471) (-393.710) (-391.672) * (-391.343) [-395.745] (-392.371) (-391.209) -- 0:00:37
      360000 -- (-389.551) [-391.867] (-389.363) (-390.414) * (-393.796) [-394.687] (-392.361) (-391.040) -- 0:00:37

      Average standard deviation of split frequencies: 0.012107

      360500 -- [-389.922] (-390.263) (-391.092) (-390.558) * (-390.230) (-393.368) (-390.907) [-392.834] -- 0:00:37
      361000 -- [-390.648] (-389.149) (-394.519) (-392.006) * [-392.292] (-392.816) (-391.476) (-389.401) -- 0:00:37
      361500 -- [-393.399] (-390.878) (-393.245) (-391.757) * (-390.138) [-390.978] (-394.292) (-390.322) -- 0:00:38
      362000 -- [-389.514] (-393.760) (-389.507) (-391.040) * [-390.287] (-392.801) (-392.474) (-391.336) -- 0:00:38
      362500 -- (-394.769) (-389.831) (-391.714) [-389.914] * [-390.548] (-392.195) (-390.525) (-394.894) -- 0:00:38
      363000 -- (-394.937) (-389.900) [-389.333] (-391.044) * (-391.042) [-389.765] (-394.191) (-398.626) -- 0:00:38
      363500 -- (-391.214) (-390.936) [-390.197] (-391.874) * [-393.313] (-391.110) (-394.245) (-392.483) -- 0:00:38
      364000 -- (-390.950) (-390.555) [-394.046] (-390.089) * [-390.680] (-391.456) (-392.576) (-390.196) -- 0:00:38
      364500 -- (-390.635) (-392.745) (-389.133) [-391.475] * [-391.414] (-392.901) (-394.862) (-389.371) -- 0:00:38
      365000 -- (-392.989) [-391.724] (-394.557) (-393.810) * (-392.502) (-392.218) (-389.909) [-390.307] -- 0:00:38

      Average standard deviation of split frequencies: 0.012737

      365500 -- (-393.037) (-389.598) [-391.202] (-391.922) * (-391.967) (-390.551) (-393.158) [-392.363] -- 0:00:38
      366000 -- (-391.583) (-391.276) (-393.431) [-391.984] * (-390.670) (-390.324) [-392.555] (-392.737) -- 0:00:38
      366500 -- (-393.767) (-392.045) (-389.443) [-393.858] * (-390.018) [-390.716] (-390.982) (-392.520) -- 0:00:38
      367000 -- (-389.928) (-394.137) [-389.982] (-391.448) * (-394.624) (-391.579) (-393.647) [-391.758] -- 0:00:37
      367500 -- (-391.625) [-390.062] (-389.975) (-394.507) * (-391.464) (-392.471) [-390.429] (-390.835) -- 0:00:37
      368000 -- (-391.197) (-390.121) [-392.497] (-392.161) * (-394.200) (-393.175) (-398.452) [-395.632] -- 0:00:37
      368500 -- (-393.326) [-391.959] (-390.451) (-390.591) * (-390.517) [-392.025] (-393.268) (-390.299) -- 0:00:37
      369000 -- [-390.257] (-390.989) (-392.675) (-390.683) * (-389.097) (-389.879) [-391.581] (-393.471) -- 0:00:37
      369500 -- (-391.501) (-393.743) [-394.122] (-393.916) * (-393.423) (-390.683) [-392.728] (-394.269) -- 0:00:37
      370000 -- (-390.964) (-391.623) (-390.137) [-390.703] * (-392.754) (-392.344) (-390.775) [-391.883] -- 0:00:37

      Average standard deviation of split frequencies: 0.013283

      370500 -- (-394.681) (-391.709) [-391.266] (-390.882) * [-391.476] (-390.645) (-392.558) (-390.985) -- 0:00:37
      371000 -- [-390.602] (-391.288) (-391.663) (-390.011) * (-392.469) (-389.647) [-392.827] (-392.699) -- 0:00:37
      371500 -- (-390.896) (-390.439) (-392.070) [-389.253] * (-392.793) [-389.873] (-394.861) (-393.894) -- 0:00:37
      372000 -- [-392.556] (-390.792) (-397.745) (-389.801) * (-396.753) (-394.326) [-391.880] (-391.864) -- 0:00:37
      372500 -- [-391.322] (-391.875) (-391.302) (-394.774) * [-391.370] (-390.130) (-389.478) (-390.322) -- 0:00:37
      373000 -- [-390.407] (-390.176) (-392.408) (-390.711) * (-392.056) (-390.902) [-390.742] (-390.692) -- 0:00:36
      373500 -- (-390.802) (-391.558) (-389.885) [-390.343] * (-390.672) [-391.214] (-390.697) (-392.030) -- 0:00:36
      374000 -- (-391.001) (-390.169) (-390.384) [-390.078] * (-389.874) (-394.309) (-392.790) [-390.861] -- 0:00:36
      374500 -- (-391.067) (-390.198) [-390.059] (-393.529) * [-389.589] (-393.332) (-392.191) (-391.449) -- 0:00:36
      375000 -- (-391.088) (-391.776) (-390.486) [-395.673] * (-389.736) (-390.290) (-395.750) [-390.859] -- 0:00:36

      Average standard deviation of split frequencies: 0.013304

      375500 -- (-393.148) (-390.971) [-390.895] (-393.376) * (-390.634) [-391.639] (-391.815) (-390.945) -- 0:00:36
      376000 -- (-390.692) (-389.387) (-394.513) [-390.384] * [-392.361] (-391.766) (-390.810) (-391.418) -- 0:00:36
      376500 -- (-390.087) [-391.118] (-391.088) (-390.453) * (-393.847) (-390.310) [-391.703] (-397.603) -- 0:00:36
      377000 -- [-389.704] (-391.537) (-389.806) (-391.254) * (-392.078) (-391.259) (-391.340) [-392.528] -- 0:00:36
      377500 -- [-392.877] (-393.545) (-389.132) (-391.108) * (-392.458) [-394.603] (-390.990) (-391.768) -- 0:00:36
      378000 -- (-392.114) (-389.769) [-390.639] (-392.852) * [-390.643] (-390.353) (-389.930) (-392.344) -- 0:00:36
      378500 -- [-391.439] (-391.396) (-392.482) (-396.371) * [-392.247] (-390.165) (-390.492) (-391.295) -- 0:00:37
      379000 -- (-388.895) (-393.307) [-392.762] (-390.587) * [-392.373] (-392.819) (-391.429) (-390.360) -- 0:00:37
      379500 -- (-389.734) (-392.689) (-391.951) [-393.176] * (-391.519) (-391.539) (-389.295) [-392.174] -- 0:00:37
      380000 -- [-389.818] (-391.475) (-390.047) (-392.896) * (-390.934) (-392.372) (-390.466) [-391.580] -- 0:00:37

      Average standard deviation of split frequencies: 0.012384

      380500 -- (-389.758) (-390.021) [-389.189] (-390.242) * (-394.205) (-394.908) [-390.412] (-390.171) -- 0:00:37
      381000 -- (-393.542) (-390.352) [-391.941] (-391.124) * (-390.343) (-394.694) [-391.083] (-395.533) -- 0:00:37
      381500 -- (-389.738) (-390.583) (-393.490) [-390.380] * (-392.885) (-390.016) (-392.403) [-390.546] -- 0:00:37
      382000 -- (-390.999) [-391.731] (-394.894) (-392.189) * [-390.009] (-390.673) (-390.008) (-391.445) -- 0:00:37
      382500 -- (-393.408) [-389.662] (-393.911) (-392.308) * (-389.634) (-390.078) [-391.894] (-391.293) -- 0:00:37
      383000 -- (-391.314) (-390.725) (-393.294) [-391.200] * (-389.051) (-393.676) [-392.502] (-394.202) -- 0:00:37
      383500 -- [-390.492] (-391.090) (-392.172) (-392.533) * (-390.165) (-390.122) [-390.167] (-392.400) -- 0:00:36
      384000 -- (-390.120) (-390.145) [-389.808] (-389.189) * (-391.300) (-392.557) (-391.793) [-389.731] -- 0:00:36
      384500 -- (-389.466) [-391.020] (-390.435) (-390.344) * (-393.051) (-392.931) [-392.283] (-390.516) -- 0:00:36
      385000 -- [-389.871] (-390.726) (-393.159) (-391.896) * [-390.475] (-392.501) (-394.779) (-390.908) -- 0:00:36

      Average standard deviation of split frequencies: 0.012552

      385500 -- [-391.584] (-391.745) (-394.316) (-392.439) * (-396.916) (-391.920) (-390.977) [-389.290] -- 0:00:36
      386000 -- (-390.084) [-390.108] (-392.819) (-395.972) * [-389.782] (-389.428) (-390.464) (-389.528) -- 0:00:36
      386500 -- [-389.438] (-392.584) (-396.175) (-393.111) * (-390.685) (-392.334) (-393.334) [-393.714] -- 0:00:36
      387000 -- (-389.773) [-391.852] (-393.143) (-390.535) * [-390.864] (-392.905) (-391.927) (-391.711) -- 0:00:36
      387500 -- (-389.844) (-390.620) [-393.581] (-392.625) * (-390.802) (-392.775) (-390.973) [-389.706] -- 0:00:36
      388000 -- (-391.032) [-390.383] (-390.985) (-392.614) * (-390.497) (-389.166) (-393.518) [-391.976] -- 0:00:36
      388500 -- (-390.414) [-391.478] (-391.086) (-390.227) * [-392.357] (-390.521) (-393.644) (-392.321) -- 0:00:36
      389000 -- [-390.924] (-390.945) (-391.712) (-389.066) * (-390.787) (-389.370) (-394.039) [-391.997] -- 0:00:36
      389500 -- (-390.959) (-393.782) (-392.100) [-390.678] * (-390.292) [-393.522] (-390.686) (-389.301) -- 0:00:36
      390000 -- (-390.631) [-390.039] (-393.350) (-390.374) * (-390.400) (-391.412) [-395.022] (-390.639) -- 0:00:35

      Average standard deviation of split frequencies: 0.012603

      390500 -- (-390.728) (-390.037) (-390.477) [-390.814] * [-389.757] (-390.689) (-390.644) (-393.041) -- 0:00:35
      391000 -- (-394.952) (-393.596) [-392.852] (-391.127) * (-390.767) [-390.597] (-393.900) (-397.551) -- 0:00:35
      391500 -- (-393.246) [-392.465] (-391.303) (-394.999) * (-390.417) [-390.249] (-394.637) (-394.411) -- 0:00:35
      392000 -- [-394.945] (-390.961) (-392.290) (-393.400) * [-390.788] (-394.405) (-392.945) (-393.197) -- 0:00:35
      392500 -- (-391.737) (-392.443) [-389.882] (-392.736) * (-392.049) [-392.576] (-392.637) (-390.242) -- 0:00:35
      393000 -- (-390.927) (-392.353) [-389.812] (-392.482) * (-389.725) (-390.516) (-392.303) [-392.256] -- 0:00:35
      393500 -- (-393.212) (-391.460) (-389.343) [-392.326] * (-392.294) (-394.480) [-392.593] (-398.128) -- 0:00:35
      394000 -- (-391.167) (-391.361) [-389.988] (-391.873) * (-392.003) [-392.137] (-395.094) (-396.675) -- 0:00:35
      394500 -- (-392.826) [-390.716] (-389.736) (-392.069) * (-389.415) [-396.690] (-390.702) (-394.730) -- 0:00:35
      395000 -- [-392.605] (-392.363) (-390.916) (-394.132) * (-391.691) (-390.289) [-390.825] (-390.993) -- 0:00:35

      Average standard deviation of split frequencies: 0.011640

      395500 -- (-390.217) [-390.733] (-392.348) (-392.639) * (-392.418) (-389.457) (-392.085) [-392.074] -- 0:00:36
      396000 -- (-390.642) (-390.998) (-390.610) [-389.222] * (-398.552) [-390.856] (-394.177) (-390.192) -- 0:00:36
      396500 -- (-391.567) (-392.518) [-390.915] (-391.319) * (-390.808) (-390.184) [-391.868] (-389.215) -- 0:00:36
      397000 -- [-394.252] (-392.999) (-390.811) (-391.450) * (-393.436) (-391.082) [-390.339] (-390.132) -- 0:00:36
      397500 -- (-390.880) [-391.493] (-392.716) (-394.236) * [-392.240] (-392.639) (-389.808) (-390.355) -- 0:00:36
      398000 -- (-395.913) [-391.415] (-391.094) (-390.311) * (-391.367) [-391.417] (-391.495) (-389.484) -- 0:00:36
      398500 -- (-392.448) (-390.351) (-395.153) [-390.337] * (-394.805) (-395.733) [-392.272] (-391.542) -- 0:00:36
      399000 -- (-389.922) [-389.998] (-391.256) (-389.395) * [-391.532] (-396.422) (-389.723) (-396.747) -- 0:00:36
      399500 -- (-391.988) (-394.722) [-392.507] (-395.048) * (-389.910) [-392.707] (-392.186) (-397.693) -- 0:00:36
      400000 -- (-390.617) [-391.829] (-393.212) (-391.113) * (-391.672) (-393.147) (-391.288) [-390.204] -- 0:00:36

      Average standard deviation of split frequencies: 0.013457

      400500 -- (-392.227) (-392.717) (-390.725) [-390.204] * (-390.444) (-391.821) [-389.379] (-390.326) -- 0:00:35
      401000 -- (-391.874) (-392.375) (-390.819) [-395.986] * (-396.249) (-391.262) (-390.806) [-389.584] -- 0:00:35
      401500 -- (-391.603) [-394.347] (-390.189) (-392.935) * (-394.830) (-391.875) (-389.977) [-389.572] -- 0:00:35
      402000 -- [-390.405] (-390.317) (-393.239) (-390.708) * (-390.802) (-391.380) (-391.214) [-389.650] -- 0:00:35
      402500 -- (-390.325) (-391.023) (-392.803) [-392.091] * (-390.892) (-389.921) (-390.948) [-392.764] -- 0:00:35
      403000 -- (-390.225) (-390.518) [-391.155] (-395.950) * (-395.273) (-394.282) (-393.040) [-391.952] -- 0:00:35
      403500 -- (-391.937) (-395.431) (-391.571) [-394.650] * (-394.218) (-390.848) [-389.535] (-391.158) -- 0:00:35
      404000 -- (-392.323) [-390.555] (-394.528) (-392.390) * (-393.756) [-391.535] (-389.413) (-390.022) -- 0:00:35
      404500 -- (-393.669) (-390.418) (-392.698) [-391.598] * [-393.816] (-395.368) (-393.917) (-390.104) -- 0:00:35
      405000 -- [-390.530] (-390.103) (-390.966) (-394.812) * (-394.831) (-389.402) [-396.068] (-390.476) -- 0:00:35

      Average standard deviation of split frequencies: 0.013135

      405500 -- (-390.187) [-394.132] (-395.876) (-390.026) * (-391.240) (-392.793) [-394.656] (-392.278) -- 0:00:35
      406000 -- (-390.535) (-391.620) (-392.146) [-394.085] * (-390.936) (-390.645) [-392.709] (-393.040) -- 0:00:35
      406500 -- (-389.983) (-393.238) [-390.174] (-392.742) * (-391.533) (-391.856) [-391.301] (-390.784) -- 0:00:35
      407000 -- (-393.480) (-394.835) [-391.393] (-391.353) * [-390.168] (-389.632) (-390.280) (-391.293) -- 0:00:34
      407500 -- (-390.208) [-393.112] (-395.239) (-389.867) * (-392.475) (-392.850) [-390.391] (-391.846) -- 0:00:34
      408000 -- (-390.714) (-391.328) (-394.423) [-393.303] * [-392.530] (-393.154) (-390.464) (-391.074) -- 0:00:34
      408500 -- (-392.823) (-390.967) (-397.095) [-390.619] * [-390.672] (-390.968) (-391.727) (-392.577) -- 0:00:34
      409000 -- [-393.147] (-391.667) (-390.592) (-391.589) * (-398.649) [-393.756] (-394.456) (-392.097) -- 0:00:34
      409500 -- (-395.358) (-390.735) (-393.756) [-391.282] * (-391.862) (-392.054) [-394.641] (-390.265) -- 0:00:34
      410000 -- (-392.960) (-391.420) [-390.654] (-395.302) * (-390.653) (-391.372) (-391.970) [-389.130] -- 0:00:34

      Average standard deviation of split frequencies: 0.012627

      410500 -- (-391.737) [-391.447] (-391.308) (-390.306) * (-389.713) [-390.069] (-390.555) (-389.980) -- 0:00:34
      411000 -- (-392.217) (-390.217) (-390.309) [-392.952] * (-393.579) [-389.475] (-390.690) (-392.295) -- 0:00:34
      411500 -- (-390.537) (-392.867) [-391.934] (-392.311) * (-391.254) (-389.493) [-390.006] (-390.243) -- 0:00:34
      412000 -- (-396.160) (-390.367) (-390.040) [-389.474] * [-391.494] (-391.436) (-390.226) (-392.253) -- 0:00:34
      412500 -- (-392.641) (-394.191) (-389.810) [-390.461] * [-390.704] (-394.024) (-392.886) (-392.792) -- 0:00:35
      413000 -- (-392.138) (-395.189) (-392.597) [-392.249] * (-392.067) [-389.954] (-389.786) (-394.601) -- 0:00:35
      413500 -- (-391.457) [-391.800] (-392.644) (-389.306) * [-391.830] (-393.244) (-391.977) (-390.242) -- 0:00:35
      414000 -- (-391.689) (-391.228) [-389.961] (-389.169) * (-392.047) [-395.175] (-392.904) (-390.884) -- 0:00:35
      414500 -- [-391.088] (-390.296) (-390.815) (-391.773) * (-394.943) (-389.778) (-392.235) [-393.300] -- 0:00:35
      415000 -- (-390.862) (-390.751) (-390.117) [-397.276] * (-391.236) (-394.773) (-395.063) [-389.995] -- 0:00:35

      Average standard deviation of split frequencies: 0.012253

      415500 -- (-391.798) (-390.964) [-389.814] (-395.831) * [-393.486] (-391.935) (-396.206) (-389.693) -- 0:00:35
      416000 -- (-391.376) [-393.522] (-389.787) (-391.665) * (-398.537) (-389.472) [-392.031] (-391.126) -- 0:00:35
      416500 -- (-389.985) [-392.181] (-392.255) (-393.016) * (-391.928) [-390.075] (-397.371) (-392.248) -- 0:00:35
      417000 -- (-392.193) (-392.998) (-392.881) [-392.134] * [-398.918] (-390.372) (-394.911) (-390.218) -- 0:00:34
      417500 -- (-394.490) (-391.061) (-392.626) [-389.844] * [-390.392] (-392.820) (-390.093) (-394.183) -- 0:00:34
      418000 -- (-391.956) (-392.145) [-389.927] (-390.699) * (-393.230) (-398.734) (-392.160) [-389.268] -- 0:00:34
      418500 -- (-393.976) [-389.315] (-394.646) (-389.941) * (-391.145) [-390.847] (-389.963) (-388.994) -- 0:00:34
      419000 -- [-393.056] (-390.850) (-393.475) (-394.375) * (-390.501) [-392.540] (-390.686) (-391.392) -- 0:00:34
      419500 -- (-391.203) (-393.263) (-390.791) [-393.321] * [-390.725] (-393.115) (-390.211) (-391.166) -- 0:00:34
      420000 -- (-394.398) (-391.315) [-390.945] (-390.647) * [-389.819] (-392.942) (-395.309) (-392.248) -- 0:00:34

      Average standard deviation of split frequencies: 0.010926

      420500 -- (-391.508) [-389.570] (-391.856) (-392.095) * (-391.237) (-390.419) [-394.466] (-397.453) -- 0:00:34
      421000 -- (-390.216) (-391.398) [-389.546] (-389.366) * (-395.937) (-390.024) [-393.577] (-391.493) -- 0:00:34
      421500 -- (-390.312) (-389.673) [-390.101] (-392.826) * (-392.898) (-390.208) [-391.089] (-393.222) -- 0:00:34
      422000 -- (-392.020) (-388.985) (-391.033) [-393.867] * [-389.907] (-395.140) (-389.912) (-394.092) -- 0:00:34
      422500 -- (-395.870) [-390.404] (-391.758) (-394.876) * (-391.790) (-396.621) [-389.496] (-393.698) -- 0:00:34
      423000 -- (-390.099) [-389.600] (-390.275) (-389.429) * (-393.604) [-391.912] (-389.693) (-390.932) -- 0:00:34
      423500 -- (-391.254) [-391.301] (-391.971) (-390.726) * (-394.003) (-393.417) [-390.384] (-389.714) -- 0:00:34
      424000 -- [-390.309] (-396.105) (-392.466) (-395.074) * (-389.741) (-393.203) (-391.346) [-390.051] -- 0:00:33
      424500 -- [-391.455] (-389.452) (-391.097) (-394.535) * (-396.769) [-392.564] (-390.935) (-389.393) -- 0:00:33
      425000 -- [-391.057] (-389.984) (-390.315) (-390.855) * [-392.785] (-389.434) (-392.663) (-389.941) -- 0:00:33

      Average standard deviation of split frequencies: 0.010285

      425500 -- (-392.355) (-390.655) [-391.217] (-389.460) * (-392.329) (-389.929) (-389.710) [-390.016] -- 0:00:33
      426000 -- (-390.239) [-392.548] (-394.834) (-389.550) * (-394.827) [-393.884] (-391.002) (-390.349) -- 0:00:33
      426500 -- (-389.877) (-389.518) (-390.770) [-390.574] * (-396.433) [-394.123] (-390.913) (-390.724) -- 0:00:33
      427000 -- (-391.086) [-390.302] (-390.039) (-389.515) * (-390.789) (-395.640) (-391.909) [-392.119] -- 0:00:33
      427500 -- (-390.391) (-390.558) (-389.241) [-390.054] * (-391.640) (-398.004) [-390.144] (-390.068) -- 0:00:33
      428000 -- [-390.279] (-389.724) (-391.211) (-389.866) * (-392.317) (-390.905) [-391.419] (-390.422) -- 0:00:33
      428500 -- (-390.398) [-390.701] (-395.618) (-391.971) * [-389.192] (-393.336) (-390.038) (-393.899) -- 0:00:33
      429000 -- [-390.052] (-390.604) (-392.873) (-389.962) * [-390.770] (-392.290) (-392.896) (-393.684) -- 0:00:33
      429500 -- (-390.491) (-394.613) (-393.111) [-390.396] * (-390.561) (-392.734) [-392.099] (-393.150) -- 0:00:34
      430000 -- (-390.437) (-395.712) (-389.812) [-390.002] * (-389.385) (-393.337) [-389.264] (-391.911) -- 0:00:34

      Average standard deviation of split frequencies: 0.009980

      430500 -- (-390.905) (-392.420) [-390.130] (-393.653) * (-391.065) (-393.418) [-389.775] (-391.974) -- 0:00:34
      431000 -- (-393.061) [-389.837] (-389.868) (-392.201) * (-393.145) [-392.619] (-393.465) (-390.690) -- 0:00:34
      431500 -- (-393.257) (-391.361) (-391.911) [-391.705] * (-390.109) (-392.453) (-389.168) [-390.409] -- 0:00:34
      432000 -- (-394.776) [-389.865] (-390.013) (-396.337) * (-394.256) [-392.041] (-390.364) (-388.927) -- 0:00:34
      432500 -- (-391.557) (-392.126) [-390.778] (-390.223) * (-392.001) [-390.854] (-391.429) (-392.337) -- 0:00:34
      433000 -- (-390.432) (-389.850) [-392.221] (-393.153) * (-389.638) (-389.864) (-394.365) [-389.751] -- 0:00:34
      433500 -- (-394.273) (-390.117) (-389.841) [-390.522] * (-389.690) (-392.718) (-394.601) [-390.163] -- 0:00:33
      434000 -- (-390.467) [-389.892] (-390.983) (-389.687) * (-393.101) (-391.185) [-392.693] (-391.466) -- 0:00:33
      434500 -- (-391.514) [-390.870] (-392.106) (-391.568) * (-391.540) [-391.832] (-390.888) (-390.997) -- 0:00:33
      435000 -- (-390.812) (-390.027) (-394.426) [-394.125] * (-391.876) (-390.370) [-391.552] (-391.310) -- 0:00:33

      Average standard deviation of split frequencies: 0.010112

      435500 -- (-391.795) (-394.348) [-390.046] (-390.111) * (-394.271) (-392.888) [-392.492] (-391.842) -- 0:00:33
      436000 -- (-392.109) (-390.279) [-390.213] (-390.112) * (-390.704) (-394.899) (-396.860) [-392.632] -- 0:00:33
      436500 -- (-389.394) [-392.348] (-393.051) (-391.311) * [-396.218] (-392.197) (-393.614) (-393.202) -- 0:00:33
      437000 -- (-390.648) (-392.750) (-390.710) [-394.106] * (-394.870) (-390.473) (-391.590) [-389.300] -- 0:00:33
      437500 -- [-390.450] (-395.536) (-395.557) (-398.962) * [-392.432] (-389.702) (-394.094) (-393.401) -- 0:00:33
      438000 -- (-390.608) (-392.682) (-391.141) [-390.519] * (-390.656) (-390.426) [-390.847] (-390.670) -- 0:00:33
      438500 -- (-390.219) [-390.358] (-391.223) (-393.128) * (-390.263) (-390.074) [-389.721] (-392.477) -- 0:00:33
      439000 -- (-390.162) [-390.005] (-390.562) (-394.097) * (-394.333) (-389.642) [-390.092] (-398.597) -- 0:00:33
      439500 -- (-390.968) (-389.736) (-390.695) [-400.748] * (-392.639) [-392.597] (-389.503) (-391.291) -- 0:00:33
      440000 -- (-390.858) [-389.337] (-395.779) (-389.901) * (-391.539) (-391.168) (-390.482) [-390.512] -- 0:00:33

      Average standard deviation of split frequencies: 0.010631

      440500 -- [-392.355] (-390.738) (-396.939) (-393.882) * (-390.128) (-391.828) [-391.793] (-394.734) -- 0:00:33
      441000 -- (-391.614) (-392.010) [-392.752] (-389.993) * (-391.664) (-390.905) (-395.089) [-389.105] -- 0:00:32
      441500 -- (-397.657) [-390.747] (-390.850) (-390.321) * (-390.229) [-396.343] (-392.595) (-388.930) -- 0:00:32
      442000 -- (-396.663) [-390.188] (-393.930) (-391.124) * (-390.962) (-390.532) (-389.634) [-389.542] -- 0:00:32
      442500 -- (-394.631) (-389.685) [-392.376] (-389.961) * [-390.399] (-390.394) (-391.297) (-391.172) -- 0:00:32
      443000 -- (-397.983) (-390.045) [-391.359] (-391.418) * (-390.343) [-390.747] (-394.202) (-393.626) -- 0:00:32
      443500 -- (-393.859) (-389.334) (-396.759) [-394.968] * [-391.430] (-391.424) (-390.423) (-394.401) -- 0:00:32
      444000 -- [-397.444] (-395.663) (-390.640) (-390.961) * (-391.504) (-392.667) [-390.602] (-391.882) -- 0:00:32
      444500 -- [-397.376] (-397.395) (-399.793) (-392.189) * (-394.086) [-389.758] (-394.010) (-391.003) -- 0:00:32
      445000 -- (-395.148) (-397.381) (-392.026) [-392.391] * (-390.607) (-389.965) [-391.866] (-390.284) -- 0:00:32

      Average standard deviation of split frequencies: 0.010694

      445500 -- (-390.966) (-396.627) [-391.941] (-393.872) * (-389.053) (-390.405) (-393.693) [-391.408] -- 0:00:32
      446000 -- [-391.114] (-392.039) (-393.462) (-390.615) * (-389.926) (-390.759) (-391.403) [-391.169] -- 0:00:33
      446500 -- (-391.000) (-394.330) (-395.008) [-390.483] * (-390.659) (-392.184) (-390.794) [-391.107] -- 0:00:33
      447000 -- (-389.639) (-396.027) [-392.550] (-389.862) * (-393.471) (-393.158) (-392.564) [-392.207] -- 0:00:33
      447500 -- (-390.640) [-395.672] (-389.767) (-392.063) * (-394.277) (-391.848) [-392.052] (-391.601) -- 0:00:33
      448000 -- (-390.518) (-393.080) (-392.359) [-390.207] * (-392.039) (-395.199) (-391.699) [-390.202] -- 0:00:33
      448500 -- (-392.834) (-394.140) [-393.297] (-389.387) * (-390.506) [-391.353] (-389.639) (-393.313) -- 0:00:33
      449000 -- [-391.012] (-390.958) (-393.727) (-390.510) * (-390.410) [-390.838] (-389.889) (-390.469) -- 0:00:33
      449500 -- (-395.320) (-391.969) (-391.213) [-390.221] * (-392.254) (-393.181) (-391.572) [-390.066] -- 0:00:33
      450000 -- (-390.344) (-392.413) [-391.462] (-393.961) * (-395.349) (-390.004) (-390.943) [-393.509] -- 0:00:33

      Average standard deviation of split frequencies: 0.011049

      450500 -- (-390.711) (-391.688) (-390.406) [-390.119] * (-391.907) [-391.966] (-390.024) (-390.756) -- 0:00:32
      451000 -- (-393.045) (-393.095) [-390.016] (-389.354) * (-391.694) (-391.406) [-393.654] (-390.925) -- 0:00:32
      451500 -- (-389.513) (-389.848) (-390.403) [-391.345] * [-393.822] (-392.404) (-393.298) (-390.310) -- 0:00:32
      452000 -- (-392.771) (-390.601) (-392.639) [-389.682] * (-389.227) (-389.180) (-395.633) [-390.850] -- 0:00:32
      452500 -- (-393.276) (-391.463) (-392.520) [-390.194] * [-393.945] (-390.671) (-393.508) (-392.016) -- 0:00:32
      453000 -- (-391.544) [-393.330] (-393.757) (-389.688) * (-395.383) (-389.816) [-390.262] (-390.396) -- 0:00:32
      453500 -- (-391.093) [-391.298] (-390.928) (-389.724) * (-391.678) (-390.177) [-391.329] (-389.548) -- 0:00:32
      454000 -- (-390.997) (-392.824) (-392.716) [-390.071] * [-391.782] (-392.670) (-389.941) (-391.505) -- 0:00:32
      454500 -- (-395.337) (-390.183) [-390.655] (-392.927) * (-393.507) (-390.059) (-393.542) [-389.894] -- 0:00:32
      455000 -- (-389.948) (-390.815) (-391.194) [-390.339] * (-393.630) [-390.958] (-389.255) (-390.004) -- 0:00:32

      Average standard deviation of split frequencies: 0.010144

      455500 -- (-392.841) [-391.872] (-392.483) (-389.976) * (-395.695) [-391.358] (-389.342) (-390.035) -- 0:00:32
      456000 -- (-394.987) [-394.477] (-397.596) (-390.629) * [-391.568] (-391.679) (-390.167) (-395.060) -- 0:00:32
      456500 -- (-392.926) (-391.224) (-389.578) [-393.983] * [-389.367] (-392.667) (-394.655) (-395.526) -- 0:00:32
      457000 -- (-391.902) (-392.374) (-390.641) [-392.221] * (-394.757) [-392.049] (-390.976) (-392.225) -- 0:00:32
      457500 -- [-390.646] (-393.249) (-392.996) (-389.479) * (-390.508) (-389.458) (-390.385) [-391.188] -- 0:00:32
      458000 -- [-391.690] (-392.138) (-391.674) (-390.936) * (-391.568) (-392.859) [-395.272] (-393.068) -- 0:00:31
      458500 -- (-395.811) (-393.716) (-391.678) [-393.276] * [-394.318] (-392.602) (-392.613) (-391.389) -- 0:00:31
      459000 -- [-392.780] (-391.132) (-393.379) (-390.898) * (-391.267) [-394.771] (-392.292) (-389.880) -- 0:00:31
      459500 -- (-391.430) [-389.885] (-390.152) (-389.777) * (-391.299) [-390.782] (-392.638) (-390.558) -- 0:00:31
      460000 -- (-394.710) [-389.752] (-393.270) (-391.414) * (-392.201) (-389.059) (-396.516) [-390.886] -- 0:00:31

      Average standard deviation of split frequencies: 0.009466

      460500 -- [-389.990] (-391.071) (-390.160) (-390.221) * (-390.447) (-390.818) (-392.557) [-393.342] -- 0:00:31
      461000 -- [-390.142] (-390.054) (-389.307) (-392.589) * (-390.433) (-393.314) (-393.552) [-394.655] -- 0:00:31
      461500 -- (-390.302) [-389.743] (-393.000) (-393.299) * (-389.423) (-391.563) [-389.456] (-389.854) -- 0:00:31
      462000 -- (-390.778) (-390.149) [-393.659] (-392.722) * (-390.669) (-390.120) (-397.396) [-389.849] -- 0:00:31
      462500 -- (-391.154) (-391.212) [-389.761] (-394.081) * (-395.670) [-392.068] (-396.470) (-390.703) -- 0:00:31
      463000 -- [-390.408] (-390.089) (-390.554) (-397.177) * (-394.665) (-396.272) [-389.666] (-391.385) -- 0:00:32
      463500 -- (-389.918) (-390.339) (-391.645) [-389.707] * (-392.532) (-391.228) [-391.806] (-391.879) -- 0:00:32
      464000 -- [-393.614] (-389.368) (-389.862) (-393.137) * [-390.280] (-392.660) (-389.874) (-393.160) -- 0:00:32
      464500 -- (-393.243) (-391.369) [-389.377] (-393.240) * (-392.238) [-394.027] (-389.754) (-392.339) -- 0:00:32
      465000 -- [-392.559] (-394.785) (-390.970) (-389.690) * (-396.027) [-395.038] (-391.720) (-390.859) -- 0:00:32

      Average standard deviation of split frequencies: 0.009104

      465500 -- [-392.416] (-392.119) (-391.473) (-390.575) * (-392.393) (-393.294) [-391.137] (-390.555) -- 0:00:32
      466000 -- [-391.019] (-390.798) (-392.287) (-391.828) * [-393.171] (-393.798) (-390.350) (-390.534) -- 0:00:32
      466500 -- (-393.456) (-391.871) (-395.855) [-392.818] * (-392.190) (-391.304) (-390.572) [-390.617] -- 0:00:32
      467000 -- (-394.161) [-390.235] (-390.442) (-393.534) * (-390.367) (-389.654) (-394.920) [-391.196] -- 0:00:31
      467500 -- (-392.289) [-390.936] (-389.815) (-391.841) * (-389.842) (-390.418) (-392.505) [-391.090] -- 0:00:31
      468000 -- (-393.271) (-391.795) (-392.577) [-390.184] * (-394.833) (-389.994) [-390.564] (-393.045) -- 0:00:31
      468500 -- (-396.062) [-391.336] (-391.609) (-391.327) * (-389.841) (-392.987) [-392.689] (-392.215) -- 0:00:31
      469000 -- [-392.689] (-397.513) (-392.180) (-394.242) * (-391.601) (-390.221) (-391.411) [-392.545] -- 0:00:31
      469500 -- [-392.249] (-390.174) (-393.607) (-390.135) * (-394.901) [-389.690] (-390.219) (-392.042) -- 0:00:31
      470000 -- (-391.776) [-389.770] (-391.680) (-391.871) * (-394.614) [-389.897] (-390.867) (-391.790) -- 0:00:31

      Average standard deviation of split frequencies: 0.008764

      470500 -- (-390.294) (-391.935) (-392.693) [-392.030] * (-391.757) (-390.998) (-389.875) [-390.503] -- 0:00:31
      471000 -- (-390.396) [-390.942] (-392.229) (-391.828) * (-392.989) [-391.494] (-390.017) (-389.663) -- 0:00:31
      471500 -- (-391.015) (-390.586) [-390.932] (-393.374) * (-393.162) (-392.820) [-389.989] (-390.112) -- 0:00:31
      472000 -- (-392.155) (-390.628) (-390.060) [-389.668] * (-389.314) (-392.070) (-390.721) [-391.010] -- 0:00:31
      472500 -- [-390.313] (-389.853) (-389.575) (-389.447) * [-389.510] (-389.264) (-389.115) (-397.819) -- 0:00:31
      473000 -- (-390.785) (-390.516) (-394.685) [-389.538] * [-390.174] (-390.502) (-389.059) (-390.065) -- 0:00:31
      473500 -- (-391.616) [-390.317] (-392.341) (-390.330) * (-392.414) (-397.059) [-391.516] (-390.876) -- 0:00:31
      474000 -- (-391.187) [-393.979] (-391.247) (-390.222) * (-392.153) (-395.907) [-390.383] (-390.456) -- 0:00:31
      474500 -- (-390.482) [-391.635] (-392.313) (-391.665) * (-394.285) (-392.290) (-390.728) [-390.634] -- 0:00:31
      475000 -- (-392.232) (-390.139) (-391.416) [-391.936] * (-391.534) [-390.003] (-389.465) (-391.639) -- 0:00:30

      Average standard deviation of split frequencies: 0.009037

      475500 -- (-392.772) (-390.461) (-389.851) [-391.694] * (-395.309) (-390.306) (-390.513) [-389.958] -- 0:00:30
      476000 -- (-391.323) (-393.263) [-390.234] (-393.702) * (-391.536) [-391.329] (-391.524) (-394.485) -- 0:00:30
      476500 -- (-391.200) (-391.735) (-391.808) [-390.946] * (-395.705) [-390.461] (-390.494) (-391.060) -- 0:00:30
      477000 -- (-389.845) [-391.500] (-393.028) (-389.991) * [-390.958] (-389.416) (-393.674) (-391.162) -- 0:00:30
      477500 -- [-392.595] (-393.752) (-392.135) (-392.763) * (-391.163) [-390.089] (-389.388) (-389.434) -- 0:00:30
      478000 -- [-396.942] (-392.495) (-391.108) (-391.600) * (-389.700) [-390.507] (-391.849) (-390.451) -- 0:00:30
      478500 -- (-393.312) (-390.372) (-391.128) [-392.423] * [-390.393] (-393.815) (-390.281) (-393.261) -- 0:00:30
      479000 -- [-389.977] (-391.581) (-390.618) (-392.872) * (-392.010) (-392.252) (-394.278) [-391.978] -- 0:00:30
      479500 -- (-390.006) (-391.023) (-390.834) [-393.486] * (-392.718) (-389.656) (-389.768) [-395.067] -- 0:00:30
      480000 -- [-392.130] (-389.788) (-391.025) (-396.495) * (-390.093) (-390.930) [-390.931] (-393.352) -- 0:00:31

      Average standard deviation of split frequencies: 0.009501

      480500 -- [-390.055] (-392.800) (-390.781) (-392.614) * (-392.166) [-388.976] (-390.294) (-390.887) -- 0:00:31
      481000 -- (-390.459) (-392.957) [-390.619] (-391.546) * [-394.682] (-393.073) (-392.378) (-390.679) -- 0:00:31
      481500 -- (-390.704) (-390.797) (-390.779) [-392.152] * (-393.876) (-392.576) [-394.813] (-390.741) -- 0:00:31
      482000 -- (-392.364) (-393.279) (-390.069) [-392.835] * [-390.801] (-395.096) (-391.909) (-390.161) -- 0:00:31
      482500 -- (-391.370) [-391.960] (-389.696) (-390.391) * (-399.564) (-391.357) (-391.308) [-392.160] -- 0:00:31
      483000 -- (-390.816) (-391.830) [-392.550] (-389.431) * [-391.886] (-390.865) (-394.144) (-393.107) -- 0:00:31
      483500 -- (-391.927) (-389.504) [-391.134] (-389.732) * (-392.141) (-389.657) (-390.795) [-391.453] -- 0:00:30
      484000 -- [-390.268] (-390.853) (-390.442) (-394.874) * [-393.704] (-389.621) (-391.614) (-395.024) -- 0:00:30
      484500 -- (-390.149) (-392.039) [-389.562] (-390.345) * (-394.338) (-390.778) (-390.139) [-393.487] -- 0:00:30
      485000 -- (-390.329) (-391.008) (-389.673) [-392.340] * (-389.809) [-389.419] (-394.457) (-397.965) -- 0:00:30

      Average standard deviation of split frequencies: 0.008790

      485500 -- (-391.562) (-390.259) (-394.651) [-390.564] * (-389.101) [-389.839] (-392.780) (-391.304) -- 0:00:30
      486000 -- (-390.477) (-390.245) (-391.433) [-390.909] * (-390.900) (-389.231) [-390.316] (-389.650) -- 0:00:30
      486500 -- (-391.663) (-389.376) (-391.300) [-391.186] * (-396.696) [-390.746] (-390.311) (-390.992) -- 0:00:30
      487000 -- (-390.391) (-389.962) [-390.950] (-390.635) * [-390.048] (-390.226) (-390.893) (-390.088) -- 0:00:30
      487500 -- (-390.877) [-390.282] (-390.257) (-391.819) * (-391.209) (-391.579) [-390.792] (-389.569) -- 0:00:30
      488000 -- [-390.630] (-391.712) (-390.971) (-390.788) * (-392.807) [-390.835] (-397.477) (-389.874) -- 0:00:30
      488500 -- (-391.912) (-391.118) (-392.565) [-390.440] * [-392.559] (-391.486) (-392.506) (-389.068) -- 0:00:30
      489000 -- (-389.572) [-391.472] (-390.516) (-390.706) * (-389.786) [-390.743] (-394.234) (-391.976) -- 0:00:30
      489500 -- (-389.870) [-392.538] (-390.726) (-390.227) * (-396.076) (-394.665) (-391.367) [-389.651] -- 0:00:30
      490000 -- (-390.970) (-393.654) (-394.790) [-390.619] * (-390.565) (-390.724) (-390.537) [-392.968] -- 0:00:30

      Average standard deviation of split frequencies: 0.008587

      490500 -- (-393.037) [-391.927] (-400.529) (-395.213) * (-396.881) [-390.139] (-393.475) (-392.106) -- 0:00:30
      491000 -- (-389.512) (-393.433) [-390.550] (-395.035) * [-390.429] (-389.700) (-389.895) (-393.386) -- 0:00:30
      491500 -- (-391.269) (-390.405) (-390.859) [-393.505] * (-390.578) [-394.608] (-393.513) (-395.799) -- 0:00:30
      492000 -- (-389.762) (-392.041) (-391.336) [-392.914] * (-392.285) (-392.836) (-391.104) [-391.138] -- 0:00:29
      492500 -- [-393.242] (-390.140) (-392.172) (-389.594) * (-390.439) (-391.389) [-392.880] (-393.730) -- 0:00:29
      493000 -- (-391.038) (-390.098) (-390.922) [-389.975] * (-391.441) [-389.441] (-395.114) (-392.805) -- 0:00:29
      493500 -- (-390.414) (-391.857) (-390.856) [-393.145] * (-389.708) (-390.717) [-390.261] (-392.807) -- 0:00:29
      494000 -- (-390.085) (-390.254) [-391.401] (-390.920) * (-390.859) (-395.407) (-391.722) [-391.440] -- 0:00:29
      494500 -- [-390.903] (-394.427) (-393.686) (-394.640) * (-390.641) (-390.481) (-390.962) [-391.676] -- 0:00:29
      495000 -- [-390.394] (-395.909) (-392.232) (-390.186) * (-390.610) (-389.870) (-391.682) [-389.564] -- 0:00:29

      Average standard deviation of split frequencies: 0.008490

      495500 -- (-390.424) (-393.831) [-393.799] (-392.666) * (-394.499) (-395.123) (-391.834) [-389.508] -- 0:00:29
      496000 -- (-392.014) (-393.255) [-389.627] (-391.012) * (-392.707) (-390.248) (-390.254) [-391.590] -- 0:00:29
      496500 -- [-390.592] (-393.011) (-390.942) (-392.233) * (-391.432) [-389.605] (-391.725) (-392.522) -- 0:00:29
      497000 -- [-389.755] (-390.454) (-390.857) (-391.372) * [-390.953] (-393.573) (-394.065) (-393.701) -- 0:00:30
      497500 -- (-389.344) (-390.444) (-392.918) [-394.150] * (-391.753) (-394.181) [-391.646] (-391.910) -- 0:00:30
      498000 -- (-393.462) [-391.841] (-392.142) (-392.024) * [-394.294] (-394.242) (-396.268) (-392.852) -- 0:00:30
      498500 -- [-392.366] (-389.976) (-391.648) (-394.297) * [-394.597] (-395.049) (-396.662) (-391.459) -- 0:00:30
      499000 -- (-390.140) [-390.928] (-392.161) (-395.008) * (-394.833) (-390.772) (-389.977) [-391.377] -- 0:00:30
      499500 -- (-389.461) (-391.086) (-390.429) [-390.575] * (-389.289) (-389.673) (-390.905) [-390.501] -- 0:00:30
      500000 -- [-392.400] (-393.211) (-392.583) (-394.101) * [-390.640] (-391.439) (-390.693) (-393.523) -- 0:00:30

      Average standard deviation of split frequencies: 0.007407

      500500 -- (-391.196) (-389.851) (-390.799) [-391.241] * (-389.516) [-392.530] (-391.159) (-389.848) -- 0:00:29
      501000 -- (-391.176) [-389.898] (-391.989) (-390.482) * (-390.602) (-390.498) (-394.304) [-394.942] -- 0:00:29
      501500 -- (-394.359) [-390.867] (-392.424) (-391.590) * (-391.050) (-390.216) [-393.391] (-389.696) -- 0:00:29
      502000 -- [-390.393] (-389.274) (-390.551) (-393.953) * [-389.594] (-391.326) (-392.830) (-391.463) -- 0:00:29
      502500 -- (-391.740) (-394.701) (-390.231) [-398.701] * [-389.453] (-394.554) (-394.988) (-392.303) -- 0:00:29
      503000 -- (-390.818) (-389.330) (-389.884) [-391.065] * [-390.794] (-390.509) (-390.817) (-391.296) -- 0:00:29
      503500 -- (-390.101) [-389.298] (-389.500) (-389.662) * (-391.499) (-391.051) (-398.230) [-389.897] -- 0:00:29
      504000 -- (-392.153) (-392.032) (-389.664) [-390.118] * (-389.378) (-391.952) [-393.110] (-393.177) -- 0:00:29
      504500 -- (-392.310) (-390.903) [-390.638] (-393.847) * (-390.067) [-391.727] (-392.434) (-391.749) -- 0:00:29
      505000 -- (-394.186) (-390.795) [-391.446] (-391.032) * (-392.630) (-395.447) [-391.623] (-391.500) -- 0:00:29

      Average standard deviation of split frequencies: 0.007453

      505500 -- (-391.949) [-391.052] (-394.530) (-392.284) * [-390.670] (-392.294) (-391.755) (-390.469) -- 0:00:29
      506000 -- (-395.227) (-389.404) [-391.153] (-390.146) * (-390.895) (-394.047) (-394.550) [-389.828] -- 0:00:29
      506500 -- (-391.414) (-389.979) (-394.309) [-390.708] * (-391.058) (-391.365) (-391.640) [-389.349] -- 0:00:29
      507000 -- (-392.243) (-390.019) [-391.816] (-397.626) * (-391.750) [-392.493] (-391.978) (-391.983) -- 0:00:29
      507500 -- [-390.461] (-390.538) (-393.762) (-391.810) * [-391.568] (-391.251) (-390.152) (-392.387) -- 0:00:29
      508000 -- (-393.069) (-390.742) [-392.348] (-391.875) * (-391.242) [-393.144] (-392.022) (-390.645) -- 0:00:29
      508500 -- (-391.868) (-389.313) [-390.631] (-398.353) * (-390.419) (-394.529) (-390.546) [-390.057] -- 0:00:28
      509000 -- (-390.454) (-389.590) [-393.353] (-390.608) * (-391.185) [-392.041] (-391.537) (-391.513) -- 0:00:28
      509500 -- (-390.096) (-391.964) (-393.965) [-390.625] * (-390.664) (-393.307) (-389.356) [-390.466] -- 0:00:28
      510000 -- (-391.886) (-392.757) (-392.935) [-390.210] * (-390.433) (-398.054) (-394.966) [-390.252] -- 0:00:28

      Average standard deviation of split frequencies: 0.007693

      510500 -- (-391.117) [-392.050] (-392.480) (-391.573) * (-397.075) [-393.195] (-392.457) (-390.712) -- 0:00:28
      511000 -- [-393.890] (-394.078) (-391.220) (-389.632) * (-393.324) (-394.825) [-389.863] (-391.323) -- 0:00:28
      511500 -- (-396.408) (-395.373) [-390.268] (-390.312) * [-390.455] (-392.583) (-391.482) (-391.198) -- 0:00:28
      512000 -- (-392.039) [-391.674] (-390.942) (-390.256) * [-389.420] (-392.262) (-390.130) (-393.788) -- 0:00:28
      512500 -- (-394.415) (-392.178) (-394.565) [-391.762] * (-389.463) [-391.773] (-391.301) (-389.921) -- 0:00:28
      513000 -- (-395.252) (-392.898) [-390.195] (-392.259) * (-389.615) (-390.520) (-393.914) [-391.392] -- 0:00:28
      513500 -- (-390.503) (-396.450) [-391.375] (-390.893) * (-390.893) (-391.427) (-397.104) [-389.865] -- 0:00:28
      514000 -- (-393.912) [-395.787] (-391.216) (-394.026) * [-389.857] (-390.878) (-393.494) (-389.595) -- 0:00:29
      514500 -- (-391.959) (-392.506) [-390.474] (-389.444) * (-391.978) [-390.516] (-390.003) (-391.068) -- 0:00:29
      515000 -- [-392.757] (-392.531) (-392.370) (-390.701) * (-390.214) [-389.973] (-389.727) (-391.649) -- 0:00:29

      Average standard deviation of split frequencies: 0.008161

      515500 -- [-391.535] (-392.774) (-390.733) (-390.596) * (-393.230) (-392.639) [-392.311] (-389.983) -- 0:00:29
      516000 -- (-391.096) (-393.099) (-391.240) [-391.295] * (-390.085) [-392.068] (-392.664) (-392.099) -- 0:00:29
      516500 -- (-390.288) (-395.364) [-392.258] (-389.902) * (-393.716) (-391.623) (-393.033) [-389.655] -- 0:00:29
      517000 -- [-391.503] (-390.863) (-391.403) (-390.568) * (-391.371) (-393.297) [-391.011] (-389.822) -- 0:00:28
      517500 -- (-390.570) [-389.880] (-391.895) (-390.168) * (-389.874) [-395.393] (-394.017) (-391.415) -- 0:00:28
      518000 -- (-389.952) (-390.103) [-389.886] (-391.427) * (-391.150) (-393.125) [-395.244] (-390.296) -- 0:00:28
      518500 -- (-390.530) (-392.018) (-389.538) [-393.243] * (-389.798) (-392.633) (-396.114) [-390.278] -- 0:00:28
      519000 -- [-391.843] (-395.611) (-389.803) (-391.789) * (-390.217) (-390.513) [-391.386] (-389.419) -- 0:00:28
      519500 -- (-389.891) (-394.265) (-390.729) [-392.330] * (-392.774) (-390.105) [-389.576] (-393.980) -- 0:00:28
      520000 -- [-390.043] (-392.747) (-392.976) (-395.315) * (-391.969) [-391.304] (-389.340) (-393.178) -- 0:00:28

      Average standard deviation of split frequencies: 0.008390

      520500 -- [-393.221] (-393.151) (-391.727) (-393.764) * (-390.330) (-389.823) (-391.575) [-390.355] -- 0:00:28
      521000 -- (-390.490) (-390.153) [-390.296] (-395.060) * (-390.015) [-391.328] (-392.936) (-391.853) -- 0:00:28
      521500 -- (-389.393) [-392.049] (-390.311) (-393.500) * (-391.397) (-390.141) (-390.503) [-392.980] -- 0:00:28
      522000 -- (-389.915) (-390.247) (-394.398) [-390.180] * [-389.762] (-391.648) (-390.349) (-390.483) -- 0:00:28
      522500 -- (-390.118) (-391.176) (-391.054) [-394.124] * (-392.983) [-390.767] (-390.402) (-391.184) -- 0:00:28
      523000 -- (-396.861) (-395.878) (-390.281) [-390.976] * (-392.921) (-393.031) (-390.740) [-389.947] -- 0:00:28
      523500 -- (-392.049) (-394.037) (-391.508) [-390.527] * (-390.237) [-393.533] (-392.150) (-392.384) -- 0:00:28
      524000 -- (-392.263) (-390.800) [-391.105] (-390.350) * (-392.567) (-389.632) [-391.275] (-393.202) -- 0:00:28
      524500 -- (-389.948) (-394.324) [-391.149] (-391.861) * (-389.798) (-392.601) [-390.438] (-394.972) -- 0:00:28
      525000 -- (-391.335) [-392.018] (-394.889) (-389.758) * (-391.113) [-394.501] (-393.048) (-392.148) -- 0:00:28

      Average standard deviation of split frequencies: 0.008245

      525500 -- (-391.304) (-390.333) [-391.234] (-391.269) * (-395.240) [-388.877] (-390.349) (-392.268) -- 0:00:27
      526000 -- (-392.823) (-390.510) (-393.216) [-389.960] * (-392.638) (-392.961) [-392.286] (-390.727) -- 0:00:27
      526500 -- (-391.786) (-393.719) [-389.967] (-392.643) * (-390.574) (-391.216) (-390.304) [-391.501] -- 0:00:27
      527000 -- [-390.984] (-392.992) (-391.139) (-390.596) * [-390.342] (-392.004) (-390.834) (-393.023) -- 0:00:27
      527500 -- (-393.756) (-394.839) (-395.377) [-393.156] * (-389.547) [-389.787] (-389.441) (-395.752) -- 0:00:27
      528000 -- [-391.748] (-392.567) (-390.194) (-393.837) * (-393.836) [-390.703] (-389.951) (-396.530) -- 0:00:27
      528500 -- (-390.076) [-391.062] (-390.764) (-389.985) * [-393.416] (-389.538) (-393.053) (-391.520) -- 0:00:27
      529000 -- (-389.896) (-396.850) [-390.351] (-396.379) * (-392.476) (-392.139) (-392.466) [-390.936] -- 0:00:27
      529500 -- [-390.443] (-392.012) (-390.705) (-390.672) * (-391.285) (-391.864) (-396.518) [-389.862] -- 0:00:27
      530000 -- (-391.619) (-390.659) [-395.992] (-390.754) * (-391.836) [-390.577] (-390.846) (-391.729) -- 0:00:27

      Average standard deviation of split frequencies: 0.008350

      530500 -- (-390.453) [-390.036] (-391.869) (-393.950) * (-398.055) [-389.576] (-391.415) (-392.099) -- 0:00:27
      531000 -- [-391.466] (-390.530) (-389.280) (-391.427) * [-392.286] (-389.951) (-389.739) (-389.434) -- 0:00:28
      531500 -- (-392.488) (-390.375) [-393.866] (-391.377) * [-391.672] (-390.282) (-391.702) (-392.655) -- 0:00:28
      532000 -- [-389.574] (-393.492) (-390.881) (-389.604) * [-390.736] (-391.174) (-392.166) (-391.151) -- 0:00:28
      532500 -- (-392.956) [-391.600] (-390.342) (-391.338) * (-391.821) (-390.044) [-389.818] (-395.158) -- 0:00:28
      533000 -- (-389.022) (-391.175) (-389.280) [-389.986] * [-390.593] (-391.524) (-391.504) (-392.607) -- 0:00:28
      533500 -- (-392.447) [-390.391] (-389.067) (-392.053) * [-390.684] (-389.284) (-391.627) (-393.303) -- 0:00:27
      534000 -- (-390.664) (-390.212) [-392.107] (-392.388) * (-394.331) (-389.264) (-392.583) [-389.986] -- 0:00:27
      534500 -- (-394.571) (-392.310) (-390.729) [-393.550] * [-391.496] (-394.410) (-391.085) (-391.001) -- 0:00:27
      535000 -- [-393.088] (-393.139) (-390.975) (-395.295) * (-394.944) [-393.100] (-391.960) (-390.675) -- 0:00:27

      Average standard deviation of split frequencies: 0.007915

      535500 -- (-391.349) [-396.431] (-394.393) (-392.129) * (-393.902) (-391.155) (-391.760) [-395.529] -- 0:00:27
      536000 -- (-392.418) [-394.742] (-392.170) (-393.033) * (-391.833) (-394.413) (-392.719) [-392.231] -- 0:00:27
      536500 -- (-392.644) (-389.668) [-390.904] (-393.868) * (-389.829) (-394.383) (-392.031) [-390.747] -- 0:00:27
      537000 -- (-392.633) [-390.036] (-393.544) (-395.081) * (-394.072) (-392.801) (-389.571) [-390.981] -- 0:00:27
      537500 -- [-391.415] (-389.575) (-391.819) (-389.789) * [-391.663] (-392.166) (-389.913) (-392.905) -- 0:00:27
      538000 -- (-391.286) [-391.812] (-391.020) (-390.828) * (-392.527) (-391.326) [-391.578] (-394.197) -- 0:00:27
      538500 -- (-390.694) (-389.697) [-391.176] (-390.753) * (-392.912) (-390.651) [-390.080] (-391.346) -- 0:00:27
      539000 -- [-390.082] (-392.325) (-392.457) (-391.572) * (-393.084) (-390.712) [-389.539] (-390.243) -- 0:00:27
      539500 -- (-390.775) (-391.133) [-389.859] (-391.867) * (-389.885) (-390.486) [-398.133] (-392.665) -- 0:00:27
      540000 -- (-391.872) [-390.758] (-391.644) (-394.913) * (-391.218) (-394.163) (-390.298) [-392.299] -- 0:00:27

      Average standard deviation of split frequencies: 0.007963

      540500 -- [-390.884] (-390.179) (-390.118) (-390.245) * [-390.391] (-392.838) (-393.872) (-392.233) -- 0:00:27
      541000 -- (-392.393) (-389.770) [-391.327] (-393.901) * [-392.407] (-393.683) (-389.356) (-392.395) -- 0:00:27
      541500 -- (-390.932) (-390.561) [-391.944] (-391.550) * (-395.184) (-393.968) [-390.059] (-396.559) -- 0:00:27
      542000 -- (-390.470) [-392.129] (-389.628) (-392.450) * (-389.925) (-394.815) [-391.138] (-392.332) -- 0:00:27
      542500 -- [-391.310] (-391.235) (-389.345) (-392.149) * (-390.440) (-394.978) (-393.624) [-391.185] -- 0:00:26
      543000 -- (-394.538) (-391.860) (-391.674) [-393.756] * (-391.234) (-394.077) (-394.269) [-390.471] -- 0:00:26
      543500 -- (-393.463) (-391.534) [-392.338] (-391.270) * [-390.817] (-393.326) (-391.917) (-394.496) -- 0:00:26
      544000 -- (-391.331) (-393.457) (-391.864) [-391.864] * (-393.981) (-393.376) [-390.063] (-395.033) -- 0:00:26
      544500 -- (-391.137) (-392.709) (-389.398) [-395.917] * (-390.925) [-389.979] (-390.725) (-393.737) -- 0:00:26
      545000 -- (-391.499) (-390.071) (-389.397) [-390.521] * (-390.878) (-390.826) [-391.546] (-394.845) -- 0:00:26

      Average standard deviation of split frequencies: 0.008364

      545500 -- (-389.141) (-389.521) [-389.150] (-390.857) * (-391.392) [-393.945] (-391.820) (-390.503) -- 0:00:26
      546000 -- (-391.913) (-390.052) [-389.611] (-395.316) * (-390.020) (-394.383) [-389.700] (-389.904) -- 0:00:26
      546500 -- (-391.665) [-390.029] (-390.226) (-392.005) * (-391.316) [-390.642] (-390.428) (-389.780) -- 0:00:26
      547000 -- (-389.888) (-391.097) (-395.070) [-390.574] * (-390.670) (-389.405) (-390.661) [-391.818] -- 0:00:26
      547500 -- (-391.074) (-394.948) (-392.675) [-389.729] * (-393.262) (-390.704) [-391.842] (-390.912) -- 0:00:26
      548000 -- (-390.156) (-389.805) (-390.404) [-392.780] * (-390.765) [-391.332] (-389.471) (-393.020) -- 0:00:27
      548500 -- (-389.762) [-390.224] (-390.308) (-394.299) * (-391.129) [-389.614] (-389.739) (-393.491) -- 0:00:27
      549000 -- [-390.238] (-391.910) (-393.222) (-392.127) * (-390.020) [-391.144] (-389.350) (-393.967) -- 0:00:27
      549500 -- [-392.432] (-390.035) (-391.458) (-390.692) * (-393.176) (-390.877) [-390.033] (-393.706) -- 0:00:27
      550000 -- [-392.682] (-390.118) (-394.415) (-389.109) * (-391.652) [-391.145] (-389.331) (-397.348) -- 0:00:27

      Average standard deviation of split frequencies: 0.007972

      550500 -- (-389.232) [-390.404] (-394.819) (-395.130) * [-389.840] (-392.804) (-392.709) (-390.501) -- 0:00:26
      551000 -- [-391.083] (-392.248) (-391.687) (-390.779) * (-390.831) (-392.009) [-390.458] (-390.425) -- 0:00:26
      551500 -- (-391.808) (-393.770) (-390.670) [-391.226] * (-392.193) (-389.422) (-391.923) [-390.488] -- 0:00:26
      552000 -- (-390.633) [-391.149] (-390.634) (-390.601) * (-391.411) (-391.232) [-390.532] (-391.214) -- 0:00:26
      552500 -- (-390.863) (-394.600) [-392.496] (-389.734) * [-389.646] (-391.488) (-390.494) (-392.022) -- 0:00:26
      553000 -- (-391.733) (-391.224) [-389.887] (-396.720) * (-392.528) [-391.464] (-390.226) (-391.766) -- 0:00:26
      553500 -- [-391.861] (-390.510) (-392.244) (-395.931) * (-397.180) [-390.113] (-391.395) (-391.624) -- 0:00:26
      554000 -- (-390.405) (-395.180) [-392.091] (-392.271) * [-390.592] (-391.432) (-390.422) (-393.520) -- 0:00:26
      554500 -- [-391.826] (-392.237) (-391.714) (-390.644) * [-390.335] (-389.279) (-391.668) (-389.979) -- 0:00:26
      555000 -- (-390.509) [-395.224] (-389.199) (-391.025) * (-390.522) (-390.088) [-391.940] (-389.457) -- 0:00:26

      Average standard deviation of split frequencies: 0.007631

      555500 -- (-390.120) (-393.497) [-390.061] (-393.533) * (-389.874) [-390.894] (-390.943) (-390.499) -- 0:00:26
      556000 -- (-393.614) (-390.349) [-390.387] (-391.746) * (-391.253) [-389.655] (-390.688) (-389.267) -- 0:00:26
      556500 -- (-389.689) (-390.445) (-389.820) [-393.759] * (-389.982) [-390.224] (-390.309) (-389.891) -- 0:00:26
      557000 -- (-390.961) (-391.778) [-390.529] (-390.136) * (-391.639) [-393.816] (-394.952) (-389.445) -- 0:00:26
      557500 -- (-389.266) (-389.792) (-389.185) [-391.484] * (-392.707) [-391.432] (-393.543) (-395.388) -- 0:00:26
      558000 -- (-395.360) (-391.711) [-390.223] (-393.750) * (-392.137) (-390.722) (-390.331) [-394.629] -- 0:00:26
      558500 -- (-391.821) (-390.877) (-394.316) [-389.775] * [-390.788] (-392.507) (-390.895) (-391.607) -- 0:00:26
      559000 -- (-390.131) [-390.374] (-393.341) (-390.966) * [-391.202] (-389.945) (-392.844) (-400.902) -- 0:00:26
      559500 -- (-390.035) [-390.070] (-394.681) (-394.453) * (-390.562) [-393.799] (-390.661) (-390.422) -- 0:00:25
      560000 -- (-391.736) [-392.299] (-393.323) (-391.424) * (-390.703) [-391.831] (-391.562) (-391.590) -- 0:00:25

      Average standard deviation of split frequencies: 0.008408

      560500 -- (-390.742) (-393.256) [-390.409] (-391.517) * (-389.508) (-392.630) [-389.316] (-389.148) -- 0:00:25
      561000 -- (-390.863) [-396.400] (-389.964) (-390.627) * [-390.894] (-391.667) (-391.854) (-391.258) -- 0:00:25
      561500 -- (-391.662) (-397.513) (-391.168) [-390.740] * (-390.769) (-393.661) (-390.392) [-390.724] -- 0:00:25
      562000 -- (-394.789) (-390.899) (-389.525) [-389.565] * (-398.635) (-392.798) [-390.999] (-393.733) -- 0:00:25
      562500 -- (-392.600) [-390.286] (-391.262) (-395.500) * (-391.348) [-393.510] (-391.089) (-390.642) -- 0:00:25
      563000 -- (-390.859) [-393.413] (-391.611) (-389.881) * (-393.211) [-393.593] (-391.136) (-390.533) -- 0:00:25
      563500 -- (-390.163) [-390.573] (-391.297) (-389.500) * (-392.024) [-392.018] (-394.590) (-389.834) -- 0:00:25
      564000 -- (-391.771) (-389.311) [-389.311] (-389.211) * (-390.641) (-393.793) [-390.086] (-390.814) -- 0:00:25
      564500 -- (-391.989) (-390.025) (-390.054) [-389.801] * (-395.550) (-393.940) (-391.991) [-390.128] -- 0:00:25
      565000 -- (-393.476) (-394.619) [-391.159] (-389.546) * (-394.309) (-395.528) [-392.527] (-390.956) -- 0:00:26

      Average standard deviation of split frequencies: 0.008173

      565500 -- (-391.024) [-389.588] (-392.168) (-389.982) * (-390.810) (-390.397) [-389.790] (-391.255) -- 0:00:26
      566000 -- [-392.059] (-392.698) (-394.480) (-393.345) * (-392.644) [-390.143] (-390.532) (-390.400) -- 0:00:26
      566500 -- [-390.131] (-395.189) (-391.642) (-390.608) * (-391.264) [-391.120] (-390.916) (-389.455) -- 0:00:26
      567000 -- (-391.043) (-395.846) [-392.176] (-391.103) * (-391.099) (-389.911) [-389.640] (-391.677) -- 0:00:25
      567500 -- (-389.547) [-392.742] (-391.924) (-389.966) * (-391.359) [-389.401] (-391.712) (-391.913) -- 0:00:25
      568000 -- (-391.892) (-392.144) [-395.929] (-396.103) * (-391.199) (-391.861) [-390.544] (-394.897) -- 0:00:25
      568500 -- (-391.541) [-391.732] (-390.569) (-391.848) * [-389.066] (-390.917) (-389.693) (-389.795) -- 0:00:25
      569000 -- (-391.058) (-391.663) [-391.075] (-393.257) * (-389.334) (-393.869) [-391.890] (-390.743) -- 0:00:25
      569500 -- (-393.489) (-392.436) [-390.497] (-390.373) * [-389.262] (-390.233) (-390.765) (-390.025) -- 0:00:25
      570000 -- (-391.248) (-390.510) (-393.338) [-392.892] * (-389.480) [-392.598] (-389.785) (-390.481) -- 0:00:25

      Average standard deviation of split frequencies: 0.008106

      570500 -- (-389.344) (-395.547) (-394.301) [-390.878] * [-391.727] (-393.295) (-391.172) (-389.615) -- 0:00:25
      571000 -- (-391.696) [-394.066] (-391.946) (-393.763) * [-394.883] (-394.872) (-389.745) (-391.986) -- 0:00:25
      571500 -- (-390.388) (-393.126) [-391.154] (-392.554) * (-394.287) [-389.452] (-389.427) (-390.538) -- 0:00:25
      572000 -- [-389.399] (-392.741) (-395.894) (-393.532) * (-390.141) (-389.608) (-390.739) [-390.107] -- 0:00:25
      572500 -- (-390.870) (-389.237) (-389.914) [-392.063] * (-390.989) (-389.887) (-390.778) [-391.078] -- 0:00:25
      573000 -- (-395.973) (-390.600) (-391.448) [-390.436] * [-392.388] (-391.149) (-391.608) (-390.496) -- 0:00:25
      573500 -- (-393.044) [-391.486] (-391.180) (-393.270) * (-390.484) [-394.644] (-391.395) (-391.126) -- 0:00:25
      574000 -- [-395.314] (-390.108) (-390.165) (-390.186) * [-389.017] (-390.306) (-391.704) (-395.853) -- 0:00:25
      574500 -- (-402.408) (-389.870) [-393.631] (-392.255) * [-390.409] (-390.388) (-390.232) (-392.283) -- 0:00:25
      575000 -- (-402.103) (-390.639) (-391.437) [-391.155] * (-389.713) (-391.568) [-390.760] (-394.811) -- 0:00:25

      Average standard deviation of split frequencies: 0.007724

      575500 -- (-394.115) [-390.252] (-395.292) (-393.411) * [-389.671] (-392.047) (-390.645) (-390.277) -- 0:00:25
      576000 -- (-389.713) (-390.672) [-389.854] (-394.012) * (-391.597) (-390.555) [-390.861] (-390.128) -- 0:00:25
      576500 -- (-389.382) (-389.568) [-390.165] (-392.554) * [-392.186] (-390.906) (-392.902) (-390.613) -- 0:00:24
      577000 -- [-389.781] (-389.865) (-392.368) (-390.873) * [-390.910] (-397.793) (-390.545) (-389.375) -- 0:00:24
      577500 -- (-392.662) (-390.710) (-391.241) [-391.745] * (-394.416) (-392.326) [-390.709] (-390.209) -- 0:00:24
      578000 -- (-390.967) (-390.930) (-392.813) [-392.564] * (-394.895) (-390.588) (-393.192) [-389.075] -- 0:00:24
      578500 -- [-390.618] (-390.331) (-390.994) (-390.723) * [-393.733] (-392.606) (-391.945) (-389.933) -- 0:00:24
      579000 -- (-392.774) [-390.257] (-390.939) (-391.299) * (-392.860) (-390.582) (-393.069) [-391.637] -- 0:00:24
      579500 -- (-390.578) (-390.968) [-391.214] (-390.912) * (-393.289) (-390.717) (-389.351) [-390.511] -- 0:00:24
      580000 -- (-393.184) [-389.371] (-390.750) (-390.803) * [-392.189] (-390.112) (-390.051) (-394.168) -- 0:00:24

      Average standard deviation of split frequencies: 0.007560

      580500 -- (-393.406) (-389.204) [-390.765] (-391.495) * (-392.181) [-389.583] (-393.202) (-392.973) -- 0:00:24
      581000 -- (-392.449) [-392.276] (-392.667) (-392.828) * (-391.364) (-392.069) [-392.880] (-393.223) -- 0:00:24
      581500 -- [-392.471] (-392.106) (-390.782) (-391.172) * (-392.918) [-391.939] (-393.150) (-391.327) -- 0:00:24
      582000 -- (-392.268) (-392.886) [-390.082] (-389.546) * (-390.877) (-389.335) [-390.224] (-391.419) -- 0:00:25
      582500 -- (-391.286) [-389.626] (-391.228) (-392.097) * (-390.197) [-390.504] (-389.428) (-390.892) -- 0:00:25
      583000 -- (-389.332) (-391.041) [-393.095] (-395.380) * [-394.564] (-391.173) (-394.444) (-389.994) -- 0:00:25
      583500 -- (-391.306) (-391.667) (-391.367) [-391.161] * [-389.075] (-393.802) (-395.129) (-392.194) -- 0:00:24
      584000 -- [-389.681] (-390.378) (-393.864) (-392.336) * (-389.114) (-395.212) [-392.830] (-391.335) -- 0:00:24
      584500 -- (-392.207) (-389.231) [-393.749] (-390.860) * (-389.114) (-392.676) [-390.541] (-390.602) -- 0:00:24
      585000 -- [-390.541] (-389.899) (-390.822) (-392.053) * [-389.324] (-395.376) (-393.771) (-390.964) -- 0:00:24

      Average standard deviation of split frequencies: 0.007491

      585500 -- (-389.377) (-392.351) (-390.455) [-394.436] * [-393.884] (-389.612) (-391.094) (-390.534) -- 0:00:24
      586000 -- (-390.447) [-393.308] (-389.583) (-389.329) * (-395.099) (-390.920) [-390.315] (-390.219) -- 0:00:24
      586500 -- (-393.399) [-390.862] (-394.298) (-390.177) * (-391.931) (-389.790) [-390.572] (-390.684) -- 0:00:24
      587000 -- [-392.634] (-391.641) (-393.642) (-391.208) * (-392.139) (-391.685) (-390.374) [-389.602] -- 0:00:24
      587500 -- (-392.138) [-390.830] (-391.818) (-396.900) * (-389.614) (-392.645) (-392.122) [-389.700] -- 0:00:24
      588000 -- (-390.622) (-392.779) [-390.882] (-391.125) * (-389.343) [-395.533] (-390.551) (-392.284) -- 0:00:24
      588500 -- (-393.101) (-391.757) [-389.958] (-391.026) * (-390.310) (-393.723) (-390.938) [-389.509] -- 0:00:24
      589000 -- (-393.628) (-391.806) [-389.329] (-392.623) * (-391.473) [-392.876] (-390.767) (-394.819) -- 0:00:24
      589500 -- (-390.162) (-389.366) [-389.767] (-393.018) * (-392.043) (-390.134) [-391.000] (-392.396) -- 0:00:24
      590000 -- [-391.382] (-394.111) (-390.259) (-393.318) * (-390.948) [-391.054] (-390.570) (-390.321) -- 0:00:24

      Average standard deviation of split frequencies: 0.007033

      590500 -- [-390.759] (-391.101) (-390.336) (-392.538) * (-390.628) [-393.798] (-390.187) (-389.260) -- 0:00:24
      591000 -- (-392.490) (-394.436) [-392.920] (-395.448) * [-390.131] (-390.106) (-392.281) (-392.218) -- 0:00:24
      591500 -- (-391.498) (-391.790) [-391.560] (-391.267) * (-391.198) (-394.180) [-390.141] (-390.467) -- 0:00:24
      592000 -- [-391.604] (-390.635) (-391.892) (-393.254) * (-390.631) (-390.772) (-390.880) [-393.873] -- 0:00:24
      592500 -- [-389.814] (-391.009) (-391.447) (-394.569) * (-390.800) [-393.609] (-391.178) (-396.092) -- 0:00:24
      593000 -- [-390.070] (-390.091) (-391.176) (-394.316) * (-393.476) (-391.624) [-391.660] (-394.427) -- 0:00:24
      593500 -- (-390.959) (-391.194) [-392.842] (-391.676) * (-391.961) [-390.882] (-396.626) (-391.632) -- 0:00:23
      594000 -- (-389.868) [-392.629] (-390.075) (-389.584) * (-393.141) (-392.809) [-389.607] (-391.146) -- 0:00:23
      594500 -- (-390.965) (-389.782) (-391.776) [-390.180] * [-391.614] (-391.817) (-392.897) (-393.846) -- 0:00:23
      595000 -- [-392.536] (-392.287) (-392.592) (-391.549) * (-392.186) [-391.746] (-396.323) (-390.151) -- 0:00:23

      Average standard deviation of split frequencies: 0.007816

      595500 -- (-392.875) (-389.929) [-393.011] (-390.713) * (-392.753) (-393.394) [-392.515] (-394.332) -- 0:00:23
      596000 -- (-392.119) (-392.877) (-394.496) [-390.201] * (-393.995) (-394.260) (-391.926) [-392.769] -- 0:00:23
      596500 -- [-389.411] (-391.122) (-392.311) (-392.933) * [-390.283] (-393.024) (-389.855) (-392.565) -- 0:00:23
      597000 -- (-391.471) [-390.885] (-392.318) (-389.856) * (-390.947) [-389.766] (-391.699) (-393.014) -- 0:00:23
      597500 -- (-392.854) (-391.953) [-390.416] (-393.878) * (-392.777) (-390.563) (-395.783) [-391.200] -- 0:00:23
      598000 -- (-393.335) (-391.282) (-394.108) [-398.269] * (-394.117) (-395.283) (-394.000) [-389.709] -- 0:00:23
      598500 -- (-390.296) (-391.318) [-390.199] (-393.018) * [-391.614] (-392.363) (-395.039) (-392.688) -- 0:00:23
      599000 -- (-390.572) (-393.350) (-389.365) [-389.950] * (-390.119) (-391.260) (-392.376) [-389.146] -- 0:00:24
      599500 -- (-392.942) (-391.207) [-389.902] (-390.105) * (-390.838) [-393.160] (-391.046) (-390.910) -- 0:00:24
      600000 -- [-393.470] (-391.398) (-395.412) (-392.780) * (-392.648) (-391.606) (-390.905) [-392.542] -- 0:00:24

      Average standard deviation of split frequencies: 0.007701

      600500 -- (-398.825) (-390.937) [-391.070] (-391.523) * (-391.172) [-390.540] (-393.785) (-392.723) -- 0:00:23
      601000 -- (-393.843) (-390.923) (-391.284) [-392.652] * (-391.387) (-392.212) [-390.613] (-392.137) -- 0:00:23
      601500 -- (-389.902) [-389.485] (-391.184) (-396.343) * (-390.145) (-396.280) (-390.332) [-391.523] -- 0:00:23
      602000 -- (-389.461) (-392.078) [-390.275] (-389.331) * [-390.268] (-393.773) (-390.951) (-392.324) -- 0:00:23
      602500 -- (-390.692) (-392.322) [-389.670] (-393.742) * (-392.571) (-396.152) (-394.410) [-395.171] -- 0:00:23
      603000 -- [-392.524] (-392.987) (-390.267) (-390.800) * (-401.639) (-394.834) (-390.240) [-393.532] -- 0:00:23
      603500 -- (-391.419) (-392.393) [-389.502] (-396.247) * (-389.643) (-391.568) [-390.259] (-396.921) -- 0:00:23
      604000 -- (-392.341) [-391.099] (-393.267) (-390.364) * (-393.629) (-393.018) [-392.608] (-391.085) -- 0:00:23
      604500 -- (-390.415) (-391.589) [-389.351] (-389.951) * [-389.523] (-392.461) (-392.173) (-390.485) -- 0:00:23
      605000 -- (-391.947) (-389.992) [-389.678] (-390.280) * (-394.111) (-392.546) [-393.525] (-391.033) -- 0:00:23

      Average standard deviation of split frequencies: 0.007293

      605500 -- (-391.153) (-391.347) [-390.314] (-391.808) * [-389.714] (-395.325) (-394.327) (-392.004) -- 0:00:23
      606000 -- (-389.503) (-389.529) (-391.949) [-390.023] * (-388.961) (-390.640) (-393.513) [-390.860] -- 0:00:23
      606500 -- (-397.276) [-390.369] (-391.285) (-392.450) * (-390.106) (-397.490) (-390.915) [-391.524] -- 0:00:23
      607000 -- (-391.597) [-391.920] (-393.267) (-391.033) * [-391.709] (-395.773) (-389.666) (-389.466) -- 0:00:23
      607500 -- (-391.132) (-390.875) (-393.605) [-391.871] * (-390.915) (-395.348) [-390.562] (-390.879) -- 0:00:23
      608000 -- [-391.646] (-389.891) (-395.582) (-392.834) * [-390.712] (-391.262) (-390.000) (-392.485) -- 0:00:23
      608500 -- (-389.108) [-391.164] (-390.209) (-389.342) * (-390.186) (-393.312) (-391.999) [-389.491] -- 0:00:23
      609000 -- (-391.625) [-392.859] (-393.077) (-394.421) * (-390.983) (-391.449) [-390.517] (-389.330) -- 0:00:23
      609500 -- (-391.227) (-391.266) (-392.260) [-393.639] * (-393.722) [-389.524] (-389.393) (-396.203) -- 0:00:23
      610000 -- (-390.997) [-390.157] (-390.073) (-393.033) * (-392.409) (-389.711) (-390.287) [-392.292] -- 0:00:23

      Average standard deviation of split frequencies: 0.006899

      610500 -- (-389.513) (-389.446) (-392.101) [-391.987] * (-390.284) (-389.770) [-391.134] (-390.481) -- 0:00:22
      611000 -- [-389.759] (-393.078) (-393.323) (-389.889) * [-390.493] (-391.911) (-393.090) (-390.935) -- 0:00:22
      611500 -- (-389.777) (-391.107) [-391.719] (-390.268) * [-391.789] (-392.147) (-391.758) (-391.337) -- 0:00:22
      612000 -- (-389.546) (-389.940) (-390.424) [-389.201] * (-390.028) (-392.321) [-392.000] (-389.823) -- 0:00:22
      612500 -- (-389.877) (-389.328) [-391.403] (-390.389) * (-389.807) [-392.751] (-389.703) (-393.029) -- 0:00:22
      613000 -- (-393.783) [-391.919] (-389.645) (-390.053) * (-390.275) [-391.491] (-389.095) (-391.967) -- 0:00:22
      613500 -- (-393.776) (-390.024) [-389.947] (-389.628) * (-390.585) (-395.325) (-392.506) [-392.996] -- 0:00:22
      614000 -- (-391.385) (-390.791) [-391.501] (-392.703) * [-391.019] (-390.084) (-390.549) (-394.224) -- 0:00:22
      614500 -- (-390.422) (-392.408) [-392.331] (-392.401) * (-391.625) (-390.249) (-390.026) [-391.750] -- 0:00:22
      615000 -- (-392.121) [-393.279] (-390.967) (-390.650) * (-392.423) [-393.632] (-393.209) (-390.547) -- 0:00:22

      Average standard deviation of split frequencies: 0.006696

      615500 -- (-389.935) (-392.624) [-391.441] (-393.387) * (-395.729) (-391.145) [-391.191] (-394.776) -- 0:00:22
      616000 -- (-390.452) (-393.082) [-392.507] (-390.824) * (-392.694) (-391.304) [-392.206] (-394.145) -- 0:00:23
      616500 -- (-392.473) (-393.081) (-393.580) [-391.390] * (-395.998) (-390.906) [-389.898] (-390.848) -- 0:00:23
      617000 -- [-390.613] (-391.096) (-397.046) (-394.502) * (-390.859) (-390.410) [-390.295] (-391.523) -- 0:00:22
      617500 -- [-389.408] (-393.551) (-391.576) (-394.243) * (-390.388) (-390.371) (-389.655) [-391.737] -- 0:00:22
      618000 -- (-389.610) [-392.383] (-396.445) (-395.104) * (-391.510) (-389.798) (-389.687) [-394.605] -- 0:00:22
      618500 -- (-391.904) (-390.632) (-389.590) [-392.877] * (-389.822) (-390.885) [-393.486] (-390.745) -- 0:00:22
      619000 -- (-395.484) [-391.854] (-391.078) (-393.962) * [-391.454] (-391.264) (-391.720) (-390.172) -- 0:00:22
      619500 -- (-389.776) (-391.446) (-393.225) [-392.064] * [-391.340] (-391.410) (-391.733) (-390.995) -- 0:00:22
      620000 -- (-391.197) [-389.098] (-391.706) (-394.294) * (-391.385) (-390.178) (-392.587) [-391.136] -- 0:00:22

      Average standard deviation of split frequencies: 0.006029

      620500 -- (-394.354) (-390.997) [-389.689] (-390.277) * (-390.236) (-390.552) [-396.881] (-389.861) -- 0:00:22
      621000 -- [-399.169] (-397.273) (-391.676) (-390.922) * (-390.989) [-389.515] (-391.092) (-391.041) -- 0:00:22
      621500 -- (-395.620) (-390.905) [-391.916] (-393.222) * [-390.228] (-389.487) (-395.002) (-392.196) -- 0:00:22
      622000 -- (-394.804) [-390.784] (-393.456) (-389.323) * (-392.465) (-393.163) (-391.707) [-391.099] -- 0:00:22
      622500 -- (-391.659) [-391.867] (-393.711) (-390.153) * (-391.983) (-392.220) [-389.532] (-391.581) -- 0:00:22
      623000 -- (-389.980) [-391.955] (-394.512) (-390.866) * [-391.165] (-395.159) (-390.004) (-389.878) -- 0:00:22
      623500 -- (-392.969) (-398.146) (-389.558) [-390.429] * (-390.498) (-395.404) [-390.936] (-392.109) -- 0:00:22
      624000 -- (-391.749) (-396.549) [-391.055] (-393.727) * (-389.617) [-392.277] (-391.718) (-393.998) -- 0:00:22
      624500 -- (-389.809) (-391.784) [-393.273] (-392.156) * (-390.251) (-389.942) [-391.000] (-392.503) -- 0:00:22
      625000 -- (-390.217) [-394.407] (-390.855) (-392.261) * (-393.072) [-390.011] (-394.453) (-389.450) -- 0:00:22

      Average standard deviation of split frequencies: 0.006118

      625500 -- [-390.144] (-391.335) (-390.033) (-394.266) * (-389.450) [-389.417] (-394.914) (-389.450) -- 0:00:22
      626000 -- (-390.759) (-389.454) [-392.072] (-390.655) * (-390.179) (-390.233) [-389.674] (-389.206) -- 0:00:22
      626500 -- (-392.957) (-391.479) (-389.379) [-391.045] * (-390.691) (-390.231) (-390.362) [-392.117] -- 0:00:22
      627000 -- (-397.084) [-389.034] (-392.197) (-391.772) * (-390.526) (-390.173) [-390.400] (-390.046) -- 0:00:22
      627500 -- (-396.549) (-392.418) (-393.166) [-394.096] * (-393.389) (-390.232) (-391.192) [-390.636] -- 0:00:21
      628000 -- (-393.882) (-389.885) (-393.842) [-391.024] * (-392.228) (-389.876) (-391.220) [-391.489] -- 0:00:21
      628500 -- [-393.518] (-392.727) (-390.784) (-390.828) * (-392.768) (-392.315) [-389.775] (-389.338) -- 0:00:21
      629000 -- (-392.251) (-392.047) (-390.280) [-393.892] * (-390.444) (-390.763) (-392.959) [-390.236] -- 0:00:21
      629500 -- (-390.115) (-390.002) [-392.057] (-391.392) * (-390.378) [-393.084] (-390.336) (-390.913) -- 0:00:21
      630000 -- [-390.023] (-389.768) (-396.215) (-391.611) * (-389.595) (-391.295) [-391.079] (-392.973) -- 0:00:21

      Average standard deviation of split frequencies: 0.005466

      630500 -- (-391.943) (-392.746) [-391.304] (-392.636) * [-391.679] (-390.814) (-390.434) (-391.398) -- 0:00:21
      631000 -- (-389.784) (-393.235) (-389.518) [-391.285] * (-390.126) (-395.066) [-391.827] (-389.925) -- 0:00:21
      631500 -- [-391.697] (-390.933) (-393.961) (-391.037) * (-393.005) (-395.209) (-395.137) [-390.944] -- 0:00:21
      632000 -- (-393.321) [-389.739] (-391.241) (-393.187) * (-391.084) (-390.190) [-391.180] (-391.298) -- 0:00:22
      632500 -- [-391.145] (-392.636) (-389.863) (-394.640) * (-391.175) (-390.903) (-389.667) [-390.149] -- 0:00:22
      633000 -- [-391.393] (-396.330) (-390.748) (-393.509) * [-390.004] (-395.522) (-391.672) (-390.935) -- 0:00:22
      633500 -- [-389.138] (-398.517) (-389.990) (-392.094) * (-390.133) [-393.596] (-393.233) (-396.988) -- 0:00:21
      634000 -- (-391.645) (-390.336) [-389.363] (-390.719) * (-390.061) (-394.792) [-391.434] (-393.486) -- 0:00:21
      634500 -- [-391.832] (-391.287) (-390.246) (-390.538) * [-393.617] (-389.702) (-390.348) (-392.239) -- 0:00:21
      635000 -- (-393.060) [-391.158] (-394.286) (-390.379) * (-389.936) (-391.431) [-390.980] (-390.704) -- 0:00:21

      Average standard deviation of split frequencies: 0.005837

      635500 -- [-391.645] (-391.683) (-391.095) (-392.824) * (-390.152) [-393.114] (-390.956) (-391.749) -- 0:00:21
      636000 -- (-391.233) [-392.646] (-392.265) (-393.957) * (-395.245) (-391.667) [-392.015] (-389.955) -- 0:00:21
      636500 -- [-390.626] (-393.010) (-392.896) (-389.837) * (-396.928) (-389.285) [-390.028] (-390.250) -- 0:00:21
      637000 -- (-392.598) (-392.026) (-392.825) [-390.216] * (-396.168) (-394.590) (-390.732) [-394.722] -- 0:00:21
      637500 -- (-390.171) (-390.206) [-393.168] (-392.475) * (-391.144) (-389.398) (-390.361) [-390.609] -- 0:00:21
      638000 -- (-390.500) (-390.162) [-391.088] (-391.632) * [-389.652] (-390.768) (-393.839) (-391.146) -- 0:00:21
      638500 -- (-391.633) (-390.448) [-391.031] (-390.581) * (-390.180) [-394.598] (-392.657) (-392.091) -- 0:00:21
      639000 -- (-390.437) [-390.314] (-393.395) (-390.457) * (-391.502) (-390.387) (-389.416) [-390.539] -- 0:00:21
      639500 -- (-391.705) (-390.614) (-393.242) [-395.373] * [-390.605] (-391.054) (-391.212) (-390.978) -- 0:00:21
      640000 -- (-390.842) (-390.347) [-392.655] (-389.410) * [-392.419] (-390.388) (-392.598) (-393.832) -- 0:00:21

      Average standard deviation of split frequencies: 0.005641

      640500 -- [-390.101] (-389.933) (-390.756) (-390.280) * (-395.923) (-389.068) [-391.071] (-389.580) -- 0:00:21
      641000 -- (-392.954) (-388.973) (-393.092) [-391.953] * (-391.759) (-390.329) (-391.433) [-391.377] -- 0:00:21
      641500 -- (-390.698) (-389.000) (-394.584) [-391.530] * (-393.536) [-390.890] (-389.136) (-389.835) -- 0:00:21
      642000 -- (-389.544) (-391.362) (-395.648) [-393.165] * (-392.585) (-390.979) (-391.876) [-390.681] -- 0:00:21
      642500 -- [-392.500] (-393.114) (-393.732) (-389.445) * (-392.890) (-395.195) (-393.669) [-391.854] -- 0:00:21
      643000 -- [-390.288] (-399.313) (-396.438) (-392.937) * [-391.524] (-389.313) (-392.197) (-391.902) -- 0:00:21
      643500 -- (-389.523) (-391.587) (-391.109) [-389.665] * (-390.672) [-390.639] (-395.707) (-391.887) -- 0:00:21
      644000 -- (-389.666) (-391.364) [-389.478] (-392.039) * [-389.678] (-398.326) (-392.627) (-391.975) -- 0:00:21
      644500 -- (-395.021) (-390.196) [-391.072] (-390.935) * (-391.870) [-392.088] (-392.290) (-392.900) -- 0:00:20
      645000 -- [-389.219] (-390.009) (-390.259) (-394.109) * (-390.243) (-390.981) [-391.519] (-391.843) -- 0:00:20

      Average standard deviation of split frequencies: 0.006294

      645500 -- (-390.594) (-391.256) (-394.000) [-391.686] * (-390.501) (-390.674) (-396.385) [-394.035] -- 0:00:20
      646000 -- (-396.633) (-391.562) (-391.852) [-390.576] * (-390.974) (-391.505) [-393.037] (-391.806) -- 0:00:20
      646500 -- (-389.935) (-389.800) [-390.929] (-396.891) * (-393.537) (-389.689) (-395.693) [-391.439] -- 0:00:20
      647000 -- [-392.129] (-392.492) (-391.550) (-395.662) * (-391.854) (-389.942) (-391.152) [-390.090] -- 0:00:20
      647500 -- (-392.468) (-391.033) [-390.784] (-392.451) * (-389.725) (-396.429) (-395.817) [-392.301] -- 0:00:20
      648000 -- (-391.413) [-393.871] (-389.334) (-392.554) * (-390.995) [-392.970] (-394.476) (-392.309) -- 0:00:20
      648500 -- (-391.094) [-390.341] (-389.925) (-392.666) * (-391.458) [-389.924] (-390.565) (-392.367) -- 0:00:20
      649000 -- (-390.545) (-390.242) (-392.751) [-392.094] * (-394.919) (-391.098) [-391.337] (-398.231) -- 0:00:21
      649500 -- (-392.113) (-390.975) [-391.237] (-393.040) * (-389.469) (-390.654) (-393.092) [-390.405] -- 0:00:21
      650000 -- (-391.255) (-391.779) [-392.548] (-397.125) * [-390.433] (-391.568) (-391.865) (-393.118) -- 0:00:21

      Average standard deviation of split frequencies: 0.006656

      650500 -- (-391.087) [-395.609] (-390.262) (-392.461) * (-390.219) (-391.238) (-390.928) [-390.167] -- 0:00:20
      651000 -- (-390.621) [-394.957] (-390.587) (-393.186) * (-395.921) (-391.352) [-390.408] (-391.279) -- 0:00:20
      651500 -- (-389.872) (-391.936) (-391.768) [-389.959] * (-390.450) (-391.587) (-391.992) [-391.095] -- 0:00:20
      652000 -- [-391.925] (-390.648) (-389.856) (-390.176) * (-390.573) [-392.084] (-392.051) (-389.492) -- 0:00:20
      652500 -- (-394.022) (-395.387) [-389.538] (-390.680) * [-390.331] (-392.224) (-393.372) (-392.945) -- 0:00:20
      653000 -- (-393.560) [-391.550] (-391.273) (-391.789) * (-391.064) (-391.896) (-394.604) [-389.621] -- 0:00:20
      653500 -- [-390.719] (-390.282) (-390.449) (-389.293) * (-392.001) (-395.391) (-393.060) [-390.097] -- 0:00:20
      654000 -- (-392.545) (-391.814) (-396.253) [-392.268] * [-389.565] (-397.047) (-391.893) (-392.607) -- 0:00:20
      654500 -- (-395.318) (-392.531) [-394.007] (-390.995) * [-391.435] (-390.077) (-389.944) (-394.013) -- 0:00:20
      655000 -- (-392.351) (-390.540) [-392.749] (-391.201) * (-395.761) (-393.410) (-389.519) [-393.611] -- 0:00:20

      Average standard deviation of split frequencies: 0.006198

      655500 -- [-392.217] (-390.830) (-393.385) (-391.166) * [-389.360] (-394.411) (-391.836) (-390.515) -- 0:00:20
      656000 -- (-389.897) [-392.530] (-390.904) (-390.775) * [-389.503] (-390.654) (-391.213) (-391.876) -- 0:00:20
      656500 -- (-391.803) [-394.060] (-391.183) (-394.201) * (-395.643) [-392.514] (-395.102) (-390.938) -- 0:00:20
      657000 -- (-393.570) (-395.295) [-394.659] (-394.683) * [-390.848] (-395.342) (-390.457) (-390.984) -- 0:00:20
      657500 -- [-392.454] (-392.004) (-391.291) (-390.779) * (-393.463) [-392.182] (-392.892) (-392.501) -- 0:00:20
      658000 -- [-393.641] (-401.492) (-392.226) (-391.017) * (-391.171) [-396.239] (-390.922) (-392.375) -- 0:00:20
      658500 -- (-391.724) (-396.248) [-390.978] (-392.174) * (-391.208) (-390.698) (-393.070) [-390.278] -- 0:00:20
      659000 -- (-391.996) [-391.654] (-393.057) (-395.592) * [-390.104] (-395.161) (-390.102) (-391.640) -- 0:00:20
      659500 -- (-390.576) [-391.495] (-394.288) (-390.948) * (-391.565) [-389.959] (-392.398) (-398.424) -- 0:00:20
      660000 -- (-394.056) (-393.454) [-393.779] (-389.485) * [-392.965] (-392.962) (-391.000) (-395.358) -- 0:00:20

      Average standard deviation of split frequencies: 0.005566

      660500 -- (-391.360) (-391.471) [-390.200] (-392.140) * (-393.699) [-395.668] (-392.893) (-390.126) -- 0:00:20
      661000 -- (-391.692) (-391.726) (-392.375) [-391.099] * (-392.610) [-389.999] (-393.255) (-392.602) -- 0:00:20
      661500 -- (-391.718) (-391.579) [-392.840] (-389.423) * (-394.780) [-389.947] (-391.910) (-392.160) -- 0:00:19
      662000 -- (-394.955) [-390.484] (-391.483) (-395.367) * (-394.899) (-392.858) (-389.037) [-391.817] -- 0:00:19
      662500 -- [-392.083] (-393.659) (-391.822) (-390.394) * (-393.511) [-393.569] (-390.633) (-391.629) -- 0:00:19
      663000 -- (-392.322) (-389.706) (-391.777) [-390.142] * [-392.023] (-389.412) (-392.609) (-391.848) -- 0:00:19
      663500 -- (-395.380) [-391.367] (-392.527) (-389.679) * (-389.788) (-389.391) [-389.328] (-391.374) -- 0:00:19
      664000 -- (-391.693) (-391.034) (-391.434) [-391.058] * (-389.444) (-390.360) [-390.095] (-390.218) -- 0:00:19
      664500 -- (-390.751) (-394.673) [-390.194] (-391.305) * (-389.780) (-392.999) (-390.181) [-391.098] -- 0:00:19
      665000 -- (-391.890) [-390.805] (-391.865) (-392.778) * (-390.306) [-392.939] (-394.989) (-390.616) -- 0:00:19

      Average standard deviation of split frequencies: 0.005238

      665500 -- (-396.129) [-389.344] (-392.533) (-390.686) * (-389.300) (-393.824) [-392.688] (-392.775) -- 0:00:19
      666000 -- (-392.507) [-389.749] (-389.911) (-391.387) * (-390.211) [-390.862] (-394.426) (-391.537) -- 0:00:20
      666500 -- (-391.973) (-391.666) (-390.358) [-394.376] * (-392.645) [-390.410] (-391.568) (-391.363) -- 0:00:20
      667000 -- [-389.870] (-392.840) (-393.410) (-390.636) * (-391.217) [-390.282] (-390.894) (-392.139) -- 0:00:19
      667500 -- (-391.190) (-389.927) [-392.521] (-393.271) * [-391.780] (-392.087) (-393.113) (-391.566) -- 0:00:19
      668000 -- (-389.613) (-390.303) [-391.911] (-394.487) * (-393.554) [-392.594] (-393.453) (-391.909) -- 0:00:19
      668500 -- (-390.995) [-395.196] (-390.928) (-392.582) * (-391.425) (-399.249) (-392.650) [-390.540] -- 0:00:19
      669000 -- [-391.567] (-393.795) (-391.505) (-392.206) * (-389.591) [-393.776] (-391.333) (-390.103) -- 0:00:19
      669500 -- (-393.298) (-390.249) (-392.693) [-392.023] * [-389.992] (-390.403) (-389.786) (-390.193) -- 0:00:19
      670000 -- (-391.441) (-391.600) [-390.231] (-391.398) * (-392.163) (-390.677) [-390.557] (-392.718) -- 0:00:19

      Average standard deviation of split frequencies: 0.005342

      670500 -- (-389.963) (-391.578) (-393.468) [-391.537] * (-393.141) (-390.635) (-390.516) [-391.016] -- 0:00:19
      671000 -- (-391.683) [-391.341] (-394.347) (-389.786) * (-391.256) (-391.629) (-391.820) [-391.578] -- 0:00:19
      671500 -- (-390.110) (-390.485) (-390.977) [-391.574] * (-392.614) (-392.027) [-392.334] (-390.742) -- 0:00:19
      672000 -- (-393.730) (-390.862) [-392.286] (-392.425) * [-391.118] (-390.553) (-391.989) (-392.574) -- 0:00:19
      672500 -- (-390.985) (-392.622) (-390.396) [-394.042] * [-389.849] (-392.788) (-392.296) (-391.228) -- 0:00:19
      673000 -- [-390.468] (-390.742) (-393.202) (-391.281) * [-391.572] (-391.536) (-392.525) (-393.850) -- 0:00:19
      673500 -- (-394.145) (-391.004) [-392.126] (-396.306) * (-390.136) (-390.856) [-390.078] (-389.915) -- 0:00:19
      674000 -- (-390.874) (-393.550) [-389.943] (-393.093) * (-389.516) (-390.912) (-390.673) [-391.757] -- 0:00:19
      674500 -- [-392.812] (-398.188) (-390.704) (-390.719) * [-389.294] (-392.637) (-391.765) (-393.019) -- 0:00:19
      675000 -- (-395.143) (-390.336) (-390.688) [-392.317] * (-389.600) [-389.782] (-390.728) (-390.241) -- 0:00:19

      Average standard deviation of split frequencies: 0.005753

      675500 -- (-390.647) [-390.627] (-390.194) (-392.001) * (-390.742) [-392.309] (-390.879) (-390.853) -- 0:00:19
      676000 -- (-391.545) (-391.198) (-393.067) [-389.842] * [-390.691] (-392.410) (-389.330) (-391.673) -- 0:00:19
      676500 -- [-390.899] (-392.445) (-392.238) (-391.059) * (-391.490) (-389.901) (-389.892) [-390.477] -- 0:00:19
      677000 -- [-392.148] (-389.564) (-389.905) (-391.896) * (-391.690) (-390.815) (-391.464) [-389.802] -- 0:00:19
      677500 -- (-393.949) (-391.222) [-390.990] (-390.131) * (-391.302) (-389.752) [-394.579] (-389.735) -- 0:00:19
      678000 -- (-390.721) (-390.229) (-389.339) [-389.828] * (-391.711) [-389.742] (-390.954) (-390.330) -- 0:00:18
      678500 -- (-393.011) (-393.662) [-389.743] (-392.320) * (-394.938) (-390.260) (-393.976) [-391.321] -- 0:00:18
      679000 -- [-391.955] (-392.254) (-389.583) (-391.290) * (-389.857) [-389.755] (-395.085) (-391.677) -- 0:00:18
      679500 -- (-390.888) (-389.357) (-390.733) [-391.115] * (-389.501) [-389.650] (-390.444) (-389.565) -- 0:00:18
      680000 -- (-392.258) (-394.246) (-390.952) [-392.831] * (-389.557) [-393.544] (-390.860) (-390.998) -- 0:00:18

      Average standard deviation of split frequencies: 0.005310

      680500 -- (-389.814) [-391.665] (-389.900) (-390.070) * (-391.483) [-395.299] (-389.549) (-391.879) -- 0:00:18
      681000 -- [-389.406] (-390.764) (-389.277) (-390.743) * (-390.569) (-392.283) (-391.112) [-391.070] -- 0:00:18
      681500 -- (-391.693) (-389.242) [-392.297] (-390.243) * (-391.952) [-390.209] (-391.160) (-391.305) -- 0:00:18
      682000 -- [-390.358] (-390.222) (-390.040) (-390.294) * (-390.851) (-389.425) (-395.831) [-391.092] -- 0:00:18
      682500 -- (-390.094) [-391.856] (-389.910) (-393.465) * (-397.072) [-390.901] (-392.115) (-389.369) -- 0:00:18
      683000 -- [-390.524] (-392.836) (-389.367) (-399.950) * (-392.033) (-389.862) (-392.814) [-390.581] -- 0:00:19
      683500 -- [-391.226] (-391.086) (-389.953) (-392.385) * [-391.816] (-390.553) (-392.790) (-393.813) -- 0:00:18
      684000 -- (-391.905) (-394.001) (-389.247) [-391.105] * (-389.708) [-390.655] (-391.286) (-391.515) -- 0:00:18
      684500 -- (-390.656) (-390.336) [-390.515] (-390.764) * (-389.725) (-390.565) (-389.718) [-391.515] -- 0:00:18
      685000 -- (-395.155) (-390.423) (-392.721) [-392.181] * (-393.240) (-389.904) (-394.434) [-393.748] -- 0:00:18

      Average standard deviation of split frequencies: 0.005268

      685500 -- (-395.657) [-391.836] (-393.237) (-397.309) * (-390.511) [-389.350] (-391.601) (-390.851) -- 0:00:18
      686000 -- (-395.357) [-392.251] (-393.077) (-390.199) * [-392.817] (-392.480) (-390.283) (-390.045) -- 0:00:18
      686500 -- (-390.178) (-389.733) (-391.932) [-391.641] * (-389.863) (-393.699) (-391.121) [-395.435] -- 0:00:18
      687000 -- (-392.927) [-391.263] (-394.058) (-390.063) * (-391.235) [-391.776] (-389.807) (-393.994) -- 0:00:18
      687500 -- [-390.516] (-393.276) (-390.792) (-390.428) * (-391.797) (-394.328) [-390.610] (-393.243) -- 0:00:18
      688000 -- (-393.217) (-391.195) [-391.063] (-390.589) * [-392.133] (-396.954) (-394.173) (-390.173) -- 0:00:18
      688500 -- [-392.540] (-392.125) (-392.991) (-392.378) * [-390.764] (-394.517) (-390.297) (-390.591) -- 0:00:18
      689000 -- [-392.639] (-390.987) (-394.043) (-394.574) * [-391.547] (-391.684) (-389.748) (-389.787) -- 0:00:18
      689500 -- (-390.993) (-390.640) [-392.088] (-390.472) * (-391.916) (-389.592) (-391.610) [-389.060] -- 0:00:18
      690000 -- (-391.209) [-392.097] (-390.961) (-391.987) * (-391.599) (-390.866) [-390.901] (-389.824) -- 0:00:18

      Average standard deviation of split frequencies: 0.005187

      690500 -- (-392.465) (-390.045) [-390.780] (-391.891) * [-389.739] (-392.000) (-389.777) (-391.802) -- 0:00:18
      691000 -- (-390.204) [-393.130] (-395.547) (-389.696) * (-393.428) [-390.523] (-390.669) (-397.167) -- 0:00:18
      691500 -- (-390.017) (-393.717) (-393.181) [-390.572] * (-392.020) [-390.295] (-395.830) (-389.590) -- 0:00:18
      692000 -- (-393.399) (-393.450) (-391.339) [-394.599] * [-390.444] (-389.458) (-390.815) (-391.206) -- 0:00:18
      692500 -- [-393.143] (-390.348) (-390.411) (-392.040) * (-390.996) [-390.831] (-394.101) (-393.952) -- 0:00:18
      693000 -- [-394.374] (-390.064) (-392.897) (-392.960) * (-390.201) (-393.072) (-391.937) [-389.983] -- 0:00:18
      693500 -- [-389.670] (-392.331) (-392.876) (-390.653) * [-391.946] (-392.525) (-391.095) (-391.658) -- 0:00:18
      694000 -- (-390.984) [-390.654] (-392.957) (-391.128) * (-394.083) [-391.246] (-390.295) (-393.185) -- 0:00:18
      694500 -- (-389.238) (-390.614) [-394.730] (-391.310) * (-393.511) [-390.908] (-389.009) (-391.570) -- 0:00:18
      695000 -- [-393.316] (-391.283) (-392.219) (-393.597) * (-391.832) (-393.376) [-390.559] (-391.545) -- 0:00:17

      Average standard deviation of split frequencies: 0.005238

      695500 -- (-392.137) (-390.141) (-392.511) [-393.613] * (-394.890) [-389.382] (-391.114) (-393.168) -- 0:00:17
      696000 -- [-397.056] (-391.317) (-395.921) (-393.070) * (-392.251) (-398.008) [-389.458] (-390.611) -- 0:00:17
      696500 -- (-391.392) (-393.352) (-394.820) [-390.372] * (-395.193) (-397.934) (-390.015) [-390.315] -- 0:00:17
      697000 -- (-393.376) (-391.671) [-391.027] (-392.623) * (-392.606) (-392.966) [-391.290] (-390.119) -- 0:00:17
      697500 -- (-390.075) (-394.727) [-392.565] (-392.528) * [-393.212] (-393.592) (-389.706) (-390.768) -- 0:00:17
      698000 -- (-394.803) (-393.831) [-390.504] (-390.241) * [-392.204] (-394.165) (-390.705) (-391.491) -- 0:00:17
      698500 -- (-391.056) [-393.083] (-390.952) (-391.536) * (-390.546) (-391.701) [-393.131] (-391.585) -- 0:00:17
      699000 -- (-392.794) (-389.962) [-391.157] (-389.035) * (-389.673) (-390.854) (-394.171) [-391.886] -- 0:00:17
      699500 -- (-399.179) [-391.777] (-390.946) (-390.617) * [-391.279] (-396.880) (-389.665) (-392.908) -- 0:00:17
      700000 -- (-392.908) [-390.554] (-390.852) (-390.448) * (-391.878) (-395.965) [-389.974] (-399.888) -- 0:00:17

      Average standard deviation of split frequencies: 0.004979

      700500 -- (-391.835) (-391.192) (-394.036) [-390.154] * (-392.537) [-390.671] (-390.691) (-396.671) -- 0:00:17
      701000 -- (-395.006) [-390.171] (-392.768) (-393.405) * (-394.057) (-390.314) (-390.333) [-392.521] -- 0:00:17
      701500 -- [-392.674] (-390.977) (-390.208) (-396.266) * (-391.390) [-391.192] (-390.270) (-391.323) -- 0:00:17
      702000 -- (-394.228) (-393.499) [-391.453] (-395.940) * (-389.484) (-390.914) [-391.902] (-391.711) -- 0:00:17
      702500 -- (-392.014) [-389.613] (-392.391) (-393.630) * (-390.663) [-391.285] (-395.299) (-390.440) -- 0:00:17
      703000 -- [-390.301] (-390.076) (-389.563) (-389.257) * (-390.999) (-393.334) (-393.799) [-390.277] -- 0:00:17
      703500 -- (-393.078) (-394.581) (-391.540) [-392.026] * (-389.946) (-391.595) [-391.466] (-390.690) -- 0:00:17
      704000 -- [-393.171] (-396.637) (-391.062) (-391.921) * (-395.148) (-390.441) (-389.591) [-389.764] -- 0:00:17
      704500 -- [-392.690] (-394.969) (-391.088) (-390.535) * (-392.114) (-392.830) (-392.248) [-390.197] -- 0:00:17
      705000 -- (-395.015) [-390.451] (-391.228) (-392.518) * (-391.185) (-390.472) [-390.704] (-390.448) -- 0:00:17

      Average standard deviation of split frequencies: 0.004763

      705500 -- [-392.054] (-392.210) (-393.367) (-391.460) * (-390.318) (-389.473) (-391.837) [-393.522] -- 0:00:17
      706000 -- (-391.208) (-390.860) [-394.769] (-391.112) * [-391.013] (-394.117) (-389.157) (-391.633) -- 0:00:17
      706500 -- (-391.625) (-390.412) [-392.668] (-389.644) * (-391.283) [-393.080] (-389.250) (-393.627) -- 0:00:17
      707000 -- [-389.130] (-396.560) (-394.624) (-391.692) * (-392.523) (-390.515) [-389.861] (-394.896) -- 0:00:17
      707500 -- (-391.869) (-396.224) (-392.090) [-390.695] * (-392.516) (-390.218) [-390.825] (-393.251) -- 0:00:17
      708000 -- (-393.261) (-392.748) (-390.718) [-392.391] * (-392.316) [-391.335] (-392.485) (-393.440) -- 0:00:17
      708500 -- (-391.225) (-393.157) (-391.377) [-390.297] * (-389.870) [-392.217] (-391.732) (-395.079) -- 0:00:17
      709000 -- (-393.845) (-389.866) [-391.810] (-399.657) * (-393.241) (-391.801) [-390.755] (-389.302) -- 0:00:17
      709500 -- (-393.147) (-390.157) (-392.177) [-390.790] * [-391.886] (-392.289) (-390.445) (-392.653) -- 0:00:17
      710000 -- (-389.475) (-393.549) [-394.513] (-390.713) * (-390.516) (-390.877) (-392.140) [-392.717] -- 0:00:17

      Average standard deviation of split frequencies: 0.004732

      710500 -- (-393.073) (-394.468) [-392.761] (-390.245) * (-394.440) (-390.087) [-393.370] (-391.076) -- 0:00:17
      711000 -- (-395.900) (-391.126) [-391.380] (-389.940) * [-391.091] (-390.095) (-392.219) (-391.816) -- 0:00:17
      711500 -- (-394.059) [-389.510] (-390.970) (-390.472) * [-392.246] (-389.603) (-393.286) (-391.444) -- 0:00:17
      712000 -- (-391.384) [-391.221] (-390.759) (-394.718) * (-391.214) (-390.633) [-390.256] (-390.706) -- 0:00:16
      712500 -- (-390.052) (-389.572) (-390.452) [-391.682] * (-392.719) [-391.857] (-390.855) (-390.109) -- 0:00:16
      713000 -- [-390.329] (-391.087) (-390.010) (-391.055) * (-390.971) (-391.806) [-389.651] (-393.735) -- 0:00:16
      713500 -- (-389.373) (-391.225) [-392.645] (-390.879) * (-391.595) (-393.230) (-392.099) [-396.389] -- 0:00:16
      714000 -- (-392.130) (-390.671) (-390.415) [-390.732] * (-389.249) (-391.059) [-393.896] (-394.574) -- 0:00:16
      714500 -- [-399.529] (-392.615) (-391.316) (-392.680) * [-390.510] (-393.664) (-391.000) (-390.939) -- 0:00:16
      715000 -- [-392.617] (-392.103) (-391.389) (-394.923) * (-390.932) (-393.724) (-390.898) [-392.877] -- 0:00:16

      Average standard deviation of split frequencies: 0.004828

      715500 -- [-390.278] (-393.501) (-394.707) (-394.933) * (-392.945) [-390.323] (-389.532) (-390.265) -- 0:00:16
      716000 -- (-389.824) (-391.710) (-390.815) [-392.569] * (-390.484) (-390.695) [-393.909] (-390.683) -- 0:00:16
      716500 -- (-389.334) (-391.082) [-390.364] (-391.023) * (-390.586) [-392.792] (-389.282) (-391.765) -- 0:00:16
      717000 -- (-389.950) (-393.338) (-390.819) [-394.570] * (-390.027) [-391.002] (-396.525) (-391.937) -- 0:00:16
      717500 -- (-393.460) [-392.776] (-390.293) (-391.004) * [-392.043] (-392.724) (-395.997) (-391.937) -- 0:00:16
      718000 -- (-391.457) (-393.860) (-389.651) [-391.099] * [-392.356] (-390.447) (-390.166) (-389.823) -- 0:00:16
      718500 -- (-391.028) [-391.296] (-390.668) (-394.179) * (-390.490) (-390.797) (-390.786) [-389.980] -- 0:00:16
      719000 -- (-390.969) [-391.939] (-394.313) (-390.299) * [-390.940] (-390.888) (-389.688) (-393.480) -- 0:00:16
      719500 -- (-393.620) (-390.442) [-392.456] (-389.871) * (-391.546) [-390.447] (-395.780) (-392.073) -- 0:00:16
      720000 -- (-393.312) (-390.995) (-393.598) [-390.494] * [-394.266] (-395.013) (-391.803) (-392.943) -- 0:00:16

      Average standard deviation of split frequencies: 0.004535

      720500 -- (-391.428) [-389.588] (-395.168) (-389.635) * (-390.140) [-395.790] (-391.770) (-391.956) -- 0:00:16
      721000 -- (-394.049) [-390.269] (-396.469) (-389.739) * (-390.633) (-396.725) (-390.120) [-392.442] -- 0:00:16
      721500 -- (-390.486) [-393.705] (-392.487) (-393.369) * (-391.881) (-390.537) (-391.253) [-392.559] -- 0:00:16
      722000 -- [-389.136] (-395.570) (-394.535) (-394.629) * [-389.576] (-391.402) (-395.266) (-391.808) -- 0:00:16
      722500 -- [-389.684] (-391.704) (-390.213) (-391.673) * (-391.954) (-389.732) [-392.267] (-393.891) -- 0:00:16
      723000 -- (-390.424) (-391.321) (-390.420) [-390.909] * (-389.596) (-391.189) (-391.138) [-391.882] -- 0:00:16
      723500 -- (-390.139) (-390.055) (-396.130) [-389.645] * (-389.819) (-389.407) (-389.977) [-390.717] -- 0:00:16
      724000 -- [-393.961] (-394.830) (-392.530) (-392.580) * [-391.657] (-390.167) (-389.992) (-392.302) -- 0:00:16
      724500 -- (-390.192) (-390.493) [-393.331] (-390.805) * (-392.041) (-390.244) [-389.976] (-390.784) -- 0:00:16
      725000 -- (-390.818) (-392.643) [-392.961] (-392.767) * (-391.126) [-390.126] (-389.302) (-406.668) -- 0:00:16

      Average standard deviation of split frequencies: 0.005021

      725500 -- [-391.938] (-390.869) (-394.023) (-391.930) * (-397.075) (-391.406) [-392.149] (-391.641) -- 0:00:16
      726000 -- [-396.725] (-391.599) (-392.940) (-392.186) * (-390.428) [-390.448] (-394.397) (-394.278) -- 0:00:16
      726500 -- [-390.791] (-395.676) (-391.073) (-393.500) * (-389.711) [-389.346] (-395.230) (-392.259) -- 0:00:16
      727000 -- [-389.377] (-395.029) (-391.553) (-394.044) * (-390.503) (-390.640) (-391.352) [-394.811] -- 0:00:16
      727500 -- [-394.305] (-392.436) (-391.472) (-392.563) * (-390.303) (-398.168) (-389.806) [-389.181] -- 0:00:16
      728000 -- (-394.259) [-391.034] (-391.514) (-392.255) * (-390.870) [-389.896] (-389.663) (-389.940) -- 0:00:16
      728500 -- (-394.937) (-390.448) (-390.952) [-392.516] * (-390.746) (-390.448) [-391.544] (-391.033) -- 0:00:16
      729000 -- [-390.372] (-390.891) (-392.137) (-390.524) * (-391.231) (-389.815) (-391.482) [-390.107] -- 0:00:15
      729500 -- (-394.714) (-395.029) (-391.720) [-389.625] * [-391.197] (-389.663) (-394.761) (-390.633) -- 0:00:15
      730000 -- (-391.889) (-390.194) [-390.603] (-392.913) * (-390.589) (-391.377) [-389.342] (-391.135) -- 0:00:15

      Average standard deviation of split frequencies: 0.005161

      730500 -- (-391.341) [-390.455] (-391.337) (-390.716) * (-390.059) [-397.300] (-391.272) (-392.936) -- 0:00:15
      731000 -- (-390.895) (-393.186) (-390.732) [-392.773] * (-389.580) (-392.390) (-393.542) [-395.300] -- 0:00:15
      731500 -- (-392.007) (-391.756) [-389.207] (-391.828) * (-390.138) (-390.702) (-394.377) [-390.183] -- 0:00:15
      732000 -- (-391.482) (-391.120) [-390.300] (-389.998) * (-397.257) [-393.556] (-391.582) (-391.044) -- 0:00:15
      732500 -- (-390.140) (-389.850) [-390.224] (-392.362) * [-389.650] (-390.927) (-391.860) (-390.782) -- 0:00:15
      733000 -- (-390.722) (-390.436) (-394.133) [-389.707] * (-389.855) (-391.779) (-390.131) [-391.351] -- 0:00:15
      733500 -- (-390.059) (-391.450) (-392.873) [-389.744] * (-390.649) (-390.888) (-390.186) [-394.896] -- 0:00:15
      734000 -- [-391.851] (-390.715) (-391.955) (-390.873) * (-389.526) [-396.574] (-393.179) (-392.434) -- 0:00:15
      734500 -- (-391.093) (-391.345) (-392.532) [-394.537] * (-395.276) [-390.475] (-390.312) (-391.893) -- 0:00:15
      735000 -- (-393.140) [-391.924] (-394.999) (-393.418) * (-392.533) [-389.969] (-391.883) (-392.459) -- 0:00:15

      Average standard deviation of split frequencies: 0.005807

      735500 -- (-391.772) (-394.395) [-390.139] (-390.189) * [-391.963] (-391.062) (-392.709) (-394.229) -- 0:00:15
      736000 -- (-390.585) (-389.849) [-390.846] (-392.582) * [-391.569] (-392.128) (-391.178) (-396.844) -- 0:00:15
      736500 -- (-392.550) (-392.695) [-392.330] (-390.153) * [-391.710] (-390.373) (-390.604) (-393.112) -- 0:00:15
      737000 -- (-394.311) [-391.701] (-393.864) (-392.029) * (-390.325) (-391.597) (-389.820) [-391.751] -- 0:00:15
      737500 -- (-390.750) [-391.092] (-392.017) (-392.671) * (-394.737) (-391.159) (-390.186) [-389.825] -- 0:00:15
      738000 -- (-390.590) (-396.816) (-390.313) [-389.441] * (-389.501) [-390.047] (-390.838) (-390.689) -- 0:00:15
      738500 -- (-393.054) [-389.726] (-389.308) (-390.602) * [-390.026] (-389.448) (-390.277) (-391.707) -- 0:00:15
      739000 -- (-390.709) (-391.966) [-389.754] (-391.377) * (-390.499) [-390.467] (-390.274) (-389.288) -- 0:00:15
      739500 -- (-391.406) (-391.457) [-390.968] (-393.968) * [-390.707] (-390.731) (-390.560) (-395.599) -- 0:00:15
      740000 -- (-391.755) (-390.893) [-390.836] (-390.519) * (-391.983) (-392.881) [-390.276] (-394.442) -- 0:00:15

      Average standard deviation of split frequencies: 0.005601

      740500 -- (-393.365) (-389.646) (-392.456) [-391.466] * [-389.734] (-394.178) (-392.169) (-390.714) -- 0:00:15
      741000 -- (-390.591) [-390.159] (-389.525) (-391.945) * (-390.962) (-391.616) (-391.794) [-390.190] -- 0:00:15
      741500 -- (-390.732) (-389.380) [-390.605] (-396.140) * [-393.027] (-389.260) (-392.312) (-389.728) -- 0:00:15
      742000 -- (-393.587) [-390.157] (-390.563) (-397.040) * [-389.343] (-389.856) (-395.205) (-393.962) -- 0:00:15
      742500 -- (-392.709) (-391.593) (-392.991) [-406.480] * (-391.346) (-391.824) [-391.085] (-392.875) -- 0:00:15
      743000 -- [-390.446] (-391.411) (-390.659) (-394.115) * (-389.722) (-390.824) (-391.604) [-392.342] -- 0:00:15
      743500 -- (-392.318) [-393.199] (-391.889) (-390.977) * [-391.711] (-390.597) (-391.508) (-391.754) -- 0:00:15
      744000 -- (-395.590) (-390.885) [-392.390] (-393.688) * (-389.708) (-392.289) [-390.970] (-390.549) -- 0:00:15
      744500 -- (-392.951) (-393.008) [-391.543] (-390.121) * [-391.416] (-392.711) (-391.764) (-390.020) -- 0:00:15
      745000 -- [-392.023] (-391.692) (-392.308) (-391.584) * (-389.292) (-395.284) [-389.950] (-391.584) -- 0:00:15

      Average standard deviation of split frequencies: 0.006082

      745500 -- (-395.892) (-391.306) (-391.800) [-391.797] * (-390.665) [-391.862] (-393.172) (-390.527) -- 0:00:15
      746000 -- (-393.787) (-391.837) [-391.567] (-392.884) * (-395.080) (-391.822) (-392.096) [-390.786] -- 0:00:14
      746500 -- (-392.659) (-392.798) (-392.043) [-392.912] * (-392.803) (-390.240) (-389.606) [-393.076] -- 0:00:14
      747000 -- (-390.082) (-391.520) [-389.545] (-394.144) * [-391.121] (-392.680) (-389.249) (-391.515) -- 0:00:14
      747500 -- (-392.170) (-390.002) [-390.947] (-394.711) * (-394.595) (-390.071) (-391.046) [-389.306] -- 0:00:14
      748000 -- [-391.120] (-391.156) (-389.585) (-390.998) * (-392.101) (-397.203) (-390.902) [-392.491] -- 0:00:14
      748500 -- (-392.613) (-391.371) (-390.912) [-390.642] * (-394.291) (-390.682) (-392.452) [-389.737] -- 0:00:14
      749000 -- [-391.266] (-389.615) (-390.427) (-389.708) * [-391.034] (-390.048) (-393.319) (-389.950) -- 0:00:14
      749500 -- [-392.783] (-394.505) (-389.857) (-391.060) * (-391.010) [-391.415] (-389.494) (-391.303) -- 0:00:14
      750000 -- (-391.863) (-391.856) (-389.197) [-390.963] * (-393.357) (-390.816) [-392.793] (-390.881) -- 0:00:14

      Average standard deviation of split frequencies: 0.006358

      750500 -- [-392.776] (-393.716) (-389.257) (-391.875) * [-390.192] (-393.961) (-392.638) (-390.721) -- 0:00:14
      751000 -- (-396.090) (-392.313) (-391.163) [-390.564] * [-389.683] (-391.561) (-398.008) (-392.598) -- 0:00:14
      751500 -- (-390.403) [-392.059] (-394.958) (-391.457) * (-393.210) (-393.994) (-390.882) [-392.211] -- 0:00:14
      752000 -- [-393.493] (-392.509) (-395.597) (-396.865) * (-390.199) [-393.041] (-394.033) (-391.895) -- 0:00:14
      752500 -- (-392.523) [-389.478] (-390.670) (-393.872) * (-390.554) (-389.769) [-393.846] (-392.038) -- 0:00:14
      753000 -- [-394.678] (-389.609) (-390.341) (-396.033) * (-393.211) (-393.121) (-393.233) [-390.287] -- 0:00:14
      753500 -- (-390.912) (-390.423) (-394.346) [-390.176] * [-391.696] (-390.424) (-389.833) (-389.087) -- 0:00:14
      754000 -- (-389.618) [-389.381] (-390.307) (-392.739) * [-391.868] (-395.629) (-391.257) (-394.939) -- 0:00:14
      754500 -- (-389.137) (-391.254) [-390.258] (-390.704) * (-390.223) (-390.511) [-389.978] (-392.251) -- 0:00:14
      755000 -- (-389.369) (-393.321) [-389.920] (-391.626) * (-395.448) (-397.335) [-391.498] (-390.697) -- 0:00:14

      Average standard deviation of split frequencies: 0.006002

      755500 -- (-391.001) [-393.080] (-392.581) (-392.102) * (-393.206) (-391.853) [-391.861] (-391.056) -- 0:00:14
      756000 -- (-393.779) (-394.692) (-394.732) [-389.354] * (-391.476) (-394.718) [-392.145] (-392.528) -- 0:00:14
      756500 -- [-393.436] (-390.224) (-393.456) (-390.412) * (-390.501) (-395.571) [-391.443] (-391.850) -- 0:00:14
      757000 -- (-392.501) (-389.945) (-393.303) [-389.442] * (-389.941) [-393.012] (-391.137) (-391.341) -- 0:00:14
      757500 -- (-392.019) (-392.751) (-390.142) [-391.141] * (-390.432) (-392.441) (-390.620) [-391.064] -- 0:00:14
      758000 -- (-391.879) (-394.041) [-392.595] (-392.348) * (-392.414) [-393.320] (-393.183) (-392.506) -- 0:00:14
      758500 -- (-390.646) (-390.703) [-389.939] (-390.801) * [-392.419] (-392.179) (-395.193) (-392.105) -- 0:00:14
      759000 -- (-393.789) [-390.748] (-393.010) (-389.822) * (-391.490) [-391.406] (-389.807) (-391.532) -- 0:00:14
      759500 -- (-391.645) [-391.514] (-393.287) (-389.540) * (-390.879) (-391.109) [-389.227] (-391.857) -- 0:00:14
      760000 -- [-391.567] (-395.563) (-391.082) (-392.818) * (-391.245) (-389.113) [-392.058] (-395.132) -- 0:00:14

      Average standard deviation of split frequencies: 0.005784

      760500 -- (-389.892) (-394.002) (-390.742) [-390.232] * [-392.908] (-389.584) (-390.868) (-389.401) -- 0:00:14
      761000 -- [-390.729] (-391.924) (-392.535) (-396.051) * (-390.774) [-389.097] (-389.813) (-388.956) -- 0:00:14
      761500 -- [-390.973] (-393.971) (-391.638) (-393.820) * (-390.404) [-390.457] (-393.534) (-390.308) -- 0:00:14
      762000 -- (-392.081) [-393.395] (-390.856) (-390.966) * (-390.696) (-390.981) (-394.474) [-390.823] -- 0:00:14
      762500 -- [-392.736] (-390.590) (-393.824) (-392.382) * (-390.305) (-393.484) [-391.728] (-391.406) -- 0:00:14
      763000 -- [-397.122] (-392.198) (-392.992) (-393.716) * (-392.174) (-391.000) [-389.339] (-393.210) -- 0:00:13
      763500 -- (-392.822) [-394.465] (-391.462) (-390.550) * (-394.523) [-390.440] (-391.526) (-393.422) -- 0:00:13
      764000 -- (-389.608) (-394.825) (-391.368) [-393.731] * [-390.608] (-392.149) (-395.907) (-390.583) -- 0:00:13
      764500 -- (-390.150) (-393.985) [-396.020] (-390.353) * (-396.002) [-392.541] (-393.391) (-394.031) -- 0:00:13
      765000 -- (-397.990) (-391.561) (-391.770) [-394.061] * (-392.116) [-390.924] (-390.753) (-391.142) -- 0:00:13

      Average standard deviation of split frequencies: 0.005116

      765500 -- [-391.995] (-391.671) (-390.421) (-391.999) * [-392.236] (-390.933) (-394.183) (-391.063) -- 0:00:13
      766000 -- (-390.910) [-389.661] (-390.981) (-390.493) * [-390.491] (-391.059) (-390.230) (-391.271) -- 0:00:13
      766500 -- (-392.914) (-391.452) [-390.391] (-390.754) * (-390.437) (-394.673) (-395.108) [-392.149] -- 0:00:13
      767000 -- (-396.633) [-391.721] (-392.457) (-393.887) * (-391.433) [-394.468] (-390.417) (-392.153) -- 0:00:13
      767500 -- [-394.140] (-390.215) (-392.490) (-392.771) * (-391.051) (-389.464) [-391.220] (-392.784) -- 0:00:13
      768000 -- (-390.228) (-393.183) [-391.602] (-390.046) * [-390.168] (-392.709) (-391.081) (-392.751) -- 0:00:13
      768500 -- (-389.809) [-389.772] (-392.234) (-391.689) * (-393.168) (-392.512) (-393.305) [-389.894] -- 0:00:13
      769000 -- (-392.163) (-391.587) [-395.102] (-390.498) * [-390.013] (-390.517) (-390.740) (-391.633) -- 0:00:13
      769500 -- [-389.149] (-391.355) (-395.214) (-392.334) * [-389.604] (-391.122) (-392.221) (-394.061) -- 0:00:13
      770000 -- (-392.373) (-392.765) [-398.422] (-390.072) * [-389.179] (-390.693) (-392.610) (-390.969) -- 0:00:13

      Average standard deviation of split frequencies: 0.004893

      770500 -- [-389.626] (-389.979) (-392.617) (-391.417) * (-392.747) (-394.048) (-399.679) [-392.518] -- 0:00:13
      771000 -- (-389.819) (-392.093) (-391.345) [-389.939] * (-391.675) [-390.177] (-393.145) (-393.038) -- 0:00:13
      771500 -- (-393.019) (-394.251) (-394.862) [-392.638] * (-391.316) (-390.560) [-393.722] (-391.106) -- 0:00:13
      772000 -- (-394.559) (-394.429) (-390.205) [-391.786] * (-393.057) (-391.618) [-390.807] (-389.547) -- 0:00:13
      772500 -- (-395.362) [-389.696] (-390.695) (-392.530) * (-392.555) (-393.312) (-398.730) [-391.017] -- 0:00:13
      773000 -- [-396.388] (-389.832) (-390.629) (-391.385) * [-394.721] (-393.350) (-394.053) (-390.231) -- 0:00:13
      773500 -- [-391.309] (-396.232) (-390.365) (-391.125) * [-393.260] (-389.388) (-390.994) (-392.334) -- 0:00:13
      774000 -- (-389.977) (-391.618) (-390.129) [-391.607] * (-391.203) [-389.376] (-389.646) (-392.476) -- 0:00:13
      774500 -- (-392.553) [-393.293] (-390.780) (-390.197) * (-393.424) [-390.028] (-392.471) (-391.903) -- 0:00:13
      775000 -- (-391.444) (-389.491) (-389.566) [-389.449] * (-390.037) (-390.433) (-397.409) [-390.450] -- 0:00:13

      Average standard deviation of split frequencies: 0.004974

      775500 -- (-391.476) (-389.293) [-389.533] (-390.599) * [-390.818] (-393.900) (-391.094) (-389.489) -- 0:00:13
      776000 -- (-390.908) (-390.370) [-389.643] (-390.834) * (-395.037) (-391.169) [-389.470] (-391.810) -- 0:00:13
      776500 -- (-390.312) (-390.368) [-390.304] (-390.150) * (-396.725) (-394.193) [-389.455] (