--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 13:17:11 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/phhB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -390.66 -399.17
2 -390.60 -393.54
--------------------------------------
TOTAL -390.63 -398.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896065 0.088902 0.378410 1.502819 0.868862 1415.48 1458.24 1.000
r(A<->C){all} 0.165019 0.019367 0.000122 0.449940 0.131654 142.65 186.04 1.003
r(A<->G){all} 0.159674 0.018150 0.000044 0.424713 0.122250 220.86 269.34 1.004
r(A<->T){all} 0.161734 0.018749 0.000033 0.434258 0.120526 190.06 257.26 1.000
r(C<->G){all} 0.169458 0.021540 0.000003 0.461421 0.128683 166.17 202.90 1.000
r(C<->T){all} 0.174571 0.021843 0.000093 0.465460 0.135446 211.14 250.35 1.000
r(G<->T){all} 0.169543 0.019047 0.000001 0.441900 0.133601 77.06 181.53 1.000
pi(A){all} 0.261786 0.000679 0.212504 0.314393 0.260734 1103.31 1136.90 1.001
pi(C){all} 0.283467 0.000729 0.230692 0.336275 0.282847 1236.95 1323.64 1.000
pi(G){all} 0.251990 0.000664 0.200828 0.299555 0.251770 1088.57 1250.66 1.000
pi(T){all} 0.202756 0.000576 0.158407 0.250571 0.202047 1346.26 1382.47 1.000
alpha{1,2} 0.433836 0.237591 0.000195 1.440011 0.258625 1247.64 1320.03 1.000
alpha{3} 0.463890 0.237626 0.000415 1.479485 0.293922 1130.15 1161.26 1.000
pinvar{all} 0.994280 0.000045 0.981676 0.999995 0.996463 1354.51 1357.29 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -370.571107
Model 2: PositiveSelection -370.571121
Model 0: one-ratio -370.571128
Model 7: beta -370.571107
Model 8: beta&w>1 -370.571098
Model 0 vs 1 4.200000000764703E-5
Model 2 vs 1 2.8000000042993634E-5
Model 8 vs 7 1.799999995455437E-5
>C1
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C2
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C3
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C4
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C5
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C6
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=94
C1 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C2 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C3 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C4 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C5 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C6 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
**************************************************
C1 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C2 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C3 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C4 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C5 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C6 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 94 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 94 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2820]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2820]--->[2820]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.452 Mb, Max= 30.617 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C2 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C3 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C4 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C5 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
C6 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
**************************************************
C1 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C2 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C3 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C4 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C5 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
C6 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
C2 ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
C3 ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
C4 ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
C5 ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
C6 ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
**************************************************
C1 CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
C2 CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
C3 CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
C4 CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
C5 CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
C6 CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
**************************************************
C1 CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
C2 CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
C3 CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
C4 CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
C5 CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
C6 CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
**************************************************
C1 ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
C2 ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
C3 ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
C4 ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
C5 ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
C6 ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
**************************************************
C1 CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
C2 CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
C3 CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
C4 CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
C5 CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
C6 CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
**************************************************
C1 TGGCACGCGATATCGACAGGCTCATCGGGGAC
C2 TGGCACGCGATATCGACAGGCTCATCGGGGAC
C3 TGGCACGCGATATCGACAGGCTCATCGGGGAC
C4 TGGCACGCGATATCGACAGGCTCATCGGGGAC
C5 TGGCACGCGATATCGACAGGCTCATCGGGGAC
C6 TGGCACGCGATATCGACAGGCTCATCGGGGAC
********************************
>C1
ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
TGGCACGCGATATCGACAGGCTCATCGGGGAC
>C2
ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
TGGCACGCGATATCGACAGGCTCATCGGGGAC
>C3
ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
TGGCACGCGATATCGACAGGCTCATCGGGGAC
>C4
ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
TGGCACGCGATATCGACAGGCTCATCGGGGAC
>C5
ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
TGGCACGCGATATCGACAGGCTCATCGGGGAC
>C6
ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA
CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA
CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA
ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT
CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA
TGGCACGCGATATCGACAGGCTCATCGGGGAC
>C1
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C2
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C3
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C4
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C5
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
>C6
MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 282 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579785342
Setting output file names to "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 70596102
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9635301982
Seed = 567445176
Swapseed = 1579785342
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -631.129485 -- -24.965149
Chain 2 -- -631.129485 -- -24.965149
Chain 3 -- -631.129485 -- -24.965149
Chain 4 -- -631.129485 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -631.129521 -- -24.965149
Chain 2 -- -631.129521 -- -24.965149
Chain 3 -- -631.129521 -- -24.965149
Chain 4 -- -631.129485 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-631.129] (-631.129) (-631.129) (-631.129) * [-631.130] (-631.130) (-631.130) (-631.129)
500 -- (-400.803) (-399.487) (-405.952) [-401.019] * (-405.182) (-400.687) (-401.971) [-392.784] -- 0:00:00
1000 -- [-396.370] (-411.304) (-407.345) (-398.791) * (-400.314) (-399.214) (-400.293) [-400.376] -- 0:00:00
1500 -- [-398.073] (-404.423) (-399.064) (-395.813) * (-407.610) (-404.892) [-393.703] (-397.994) -- 0:00:00
2000 -- (-399.517) [-398.614] (-396.632) (-400.123) * (-409.228) (-401.787) [-402.421] (-398.229) -- 0:00:00
2500 -- (-397.874) (-405.155) (-395.842) [-396.746] * (-397.008) (-406.254) [-394.325] (-399.823) -- 0:00:00
3000 -- (-401.156) (-400.171) [-395.300] (-399.252) * (-400.230) [-398.891] (-402.886) (-398.707) -- 0:00:00
3500 -- (-401.754) (-400.089) [-395.136] (-403.508) * (-404.547) [-399.143] (-405.273) (-398.920) -- 0:00:00
4000 -- (-410.280) (-400.355) (-410.552) [-401.343] * (-399.864) (-404.209) (-399.881) [-402.405] -- 0:00:00
4500 -- (-406.116) (-401.037) [-398.274] (-410.259) * [-398.226] (-408.376) (-405.652) (-398.865) -- 0:00:00
5000 -- (-398.368) [-403.381] (-397.672) (-402.364) * [-402.783] (-404.301) (-396.624) (-401.899) -- 0:00:00
Average standard deviation of split frequencies: 0.070711
5500 -- (-403.592) [-395.838] (-401.912) (-398.484) * [-395.293] (-402.753) (-396.326) (-397.873) -- 0:00:00
6000 -- (-404.968) (-397.963) (-405.858) [-400.634] * (-392.808) (-398.240) [-398.767] (-404.637) -- 0:00:00
6500 -- (-400.761) [-399.437] (-401.587) (-404.190) * (-404.229) (-400.014) [-396.187] (-403.715) -- 0:00:00
7000 -- (-408.330) (-398.206) [-403.862] (-398.607) * (-400.303) (-406.636) [-405.037] (-402.091) -- 0:02:21
7500 -- (-398.026) [-398.352] (-398.645) (-409.723) * (-401.416) [-400.617] (-408.274) (-399.248) -- 0:02:12
8000 -- (-395.611) (-410.313) [-401.466] (-400.972) * (-400.246) (-417.274) (-408.251) [-397.795] -- 0:02:04
8500 -- (-399.554) (-403.455) (-394.108) [-399.285] * (-403.512) (-391.759) [-399.328] (-407.971) -- 0:01:56
9000 -- (-400.191) (-402.558) (-399.694) [-401.028] * (-406.034) (-394.421) (-394.730) [-394.447] -- 0:01:50
9500 -- [-406.397] (-403.964) (-410.269) (-406.734) * (-393.257) [-390.230] (-396.142) (-397.505) -- 0:01:44
10000 -- (-402.146) (-394.800) (-395.702) [-396.200] * (-399.516) (-391.744) (-393.176) [-401.675] -- 0:01:39
Average standard deviation of split frequencies: 0.081410
10500 -- (-405.306) (-411.408) [-404.378] (-398.135) * (-403.832) (-393.293) [-391.165] (-402.699) -- 0:01:34
11000 -- (-408.171) (-398.823) (-398.174) [-402.669] * (-401.076) (-390.306) (-390.183) [-396.404] -- 0:01:29
11500 -- (-403.222) [-396.813] (-396.528) (-396.543) * (-398.564) (-392.611) [-393.085] (-398.490) -- 0:01:25
12000 -- [-399.233] (-406.613) (-405.282) (-397.439) * (-402.396) [-394.492] (-390.478) (-398.054) -- 0:01:22
12500 -- (-396.358) (-393.923) [-403.218] (-403.681) * (-408.186) (-391.224) (-392.177) [-403.083] -- 0:01:19
13000 -- (-399.404) [-394.744] (-399.909) (-398.648) * (-411.144) (-393.740) [-391.278] (-402.271) -- 0:01:15
13500 -- (-398.174) (-399.070) [-397.036] (-396.605) * (-403.128) [-389.398] (-391.162) (-402.520) -- 0:01:13
14000 -- [-402.198] (-400.997) (-408.753) (-399.661) * [-406.046] (-391.202) (-389.590) (-408.404) -- 0:01:10
14500 -- [-398.402] (-398.559) (-395.346) (-400.026) * (-399.392) (-394.878) [-389.732] (-401.688) -- 0:01:07
15000 -- (-400.175) [-396.003] (-396.140) (-400.493) * (-400.407) (-393.232) (-391.012) [-402.036] -- 0:01:05
Average standard deviation of split frequencies: 0.069780
15500 -- (-401.204) [-396.790] (-406.519) (-405.131) * [-402.981] (-391.003) (-390.239) (-415.436) -- 0:01:03
16000 -- (-405.607) (-415.674) [-397.541] (-396.892) * (-401.506) (-389.935) [-390.247] (-413.225) -- 0:01:01
16500 -- (-403.411) (-399.988) [-397.388] (-406.141) * (-404.992) (-391.550) [-391.193] (-392.602) -- 0:00:59
17000 -- [-400.041] (-401.859) (-401.096) (-405.856) * (-404.838) [-389.648] (-391.927) (-390.396) -- 0:00:57
17500 -- [-395.940] (-403.999) (-397.338) (-397.837) * (-403.297) [-391.322] (-391.511) (-389.778) -- 0:00:56
18000 -- [-397.534] (-417.049) (-403.317) (-405.855) * (-407.149) (-395.351) [-393.518] (-390.073) -- 0:00:54
18500 -- (-402.062) [-406.103] (-400.235) (-400.865) * [-400.885] (-391.612) (-396.600) (-390.782) -- 0:00:53
19000 -- (-400.750) (-403.570) (-404.722) [-402.253] * (-402.941) (-391.355) (-402.241) [-389.841] -- 0:00:51
19500 -- (-409.499) (-398.841) (-400.106) [-398.501] * (-403.553) (-391.441) (-390.890) [-389.553] -- 0:00:50
20000 -- (-398.762) [-391.056] (-398.792) (-404.951) * (-407.095) (-390.252) [-390.611] (-391.471) -- 0:00:49
Average standard deviation of split frequencies: 0.059559
20500 -- (-399.016) (-392.926) (-403.496) [-400.271] * [-397.961] (-390.301) (-397.134) (-390.048) -- 0:00:47
21000 -- [-399.516] (-390.626) (-401.030) (-400.819) * (-407.876) (-397.015) (-390.576) [-394.506] -- 0:00:46
21500 -- [-395.717] (-392.381) (-398.724) (-404.989) * [-403.178] (-389.446) (-391.114) (-392.043) -- 0:00:45
22000 -- [-395.487] (-394.378) (-409.932) (-396.208) * [-403.939] (-391.731) (-395.664) (-392.022) -- 0:00:44
22500 -- (-401.485) (-394.941) (-415.250) [-401.096] * (-419.220) [-391.713] (-390.814) (-390.958) -- 0:01:26
23000 -- [-395.636] (-402.666) (-404.663) (-403.793) * (-412.473) (-391.453) [-390.319] (-391.888) -- 0:01:24
23500 -- (-405.268) [-395.165] (-400.453) (-397.985) * (-416.707) [-391.369] (-395.428) (-394.517) -- 0:01:23
24000 -- (-400.489) [-390.857] (-404.771) (-401.424) * (-405.879) (-389.618) [-390.510] (-392.707) -- 0:01:21
24500 -- (-400.654) (-390.672) (-399.939) [-398.630] * (-391.197) [-389.351] (-390.243) (-390.339) -- 0:01:19
25000 -- [-398.144] (-390.475) (-409.492) (-409.416) * (-390.268) [-389.197] (-390.605) (-389.988) -- 0:01:18
Average standard deviation of split frequencies: 0.034535
25500 -- (-394.539) (-392.207) (-404.225) [-397.197] * (-392.831) [-389.767] (-395.890) (-390.861) -- 0:01:16
26000 -- (-408.662) (-396.206) [-404.752] (-409.253) * (-391.410) (-395.389) [-391.512] (-396.975) -- 0:01:14
26500 -- (-403.570) (-392.947) (-406.250) [-399.982] * [-391.924] (-391.324) (-391.971) (-392.115) -- 0:01:13
27000 -- (-404.247) (-392.939) (-416.735) [-401.102] * (-390.337) (-390.428) [-392.259] (-392.993) -- 0:01:12
27500 -- (-398.905) (-392.029) (-398.606) [-395.772] * (-391.607) (-389.578) [-391.658] (-389.953) -- 0:01:10
28000 -- [-396.653] (-392.374) (-394.182) (-400.019) * (-390.456) [-390.261] (-391.400) (-391.073) -- 0:01:09
28500 -- (-398.230) (-390.680) [-392.914] (-415.949) * [-390.865] (-392.133) (-392.525) (-391.027) -- 0:01:08
29000 -- (-396.047) [-393.155] (-389.376) (-402.637) * [-392.251] (-394.003) (-393.129) (-390.605) -- 0:01:06
29500 -- (-404.609) (-389.973) (-391.338) [-402.194] * [-392.617] (-393.433) (-391.674) (-391.540) -- 0:01:05
30000 -- (-399.145) (-391.783) [-389.336] (-401.787) * [-390.277] (-392.640) (-390.269) (-392.506) -- 0:01:04
Average standard deviation of split frequencies: 0.038025
30500 -- (-401.830) [-389.655] (-390.687) (-412.473) * (-391.457) (-391.177) (-389.626) [-391.167] -- 0:01:03
31000 -- (-402.178) (-391.321) [-389.992] (-401.470) * [-391.936] (-397.950) (-390.507) (-394.326) -- 0:01:02
31500 -- (-404.253) (-393.187) (-394.757) [-396.999] * (-394.079) (-394.656) (-390.341) [-391.152] -- 0:01:01
32000 -- [-395.530] (-391.628) (-391.814) (-401.535) * [-390.287] (-391.942) (-391.769) (-391.414) -- 0:01:00
32500 -- [-396.664] (-391.202) (-391.042) (-404.811) * (-389.450) (-393.856) [-392.510] (-389.928) -- 0:00:59
33000 -- [-401.704] (-397.080) (-392.224) (-404.934) * (-391.551) [-390.925] (-390.734) (-390.522) -- 0:00:58
33500 -- (-398.008) (-392.701) [-390.734] (-403.238) * (-392.465) [-392.558] (-391.356) (-389.295) -- 0:00:57
34000 -- (-398.014) (-393.392) [-389.393] (-400.403) * (-393.801) (-397.707) (-391.101) [-392.026] -- 0:00:56
34500 -- (-402.313) (-391.551) [-388.884] (-393.907) * [-391.211] (-393.537) (-393.038) (-393.817) -- 0:00:55
35000 -- [-401.821] (-390.800) (-391.038) (-407.594) * [-389.548] (-395.364) (-392.471) (-391.758) -- 0:00:55
Average standard deviation of split frequencies: 0.031703
35500 -- [-399.381] (-391.252) (-390.730) (-398.164) * (-390.742) [-393.481] (-394.455) (-392.291) -- 0:00:54
36000 -- (-405.848) [-392.794] (-391.013) (-407.624) * (-390.375) (-393.085) (-391.838) [-390.601] -- 0:00:53
36500 -- [-400.710] (-390.760) (-389.461) (-389.523) * [-390.025] (-393.916) (-390.600) (-391.389) -- 0:00:52
37000 -- (-399.651) [-391.057] (-391.091) (-390.945) * [-389.902] (-393.296) (-390.819) (-393.082) -- 0:00:52
37500 -- (-410.060) (-392.095) [-389.861] (-389.619) * (-390.541) (-392.714) [-391.119] (-389.571) -- 0:00:51
38000 -- (-404.138) (-389.688) [-390.471] (-390.749) * (-391.612) [-390.540] (-390.990) (-391.687) -- 0:00:50
38500 -- (-407.298) (-389.888) (-391.761) [-390.477] * (-390.306) [-389.600] (-392.419) (-394.303) -- 0:00:49
39000 -- (-402.494) [-390.890] (-391.274) (-391.200) * (-392.063) (-389.606) [-390.919] (-390.265) -- 0:01:13
39500 -- [-399.226] (-392.555) (-396.089) (-392.002) * (-394.782) [-389.969] (-392.575) (-391.206) -- 0:01:12
40000 -- [-401.901] (-389.452) (-390.550) (-390.250) * [-390.764] (-391.795) (-394.833) (-391.518) -- 0:01:12
Average standard deviation of split frequencies: 0.029895
40500 -- (-405.101) (-393.661) [-392.521] (-392.858) * (-391.040) [-389.549] (-390.904) (-393.610) -- 0:01:11
41000 -- (-403.894) (-395.660) [-395.108] (-396.030) * (-389.120) (-390.336) (-391.411) [-390.067] -- 0:01:10
41500 -- (-421.008) (-391.366) [-390.484] (-392.418) * (-391.210) [-389.942] (-389.415) (-390.927) -- 0:01:09
42000 -- (-411.179) (-391.111) [-391.273] (-390.836) * [-393.070] (-391.516) (-390.228) (-394.824) -- 0:01:08
42500 -- (-400.429) (-391.143) (-389.556) [-397.017] * (-391.255) (-393.802) (-389.652) [-391.618] -- 0:01:07
43000 -- (-391.713) [-390.591] (-391.346) (-396.329) * (-397.178) [-391.815] (-396.192) (-391.932) -- 0:01:06
43500 -- [-393.182] (-391.840) (-391.681) (-392.679) * (-394.846) (-393.705) (-392.345) [-393.007] -- 0:01:05
44000 -- (-392.309) [-392.474] (-391.118) (-390.382) * [-392.345] (-391.932) (-392.254) (-390.743) -- 0:01:05
44500 -- (-393.963) (-399.756) [-390.558] (-392.454) * (-392.844) [-392.094] (-392.886) (-391.415) -- 0:01:04
45000 -- (-392.204) (-391.447) [-392.876] (-392.522) * (-392.212) (-390.428) [-390.319] (-391.227) -- 0:01:03
Average standard deviation of split frequencies: 0.024400
45500 -- [-392.774] (-391.898) (-389.647) (-392.171) * (-390.952) (-391.521) (-389.365) [-392.744] -- 0:01:02
46000 -- (-394.181) [-392.819] (-391.697) (-391.190) * [-390.552] (-395.109) (-390.503) (-390.334) -- 0:01:02
46500 -- (-394.215) [-391.576] (-392.218) (-390.840) * (-393.826) (-389.986) (-390.395) [-389.389] -- 0:01:01
47000 -- (-391.992) (-391.197) (-393.031) [-390.748] * (-390.731) (-390.147) [-390.385] (-395.227) -- 0:01:00
47500 -- [-390.517] (-390.544) (-392.891) (-391.597) * [-390.011] (-389.796) (-391.137) (-390.295) -- 0:01:00
48000 -- (-389.750) (-390.272) (-390.273) [-390.933] * [-389.894] (-395.005) (-393.331) (-392.435) -- 0:00:59
48500 -- (-390.491) (-395.632) [-392.746] (-393.657) * (-390.569) (-392.953) (-393.647) [-393.369] -- 0:00:58
49000 -- [-390.060] (-392.372) (-392.103) (-389.938) * (-390.300) [-391.186] (-389.751) (-391.286) -- 0:00:58
49500 -- [-392.018] (-393.798) (-390.927) (-390.911) * (-392.074) (-391.894) (-391.037) [-389.452] -- 0:00:57
50000 -- (-395.225) [-391.396] (-398.490) (-392.262) * (-393.583) (-392.844) [-391.338] (-389.742) -- 0:00:57
Average standard deviation of split frequencies: 0.024106
50500 -- (-393.056) (-390.097) [-395.489] (-391.412) * (-390.744) [-393.677] (-390.985) (-392.644) -- 0:00:56
51000 -- (-389.477) [-389.966] (-393.672) (-392.611) * (-389.261) [-391.839] (-389.374) (-391.906) -- 0:00:55
51500 -- (-389.447) [-389.477] (-389.980) (-391.963) * (-389.836) (-393.579) (-390.333) [-391.907] -- 0:00:55
52000 -- (-393.977) (-391.636) (-393.804) [-391.791] * (-390.493) (-392.589) [-392.174] (-390.030) -- 0:00:54
52500 -- (-390.278) (-391.916) [-389.693] (-389.078) * (-391.046) (-389.830) (-390.222) [-390.206] -- 0:00:54
53000 -- (-391.157) (-390.163) (-389.086) [-389.965] * (-390.818) [-390.152] (-393.236) (-391.269) -- 0:00:53
53500 -- (-389.631) (-391.117) [-390.400] (-390.721) * (-389.955) (-392.455) (-389.266) [-391.104] -- 0:00:53
54000 -- [-390.918] (-393.007) (-392.687) (-390.140) * (-392.134) (-390.285) (-391.188) [-391.319] -- 0:00:52
54500 -- (-389.822) (-390.820) [-390.947] (-390.634) * (-392.461) (-393.177) (-390.693) [-390.519] -- 0:00:52
55000 -- [-390.135] (-389.455) (-391.172) (-390.021) * [-395.717] (-393.120) (-392.877) (-396.261) -- 0:00:51
Average standard deviation of split frequencies: 0.021245
55500 -- [-393.913] (-392.733) (-392.139) (-391.013) * (-393.043) (-394.215) (-397.060) [-395.255] -- 0:00:51
56000 -- (-392.674) [-395.245] (-389.606) (-394.074) * (-389.415) (-392.849) (-393.663) [-393.774] -- 0:01:07
56500 -- (-390.076) (-394.809) [-392.897] (-390.772) * [-393.059] (-396.235) (-392.388) (-393.389) -- 0:01:06
57000 -- [-391.367] (-391.880) (-393.459) (-394.575) * [-391.135] (-396.808) (-391.973) (-393.320) -- 0:01:06
57500 -- (-391.196) (-393.390) [-391.516] (-389.998) * [-390.727] (-395.295) (-391.483) (-393.567) -- 0:01:05
58000 -- [-389.035] (-393.251) (-389.559) (-390.430) * (-392.904) [-393.123] (-391.600) (-392.990) -- 0:01:04
58500 -- (-391.682) (-392.982) [-389.964] (-390.002) * [-390.133] (-390.605) (-389.992) (-390.647) -- 0:01:04
59000 -- (-391.909) [-390.229] (-391.441) (-389.390) * [-389.609] (-393.914) (-390.219) (-389.684) -- 0:01:03
59500 -- (-393.347) [-389.041] (-391.979) (-391.827) * (-391.070) (-392.069) (-392.665) [-389.497] -- 0:01:03
60000 -- (-390.718) (-396.284) [-390.433] (-391.357) * (-392.035) (-391.081) [-392.612] (-391.242) -- 0:01:02
Average standard deviation of split frequencies: 0.027585
60500 -- (-397.789) (-391.434) [-391.368] (-389.153) * (-393.202) [-391.710] (-391.208) (-394.451) -- 0:01:02
61000 -- (-396.719) (-391.319) (-394.022) [-390.851] * (-391.571) (-393.161) (-392.434) [-390.371] -- 0:01:01
61500 -- [-394.270] (-389.554) (-391.485) (-390.690) * (-391.686) [-390.462] (-398.157) (-393.257) -- 0:01:01
62000 -- (-389.765) (-389.837) [-391.935] (-392.586) * (-390.476) [-391.592] (-392.693) (-393.828) -- 0:01:00
62500 -- (-391.871) (-390.856) [-391.835] (-393.150) * (-390.671) [-393.146] (-390.239) (-393.574) -- 0:01:00
63000 -- (-390.231) (-389.772) (-389.510) [-391.951] * (-390.759) (-389.966) [-391.075] (-393.320) -- 0:00:59
63500 -- [-390.862] (-392.129) (-390.239) (-390.201) * (-392.161) [-392.230] (-390.610) (-391.637) -- 0:00:58
64000 -- (-391.161) [-390.012] (-392.351) (-393.854) * [-389.832] (-392.209) (-390.107) (-392.084) -- 0:00:58
64500 -- (-391.314) [-390.202] (-391.277) (-391.622) * (-390.650) [-392.139] (-389.764) (-391.136) -- 0:00:58
65000 -- [-391.881] (-390.168) (-393.660) (-392.075) * (-392.590) [-390.385] (-390.842) (-392.158) -- 0:00:57
Average standard deviation of split frequencies: 0.021752
65500 -- (-389.895) (-391.346) [-395.516] (-390.640) * (-390.412) (-392.833) [-392.180] (-392.181) -- 0:00:57
66000 -- (-392.181) (-390.435) (-396.350) [-391.605] * (-394.500) (-390.763) (-391.134) [-391.231] -- 0:00:56
66500 -- (-391.452) [-390.665] (-390.880) (-391.782) * (-393.613) (-390.736) (-390.383) [-391.771] -- 0:00:56
67000 -- (-389.986) [-394.304] (-391.643) (-393.511) * (-389.904) (-389.494) [-389.388] (-390.970) -- 0:00:55
67500 -- [-390.200] (-394.989) (-391.538) (-395.469) * [-392.102] (-389.441) (-392.584) (-390.490) -- 0:00:55
68000 -- [-390.495] (-392.257) (-390.437) (-391.491) * (-392.220) [-389.330] (-390.542) (-393.534) -- 0:00:54
68500 -- [-391.726] (-390.715) (-389.418) (-389.589) * (-391.671) (-389.720) (-390.928) [-390.132] -- 0:00:54
69000 -- [-390.841] (-391.606) (-389.160) (-398.959) * (-392.425) (-393.471) (-390.499) [-395.107] -- 0:00:53
69500 -- (-392.400) (-391.733) [-390.128] (-389.298) * (-391.792) [-390.903] (-391.836) (-392.497) -- 0:00:53
70000 -- (-389.989) (-389.816) (-390.031) [-389.633] * (-392.246) [-389.659] (-389.459) (-390.135) -- 0:00:53
Average standard deviation of split frequencies: 0.021753
70500 -- (-393.751) (-389.920) [-389.980] (-389.764) * [-389.837] (-389.633) (-392.846) (-392.023) -- 0:00:52
71000 -- (-394.249) [-389.922] (-389.479) (-390.297) * (-390.106) [-390.127] (-393.528) (-390.974) -- 0:00:52
71500 -- (-399.369) [-390.660] (-393.015) (-390.478) * (-392.070) (-389.408) [-391.499] (-392.852) -- 0:00:51
72000 -- (-390.045) (-392.191) (-392.284) [-392.130] * (-392.996) (-390.721) (-389.627) [-393.759] -- 0:00:51
72500 -- (-392.353) (-393.152) (-393.691) [-392.551] * [-391.535] (-390.437) (-389.436) (-392.961) -- 0:00:51
73000 -- [-390.979] (-395.024) (-394.647) (-389.549) * [-396.734] (-390.621) (-389.620) (-389.959) -- 0:01:03
73500 -- [-389.296] (-393.107) (-392.196) (-392.226) * (-392.449) (-391.667) [-390.424] (-390.289) -- 0:01:03
74000 -- (-391.523) [-390.006] (-391.498) (-395.231) * (-390.354) (-390.755) [-390.249] (-390.415) -- 0:01:02
74500 -- (-392.113) (-389.503) [-389.281] (-389.275) * [-393.109] (-393.369) (-393.035) (-390.548) -- 0:01:02
75000 -- (-390.358) (-389.726) (-389.424) [-391.816] * (-390.205) (-398.812) (-390.707) [-389.399] -- 0:01:01
Average standard deviation of split frequencies: 0.022152
75500 -- (-391.875) (-392.559) [-389.981] (-394.070) * (-390.516) (-393.255) (-391.398) [-389.906] -- 0:01:01
76000 -- (-390.551) (-390.753) [-389.483] (-391.241) * (-390.207) (-394.586) [-390.463] (-389.607) -- 0:01:00
76500 -- (-391.651) (-391.208) [-391.795] (-389.293) * [-393.388] (-390.684) (-390.926) (-391.099) -- 0:01:00
77000 -- (-390.847) [-390.961] (-395.333) (-390.888) * (-394.800) [-390.086] (-391.466) (-390.305) -- 0:00:59
77500 -- (-391.798) [-393.962] (-393.670) (-392.579) * [-393.038] (-394.393) (-389.481) (-390.416) -- 0:00:59
78000 -- (-391.109) (-389.364) (-396.696) [-399.763] * (-390.750) [-390.683] (-390.838) (-389.971) -- 0:00:59
78500 -- (-389.364) (-390.309) (-401.656) [-393.149] * (-390.736) (-394.451) [-389.312] (-392.673) -- 0:00:58
79000 -- (-395.134) (-389.961) [-393.442] (-392.900) * [-391.548] (-391.958) (-392.343) (-393.478) -- 0:00:58
79500 -- (-389.969) (-392.059) [-390.657] (-389.803) * (-390.450) (-390.448) [-396.602] (-393.983) -- 0:00:57
80000 -- (-391.964) (-396.544) [-391.194] (-393.471) * [-389.984] (-392.951) (-394.857) (-389.051) -- 0:00:57
Average standard deviation of split frequencies: 0.023991
80500 -- (-391.291) (-400.917) [-390.448] (-391.548) * [-390.000] (-391.332) (-389.952) (-395.148) -- 0:00:57
81000 -- (-397.029) (-392.576) (-393.871) [-393.556] * [-393.607] (-394.668) (-390.282) (-393.459) -- 0:00:56
81500 -- (-391.925) (-391.305) (-392.512) [-392.144] * (-389.494) (-389.555) (-390.885) [-392.683] -- 0:00:56
82000 -- [-390.164] (-389.811) (-399.371) (-391.229) * (-389.546) (-390.424) [-390.959] (-391.211) -- 0:00:55
82500 -- (-392.037) (-400.800) [-395.237] (-391.795) * [-392.448] (-390.512) (-391.152) (-391.172) -- 0:00:55
83000 -- [-391.385] (-393.763) (-397.495) (-393.866) * (-391.161) [-390.551] (-390.338) (-392.044) -- 0:00:55
83500 -- (-390.515) (-395.784) (-393.014) [-390.178] * (-392.657) (-391.300) [-390.501] (-392.253) -- 0:00:54
84000 -- (-392.161) [-391.699] (-402.137) (-389.394) * (-395.721) (-395.398) [-390.535] (-390.823) -- 0:00:54
84500 -- (-390.456) (-390.923) (-393.793) [-389.072] * (-392.124) (-392.232) [-391.461] (-393.055) -- 0:00:54
85000 -- (-390.718) (-394.793) (-390.027) [-389.994] * (-391.124) (-391.953) (-390.724) [-391.907] -- 0:00:53
Average standard deviation of split frequencies: 0.020195
85500 -- (-391.271) (-394.929) (-391.183) [-393.651] * (-391.747) (-394.335) [-392.517] (-391.211) -- 0:00:53
86000 -- (-394.198) (-391.539) (-390.942) [-393.526] * (-395.173) (-392.980) (-391.085) [-391.670] -- 0:00:53
86500 -- (-390.244) (-390.865) [-390.824] (-392.193) * (-391.516) (-398.329) (-390.562) [-391.213] -- 0:00:52
87000 -- (-392.339) (-390.351) (-393.297) [-390.521] * (-392.550) (-395.362) (-393.005) [-390.339] -- 0:00:52
87500 -- [-390.670] (-390.216) (-391.298) (-393.731) * (-391.916) (-398.324) [-393.143] (-390.458) -- 0:00:52
88000 -- [-389.906] (-392.486) (-391.793) (-396.608) * (-391.835) [-392.656] (-389.422) (-390.309) -- 0:00:51
88500 -- (-392.828) [-391.624] (-393.306) (-391.066) * [-392.270] (-389.700) (-391.501) (-392.618) -- 0:00:51
89000 -- (-389.327) (-390.268) [-393.556] (-393.247) * (-391.686) [-391.168] (-393.846) (-392.763) -- 0:00:51
89500 -- (-394.497) (-390.109) (-389.523) [-393.323] * (-391.715) [-391.362] (-392.574) (-390.387) -- 0:00:50
90000 -- [-390.446] (-391.240) (-391.483) (-394.992) * (-391.460) (-388.987) [-390.005] (-391.320) -- 0:00:50
Average standard deviation of split frequencies: 0.020524
90500 -- [-390.126] (-389.600) (-397.443) (-391.407) * (-391.494) (-392.852) (-389.532) [-390.720] -- 0:01:00
91000 -- (-392.981) (-391.563) [-392.916] (-394.603) * (-393.518) (-392.557) (-389.325) [-391.529] -- 0:00:59
91500 -- (-395.102) (-391.144) (-395.650) [-391.981] * [-394.520] (-392.102) (-394.002) (-390.988) -- 0:00:59
92000 -- [-390.301] (-391.144) (-393.525) (-392.738) * (-392.633) (-389.625) [-392.118] (-390.832) -- 0:00:59
92500 -- (-390.401) (-393.078) (-395.446) [-390.609] * (-390.869) (-391.510) (-389.754) [-389.652] -- 0:00:58
93000 -- (-389.793) (-392.190) (-393.322) [-389.591] * (-390.504) (-390.673) [-391.425] (-390.809) -- 0:00:58
93500 -- (-390.193) (-391.325) [-391.224] (-397.464) * [-390.520] (-393.968) (-390.896) (-390.489) -- 0:00:58
94000 -- [-389.784] (-396.686) (-390.457) (-389.867) * (-392.808) [-392.314] (-390.094) (-389.792) -- 0:00:57
94500 -- (-391.468) [-390.373] (-396.938) (-392.498) * [-392.180] (-394.143) (-391.309) (-394.222) -- 0:00:57
95000 -- (-390.996) [-389.962] (-397.050) (-394.503) * (-392.580) [-390.469] (-391.425) (-392.747) -- 0:00:57
Average standard deviation of split frequencies: 0.018608
95500 -- (-393.669) (-398.427) (-398.680) [-392.204] * (-392.818) (-390.804) [-391.305] (-391.449) -- 0:00:56
96000 -- [-391.542] (-398.398) (-391.147) (-390.108) * (-390.236) (-391.460) (-391.746) [-391.997] -- 0:00:56
96500 -- (-392.917) (-398.160) [-392.242] (-389.967) * (-394.360) [-389.953] (-389.723) (-392.966) -- 0:00:56
97000 -- [-390.772] (-395.753) (-394.924) (-394.034) * (-390.591) (-390.957) (-391.551) [-393.624] -- 0:00:55
97500 -- (-393.429) [-392.101] (-389.787) (-395.734) * [-393.785] (-391.110) (-389.458) (-392.762) -- 0:00:55
98000 -- (-389.876) [-392.619] (-390.177) (-395.310) * (-394.593) [-390.631] (-397.946) (-392.293) -- 0:00:55
98500 -- (-390.579) (-392.143) [-390.240] (-393.630) * [-389.978] (-392.884) (-394.277) (-391.033) -- 0:00:54
99000 -- (-390.112) (-391.131) (-391.677) [-392.435] * (-396.938) (-389.793) (-393.451) [-391.732] -- 0:00:54
99500 -- (-390.277) (-391.066) (-390.196) [-392.596] * (-394.235) (-390.219) (-392.535) [-389.568] -- 0:00:54
100000 -- (-393.061) (-392.401) (-390.868) [-391.649] * (-392.872) [-391.703] (-392.333) (-389.802) -- 0:00:54
Average standard deviation of split frequencies: 0.017253
100500 -- (-393.358) (-389.641) [-390.328] (-391.268) * (-395.041) [-395.111] (-392.912) (-390.140) -- 0:00:53
101000 -- [-390.270] (-392.806) (-389.879) (-395.802) * (-393.616) [-390.962] (-394.596) (-391.475) -- 0:00:53
101500 -- (-391.391) [-391.252] (-392.635) (-391.372) * (-390.379) (-389.944) (-398.220) [-390.485] -- 0:00:53
102000 -- (-390.152) (-391.662) (-393.914) [-390.310] * (-389.786) (-391.945) (-390.100) [-393.998] -- 0:00:52
102500 -- (-391.598) (-390.255) (-391.579) [-390.522] * (-393.733) (-390.549) [-393.257] (-389.969) -- 0:00:52
103000 -- (-391.085) [-394.855] (-391.354) (-391.577) * (-391.509) (-391.798) [-395.113] (-391.024) -- 0:00:52
103500 -- (-392.494) (-392.097) (-391.991) [-390.730] * (-392.908) (-391.185) (-391.872) [-392.722] -- 0:00:51
104000 -- (-392.156) (-393.536) (-392.525) [-390.008] * (-391.547) [-392.786] (-391.841) (-390.322) -- 0:00:51
104500 -- (-390.823) [-390.582] (-390.192) (-391.138) * (-389.478) (-389.922) (-391.098) [-390.629] -- 0:00:51
105000 -- [-391.099] (-393.169) (-394.234) (-391.180) * (-390.885) (-393.030) [-391.205] (-392.542) -- 0:00:51
Average standard deviation of split frequencies: 0.018234
105500 -- [-393.235] (-389.834) (-393.903) (-390.198) * (-391.691) (-393.262) (-389.479) [-391.004] -- 0:00:50
106000 -- (-391.358) (-391.788) [-391.980] (-389.574) * (-391.892) [-392.565] (-391.597) (-391.075) -- 0:00:50
106500 -- [-390.795] (-392.545) (-391.376) (-392.638) * (-391.359) [-391.541] (-391.425) (-390.670) -- 0:00:50
107000 -- (-390.241) [-390.937] (-392.257) (-389.684) * (-395.355) [-393.972] (-391.381) (-391.110) -- 0:00:58
107500 -- (-391.681) (-391.185) (-390.684) [-390.036] * (-390.636) (-391.407) (-390.710) [-389.787] -- 0:00:58
108000 -- (-391.956) (-392.252) [-391.050] (-392.076) * (-393.435) [-392.783] (-392.905) (-392.638) -- 0:00:57
108500 -- (-394.781) (-395.443) [-389.751] (-395.500) * (-390.482) (-391.140) (-391.273) [-390.452] -- 0:00:57
109000 -- (-391.440) (-392.688) (-392.713) [-396.582] * (-390.070) [-390.042] (-392.475) (-391.465) -- 0:00:57
109500 -- [-389.591] (-389.803) (-390.764) (-390.617) * (-390.698) [-390.624] (-390.810) (-392.562) -- 0:00:56
110000 -- [-389.371] (-391.726) (-390.146) (-401.316) * (-390.439) [-391.834] (-391.975) (-390.466) -- 0:00:56
Average standard deviation of split frequencies: 0.019281
110500 -- (-390.138) (-391.987) [-390.007] (-398.399) * (-390.649) (-391.540) [-389.518] (-389.488) -- 0:00:56
111000 -- [-391.110] (-391.206) (-390.757) (-393.439) * (-392.487) [-394.513] (-389.823) (-390.400) -- 0:00:56
111500 -- (-394.601) (-391.400) (-390.294) [-392.464] * (-389.114) (-390.035) [-390.249] (-391.132) -- 0:00:55
112000 -- (-391.049) [-392.511] (-389.926) (-391.849) * [-389.114] (-391.897) (-389.945) (-392.255) -- 0:00:55
112500 -- [-391.245] (-392.939) (-391.766) (-395.669) * (-388.994) (-391.327) (-392.123) [-392.145] -- 0:00:55
113000 -- (-390.537) (-390.171) (-393.481) [-389.607] * (-389.586) (-393.270) (-390.148) [-393.951] -- 0:00:54
113500 -- (-390.499) [-390.277] (-396.374) (-393.300) * [-390.025] (-390.169) (-389.558) (-393.059) -- 0:00:54
114000 -- [-391.632] (-394.164) (-390.365) (-392.601) * [-389.660] (-393.527) (-390.264) (-390.919) -- 0:00:54
114500 -- (-389.694) (-394.860) [-389.643] (-391.888) * [-390.240] (-393.068) (-391.645) (-393.158) -- 0:00:54
115000 -- (-392.617) (-391.627) (-390.089) [-390.523] * (-390.785) [-390.598] (-389.927) (-393.628) -- 0:00:53
Average standard deviation of split frequencies: 0.019416
115500 -- [-391.653] (-390.393) (-389.921) (-392.035) * (-394.762) [-391.053] (-393.378) (-394.961) -- 0:00:53
116000 -- [-390.881] (-393.708) (-390.356) (-389.173) * (-393.675) (-391.962) (-395.862) [-391.593] -- 0:00:53
116500 -- (-389.597) [-389.622] (-389.872) (-391.812) * (-390.372) (-391.724) (-390.770) [-389.360] -- 0:00:53
117000 -- (-390.465) (-393.900) [-392.754] (-393.195) * [-391.487] (-392.220) (-392.849) (-390.066) -- 0:00:52
117500 -- (-392.402) (-390.835) [-392.194] (-395.533) * (-390.803) (-390.400) (-394.619) [-392.329] -- 0:00:52
118000 -- (-393.320) [-389.357] (-389.126) (-391.423) * (-389.662) (-390.533) [-390.973] (-390.993) -- 0:00:52
118500 -- [-391.535] (-392.335) (-390.178) (-394.697) * (-394.677) (-391.211) [-390.569] (-392.484) -- 0:00:52
119000 -- (-391.261) (-393.277) [-391.080] (-390.820) * (-395.820) (-391.995) [-389.830] (-391.508) -- 0:00:51
119500 -- (-391.203) (-392.662) (-390.563) [-392.063] * (-392.091) (-390.903) [-392.852] (-392.334) -- 0:00:51
120000 -- (-394.754) (-391.790) [-393.647] (-393.395) * [-395.915] (-391.649) (-391.705) (-391.099) -- 0:00:51
Average standard deviation of split frequencies: 0.018068
120500 -- (-392.178) (-391.154) (-399.518) [-391.161] * (-392.339) (-390.830) [-390.887] (-390.587) -- 0:00:51
121000 -- (-390.707) [-391.414] (-392.509) (-391.073) * (-395.456) (-392.649) (-389.484) [-390.033] -- 0:00:50
121500 -- [-390.796] (-390.080) (-392.449) (-389.470) * [-392.463] (-395.387) (-389.664) (-389.949) -- 0:00:50
122000 -- (-391.461) (-390.885) (-392.937) [-394.208] * (-390.274) (-393.137) [-391.917] (-390.657) -- 0:00:50
122500 -- (-391.554) [-391.834] (-392.536) (-390.836) * (-390.969) (-390.542) [-389.361] (-396.187) -- 0:00:50
123000 -- [-390.148] (-389.809) (-394.817) (-391.031) * (-391.981) (-390.515) (-389.301) [-391.441] -- 0:00:49
123500 -- [-393.781] (-391.544) (-393.359) (-390.455) * (-395.464) (-389.944) (-389.236) [-389.900] -- 0:00:49
124000 -- [-391.521] (-391.332) (-395.662) (-397.649) * (-392.492) (-390.212) (-391.427) [-391.079] -- 0:00:56
124500 -- (-391.458) (-393.156) [-392.480] (-393.935) * [-391.443] (-389.986) (-389.939) (-391.194) -- 0:00:56
125000 -- [-391.495] (-392.303) (-391.109) (-398.449) * (-390.162) (-391.478) [-391.459] (-392.258) -- 0:00:56
Average standard deviation of split frequencies: 0.019241
125500 -- [-389.415] (-392.237) (-389.910) (-394.801) * (-395.517) (-389.525) [-391.265] (-390.301) -- 0:00:55
126000 -- (-393.630) (-389.582) [-389.105] (-392.304) * (-391.694) (-390.681) [-391.933] (-389.493) -- 0:00:55
126500 -- [-396.919] (-391.568) (-389.316) (-393.521) * (-390.582) (-390.389) [-389.546] (-390.899) -- 0:00:55
127000 -- (-392.163) [-391.598] (-389.913) (-392.688) * (-390.798) (-390.497) (-390.531) [-390.469] -- 0:00:54
127500 -- (-390.316) [-392.238] (-390.095) (-390.030) * (-389.060) (-393.274) [-391.179] (-389.552) -- 0:00:54
128000 -- (-390.552) [-391.897] (-392.619) (-392.295) * (-397.523) (-390.499) (-393.241) [-391.303] -- 0:00:54
128500 -- (-396.046) [-394.178] (-390.467) (-390.152) * [-393.017] (-391.507) (-392.727) (-392.581) -- 0:00:54
129000 -- (-392.187) [-389.795] (-391.537) (-392.614) * (-394.254) (-392.352) (-390.072) [-391.123] -- 0:00:54
129500 -- (-390.394) (-390.076) (-392.731) [-389.870] * (-395.878) (-389.751) (-389.979) [-389.720] -- 0:00:53
130000 -- (-392.076) (-390.831) [-390.844] (-392.522) * (-393.094) [-389.725] (-389.753) (-390.936) -- 0:00:53
Average standard deviation of split frequencies: 0.018897
130500 -- (-392.871) (-390.356) [-389.651] (-391.665) * (-393.225) (-389.394) (-391.487) [-391.661] -- 0:00:53
131000 -- (-392.354) (-391.303) (-391.275) [-393.985] * (-390.302) [-390.062] (-392.221) (-395.380) -- 0:00:53
131500 -- (-391.624) (-389.696) [-389.669] (-390.663) * (-389.909) (-391.046) [-389.915] (-389.763) -- 0:00:52
132000 -- (-393.279) (-389.359) (-391.142) [-391.772] * (-390.732) (-391.742) [-389.533] (-389.942) -- 0:00:52
132500 -- (-392.505) (-390.996) [-391.937] (-390.602) * (-390.526) [-391.347] (-392.809) (-390.892) -- 0:00:52
133000 -- (-389.502) [-392.015] (-391.654) (-390.483) * [-389.742] (-392.514) (-397.863) (-389.732) -- 0:00:52
133500 -- (-390.902) (-391.233) (-396.267) [-389.933] * [-392.252] (-391.066) (-391.001) (-395.399) -- 0:00:51
134000 -- [-390.758] (-389.069) (-389.581) (-391.159) * (-389.655) (-390.284) (-390.524) [-393.377] -- 0:00:51
134500 -- (-394.776) (-391.750) [-393.835] (-392.849) * (-391.498) (-390.313) (-390.932) [-390.461] -- 0:00:51
135000 -- (-390.827) (-397.351) (-391.852) [-390.280] * (-391.463) [-390.201] (-389.948) (-392.199) -- 0:00:51
Average standard deviation of split frequencies: 0.017149
135500 -- [-391.784] (-394.318) (-390.957) (-390.920) * [-390.973] (-392.798) (-389.788) (-389.687) -- 0:00:51
136000 -- [-389.860] (-391.873) (-394.053) (-390.192) * [-394.643] (-390.643) (-392.419) (-393.531) -- 0:00:50
136500 -- (-390.395) (-393.871) (-393.850) [-390.109] * (-393.384) (-392.689) [-392.134] (-393.456) -- 0:00:50
137000 -- [-389.648] (-391.221) (-392.316) (-392.898) * (-391.330) [-392.489] (-391.773) (-392.413) -- 0:00:50
137500 -- (-391.831) (-390.869) (-392.553) [-394.001] * (-390.855) (-390.833) (-390.744) [-390.485] -- 0:00:50
138000 -- (-392.220) [-392.483] (-395.463) (-391.850) * (-395.122) (-390.668) (-391.863) [-395.430] -- 0:00:49
138500 -- (-390.344) (-389.676) (-389.881) [-389.710] * (-398.947) (-392.681) (-396.043) [-391.880] -- 0:00:49
139000 -- [-389.296] (-393.425) (-390.456) (-390.989) * (-392.372) [-391.754] (-393.138) (-390.513) -- 0:00:49
139500 -- (-392.585) [-393.911] (-392.138) (-392.875) * [-393.786] (-393.611) (-390.212) (-393.440) -- 0:00:49
140000 -- (-396.671) (-395.623) [-390.146] (-391.291) * (-393.456) (-390.186) (-393.430) [-391.234] -- 0:00:49
Average standard deviation of split frequencies: 0.018167
140500 -- [-390.321] (-390.880) (-390.096) (-392.539) * (-395.475) (-389.536) (-389.566) [-390.118] -- 0:00:48
141000 -- (-392.929) [-392.485] (-392.110) (-389.975) * (-391.715) [-390.256] (-391.069) (-391.080) -- 0:00:48
141500 -- (-392.364) (-390.838) (-392.054) [-390.117] * (-391.445) (-393.898) (-394.642) [-392.421] -- 0:00:54
142000 -- (-392.921) (-390.277) (-389.989) [-390.120] * [-391.584] (-395.910) (-392.368) (-396.220) -- 0:00:54
142500 -- [-390.907] (-392.142) (-393.114) (-389.253) * (-389.698) (-392.199) [-391.904] (-389.557) -- 0:00:54
143000 -- (-391.802) (-390.197) (-392.748) [-390.104] * [-392.667] (-390.022) (-392.811) (-389.185) -- 0:00:53
143500 -- [-393.546] (-389.679) (-393.439) (-390.108) * [-390.472] (-391.016) (-391.723) (-390.384) -- 0:00:53
144000 -- (-390.036) (-394.359) [-391.093] (-392.807) * (-392.366) [-392.880] (-391.121) (-392.512) -- 0:00:53
144500 -- (-389.938) (-391.870) [-392.717] (-390.529) * [-390.187] (-392.583) (-391.468) (-389.946) -- 0:00:53
145000 -- (-395.801) [-390.530] (-393.578) (-391.189) * (-390.509) (-391.416) [-391.877] (-391.752) -- 0:00:53
Average standard deviation of split frequencies: 0.017113
145500 -- (-400.145) (-392.186) (-392.905) [-393.294] * (-390.109) [-392.011] (-389.796) (-392.868) -- 0:00:52
146000 -- (-390.665) (-391.578) [-391.671] (-395.043) * (-391.821) (-392.492) [-391.214] (-394.579) -- 0:00:52
146500 -- (-390.968) (-389.481) [-391.000] (-390.765) * (-392.473) (-391.171) (-393.962) [-389.808] -- 0:00:52
147000 -- [-390.696] (-391.239) (-391.529) (-390.750) * (-392.648) [-394.049] (-391.359) (-390.808) -- 0:00:52
147500 -- (-391.744) (-390.709) (-390.538) [-391.125] * (-391.391) (-390.168) (-390.354) [-394.652] -- 0:00:52
148000 -- (-392.408) [-393.746] (-389.674) (-391.172) * (-389.764) [-390.237] (-391.065) (-392.494) -- 0:00:51
148500 -- (-393.338) (-392.941) (-390.052) [-393.645] * [-394.500] (-389.926) (-391.042) (-392.172) -- 0:00:51
149000 -- (-389.312) (-390.188) [-393.149] (-391.736) * (-391.719) (-391.007) (-391.197) [-390.918] -- 0:00:51
149500 -- (-395.149) [-392.001] (-390.921) (-392.638) * (-391.106) [-389.351] (-392.512) (-391.691) -- 0:00:51
150000 -- (-392.403) [-390.584] (-397.072) (-392.349) * (-390.209) (-389.571) (-393.943) [-392.753] -- 0:00:51
Average standard deviation of split frequencies: 0.015175
150500 -- (-391.573) [-389.701] (-391.159) (-396.453) * [-391.045] (-391.271) (-390.781) (-391.024) -- 0:00:50
151000 -- [-390.830] (-389.816) (-391.308) (-392.222) * (-391.126) (-389.328) [-390.733] (-393.656) -- 0:00:50
151500 -- (-392.016) (-389.341) [-391.821] (-396.494) * (-392.208) (-389.846) [-393.488] (-390.811) -- 0:00:50
152000 -- [-392.913] (-390.705) (-390.750) (-395.454) * (-392.436) (-393.627) [-391.395] (-390.239) -- 0:00:50
152500 -- (-389.998) [-390.994] (-389.897) (-390.179) * (-390.676) (-390.087) [-391.002] (-394.181) -- 0:00:50
153000 -- (-392.244) [-390.399] (-390.035) (-392.131) * [-390.856] (-392.546) (-391.986) (-391.662) -- 0:00:49
153500 -- (-389.949) [-391.819] (-393.590) (-390.891) * (-392.366) [-391.770] (-393.080) (-393.644) -- 0:00:49
154000 -- [-391.565] (-394.684) (-392.553) (-394.222) * (-391.129) [-391.893] (-389.253) (-392.157) -- 0:00:49
154500 -- (-392.018) (-390.847) [-391.054] (-391.868) * [-390.146] (-391.912) (-393.404) (-397.456) -- 0:00:49
155000 -- (-393.123) (-391.254) (-390.438) [-391.230] * (-392.349) (-395.487) [-394.561] (-393.763) -- 0:00:49
Average standard deviation of split frequencies: 0.013201
155500 -- (-390.860) [-389.550] (-389.933) (-393.003) * (-391.781) (-390.204) [-393.567] (-390.592) -- 0:00:48
156000 -- (-391.872) (-389.513) (-390.478) [-391.168] * (-393.715) (-390.400) [-391.821] (-392.309) -- 0:00:48
156500 -- (-390.226) (-391.306) [-392.170] (-395.456) * [-389.854] (-390.437) (-394.990) (-390.752) -- 0:00:48
157000 -- (-390.710) [-391.709] (-392.382) (-389.874) * [-390.459] (-391.179) (-390.777) (-389.037) -- 0:00:48
157500 -- (-392.985) [-391.285] (-394.892) (-391.699) * (-389.901) (-391.282) [-390.109] (-394.784) -- 0:00:48
158000 -- (-393.385) [-389.638] (-396.331) (-392.519) * (-390.714) (-394.813) [-396.924] (-389.861) -- 0:00:47
158500 -- (-392.120) (-389.532) [-392.530] (-395.653) * (-391.655) (-395.198) (-392.512) [-389.330] -- 0:00:53
159000 -- (-391.839) (-392.257) [-391.289] (-392.335) * (-390.045) (-390.597) [-390.256] (-391.694) -- 0:00:52
159500 -- [-391.711] (-391.230) (-390.435) (-390.443) * (-393.564) [-389.989] (-391.334) (-389.191) -- 0:00:52
160000 -- (-390.932) [-389.836] (-389.282) (-392.836) * [-392.089] (-394.589) (-390.125) (-390.452) -- 0:00:52
Average standard deviation of split frequencies: 0.014377
160500 -- (-391.437) [-392.002] (-394.388) (-394.671) * [-393.104] (-392.105) (-393.562) (-389.852) -- 0:00:52
161000 -- [-393.150] (-389.995) (-390.099) (-392.043) * [-390.948] (-390.330) (-390.452) (-393.546) -- 0:00:52
161500 -- [-390.115] (-391.103) (-392.055) (-392.586) * (-394.400) (-393.216) (-389.816) [-391.294] -- 0:00:51
162000 -- [-391.159] (-389.909) (-390.115) (-394.246) * (-391.780) (-394.476) (-389.751) [-390.346] -- 0:00:51
162500 -- (-390.909) (-390.931) (-390.499) [-391.771] * [-391.266] (-390.822) (-389.771) (-394.966) -- 0:00:51
163000 -- [-392.159] (-390.031) (-391.024) (-391.172) * (-392.219) (-389.653) (-393.044) [-392.822] -- 0:00:51
163500 -- (-399.199) [-390.803] (-389.950) (-392.276) * (-390.533) (-391.770) [-389.372] (-391.059) -- 0:00:51
164000 -- (-389.901) (-395.228) (-392.303) [-391.236] * (-390.199) (-390.901) (-397.804) [-391.403] -- 0:00:50
164500 -- (-391.135) [-390.934] (-389.673) (-392.343) * (-394.174) [-392.911] (-394.766) (-390.557) -- 0:00:50
165000 -- (-390.251) (-392.926) (-389.942) [-391.471] * (-390.693) [-390.924] (-392.727) (-393.004) -- 0:00:50
Average standard deviation of split frequencies: 0.013773
165500 -- (-392.416) (-392.192) [-389.735] (-391.126) * (-391.984) [-390.790] (-390.470) (-391.806) -- 0:00:50
166000 -- (-390.490) [-392.511] (-397.950) (-391.921) * [-389.061] (-390.059) (-392.574) (-392.448) -- 0:00:50
166500 -- [-389.187] (-391.048) (-391.393) (-393.630) * (-392.250) [-389.336] (-392.639) (-392.147) -- 0:00:50
167000 -- (-392.055) (-392.041) [-390.092] (-392.995) * (-389.623) (-394.189) (-392.825) [-390.172] -- 0:00:49
167500 -- [-391.890] (-389.915) (-390.127) (-391.844) * (-389.441) (-392.714) [-391.526] (-389.586) -- 0:00:49
168000 -- (-389.166) (-392.224) [-393.488] (-393.583) * (-392.061) [-392.084] (-389.142) (-389.556) -- 0:00:49
168500 -- (-394.310) (-389.616) (-390.109) [-390.359] * (-391.883) (-390.503) (-394.475) [-394.386] -- 0:00:49
169000 -- [-390.502] (-391.666) (-390.199) (-395.211) * [-390.172] (-392.216) (-389.248) (-394.291) -- 0:00:49
169500 -- [-390.274] (-391.655) (-391.321) (-393.737) * (-389.346) [-389.529] (-391.983) (-391.424) -- 0:00:48
170000 -- (-390.462) (-391.223) [-394.641] (-391.622) * (-390.936) (-393.065) (-391.181) [-390.983] -- 0:00:48
Average standard deviation of split frequencies: 0.014885
170500 -- (-390.674) [-395.707] (-392.265) (-389.602) * (-390.857) (-389.894) [-392.172] (-390.167) -- 0:00:48
171000 -- [-390.305] (-393.138) (-389.648) (-391.988) * (-390.941) (-392.838) (-394.486) [-390.523] -- 0:00:48
171500 -- [-390.847] (-390.462) (-392.844) (-391.867) * (-391.188) (-392.517) (-389.274) [-391.785] -- 0:00:48
172000 -- (-394.221) (-390.372) (-395.080) [-391.893] * (-390.815) [-392.532] (-391.420) (-392.915) -- 0:00:48
172500 -- (-395.103) (-390.231) [-395.344] (-391.104) * (-395.516) (-391.508) [-394.106] (-394.764) -- 0:00:47
173000 -- [-392.000] (-392.200) (-391.175) (-390.937) * (-392.994) [-393.077] (-390.927) (-392.056) -- 0:00:47
173500 -- (-395.042) (-391.951) (-390.359) [-391.321] * (-390.478) (-390.287) (-393.794) [-390.253] -- 0:00:47
174000 -- (-390.786) (-391.045) [-389.635] (-396.814) * [-389.657] (-390.831) (-392.788) (-391.842) -- 0:00:47
174500 -- [-389.526] (-390.802) (-392.807) (-390.108) * [-393.990] (-393.860) (-392.102) (-393.177) -- 0:00:47
175000 -- (-389.177) (-393.530) (-392.437) [-390.352] * [-389.560] (-390.459) (-390.076) (-390.566) -- 0:00:47
Average standard deviation of split frequencies: 0.014865
175500 -- (-396.683) (-390.323) (-390.203) [-395.154] * (-389.452) (-389.900) [-390.971] (-389.920) -- 0:00:51
176000 -- (-392.478) (-391.609) [-391.351] (-390.268) * (-390.041) (-392.521) [-393.413] (-390.712) -- 0:00:51
176500 -- [-391.101] (-390.875) (-389.766) (-390.792) * (-393.175) [-392.042] (-393.281) (-392.373) -- 0:00:51
177000 -- (-389.624) [-391.206] (-394.982) (-392.045) * [-393.004] (-391.412) (-393.648) (-390.440) -- 0:00:51
177500 -- (-392.328) [-392.327] (-390.437) (-390.007) * (-391.076) (-389.787) [-391.954] (-390.038) -- 0:00:50
178000 -- (-392.933) (-389.610) [-389.970] (-390.800) * (-392.205) (-393.993) [-389.975] (-396.432) -- 0:00:50
178500 -- (-393.152) (-389.390) [-389.200] (-392.390) * (-389.549) (-392.598) [-389.323] (-389.557) -- 0:00:50
179000 -- (-391.108) [-390.542] (-390.528) (-397.588) * [-390.232] (-395.061) (-395.429) (-392.552) -- 0:00:50
179500 -- [-391.306] (-392.173) (-389.927) (-390.979) * (-390.981) [-389.966] (-391.607) (-390.897) -- 0:00:50
180000 -- (-390.971) (-390.711) [-390.858] (-394.167) * [-396.389] (-391.342) (-390.150) (-390.990) -- 0:00:50
Average standard deviation of split frequencies: 0.013792
180500 -- (-394.969) (-391.729) (-391.724) [-390.976] * (-392.267) (-395.921) [-391.148] (-391.963) -- 0:00:49
181000 -- (-391.557) [-397.776] (-394.110) (-392.310) * (-392.653) [-390.559] (-390.003) (-390.557) -- 0:00:49
181500 -- [-389.255] (-391.061) (-390.689) (-389.817) * [-389.718] (-390.447) (-389.927) (-389.447) -- 0:00:49
182000 -- [-390.073] (-389.907) (-391.949) (-390.781) * [-393.990] (-390.526) (-389.543) (-391.037) -- 0:00:49
182500 -- [-392.934] (-389.789) (-392.164) (-391.893) * [-392.483] (-394.773) (-390.702) (-392.491) -- 0:00:49
183000 -- (-394.022) (-390.345) [-391.305] (-389.428) * [-390.351] (-392.022) (-391.900) (-391.244) -- 0:00:49
183500 -- (-390.832) (-392.989) [-390.381] (-391.369) * (-391.552) (-394.260) [-390.908] (-391.658) -- 0:00:48
184000 -- (-390.064) [-389.447] (-390.004) (-389.685) * (-390.537) (-390.070) [-389.638] (-390.783) -- 0:00:48
184500 -- (-391.417) (-389.216) [-393.792] (-393.655) * (-390.900) (-390.957) (-391.359) [-392.823] -- 0:00:48
185000 -- [-391.599] (-390.559) (-391.581) (-395.264) * [-391.658] (-390.897) (-391.888) (-390.648) -- 0:00:48
Average standard deviation of split frequencies: 0.013879
185500 -- [-393.540] (-391.051) (-391.844) (-392.980) * [-392.051] (-392.107) (-392.243) (-393.667) -- 0:00:48
186000 -- (-391.137) [-389.972] (-391.492) (-391.549) * [-393.751] (-392.977) (-392.491) (-391.403) -- 0:00:48
186500 -- [-394.573] (-393.552) (-392.090) (-391.745) * (-391.595) (-391.472) [-394.523] (-391.364) -- 0:00:47
187000 -- (-391.216) [-393.241] (-392.801) (-391.606) * (-390.542) (-392.544) (-395.875) [-391.872] -- 0:00:47
187500 -- (-389.799) (-389.455) [-390.145] (-391.250) * (-391.480) [-390.243] (-395.850) (-390.092) -- 0:00:47
188000 -- (-392.773) [-391.362] (-391.530) (-392.607) * (-391.937) (-390.866) (-392.880) [-390.468] -- 0:00:47
188500 -- (-401.186) (-390.823) [-389.023] (-390.911) * (-390.201) (-391.055) [-389.999] (-390.306) -- 0:00:47
189000 -- (-392.126) [-390.526] (-389.062) (-389.465) * (-392.629) (-392.072) (-389.927) [-389.911] -- 0:00:47
189500 -- (-392.029) (-389.914) [-390.679] (-390.070) * (-392.134) (-390.617) [-390.673] (-391.171) -- 0:00:47
190000 -- [-394.705] (-391.129) (-391.425) (-390.114) * (-392.489) [-392.464] (-390.010) (-390.570) -- 0:00:46
Average standard deviation of split frequencies: 0.015355
190500 -- (-391.105) (-390.881) [-390.250] (-389.939) * (-393.090) (-390.810) [-390.953] (-389.413) -- 0:00:46
191000 -- (-395.275) [-392.548] (-390.976) (-391.819) * [-390.730] (-393.471) (-391.815) (-390.936) -- 0:00:46
191500 -- [-390.259] (-394.557) (-392.749) (-389.595) * (-390.098) (-390.399) (-390.632) [-389.990] -- 0:00:46
192000 -- (-391.443) (-390.761) [-389.594] (-389.796) * (-388.945) [-390.302] (-390.616) (-399.450) -- 0:00:50
192500 -- [-390.961] (-393.192) (-389.877) (-397.094) * (-393.987) (-392.031) (-390.089) [-391.336] -- 0:00:50
193000 -- (-397.080) (-394.147) (-392.882) [-399.665] * [-389.490] (-391.643) (-389.436) (-390.847) -- 0:00:50
193500 -- (-391.893) (-390.213) [-389.350] (-393.774) * (-393.533) (-390.565) [-390.296] (-390.206) -- 0:00:50
194000 -- [-392.300] (-394.901) (-392.255) (-390.408) * [-390.316] (-392.830) (-392.629) (-394.815) -- 0:00:49
194500 -- [-390.203] (-395.190) (-392.208) (-390.401) * (-389.528) (-391.118) [-391.752] (-390.537) -- 0:00:49
195000 -- (-391.516) [-390.034] (-392.257) (-391.140) * (-391.053) (-393.969) (-390.479) [-390.889] -- 0:00:49
Average standard deviation of split frequencies: 0.015697
195500 -- (-393.220) (-390.920) [-391.255] (-390.547) * (-391.447) (-391.172) (-396.176) [-390.392] -- 0:00:49
196000 -- (-394.226) (-392.513) [-392.639] (-392.031) * (-393.677) (-395.991) (-396.008) [-389.401] -- 0:00:49
196500 -- [-391.845] (-393.639) (-389.307) (-391.151) * (-397.087) [-392.295] (-392.861) (-391.746) -- 0:00:49
197000 -- (-389.893) (-390.675) (-392.939) [-395.026] * [-390.484] (-393.240) (-390.875) (-391.484) -- 0:00:48
197500 -- (-389.598) (-389.416) [-391.578] (-392.531) * [-389.611] (-389.885) (-392.180) (-390.567) -- 0:00:48
198000 -- (-390.469) (-391.521) (-390.125) [-391.639] * (-391.656) (-392.019) [-392.574] (-393.314) -- 0:00:48
198500 -- [-390.897] (-393.180) (-389.964) (-390.964) * (-394.185) (-391.893) (-390.575) [-392.219] -- 0:00:48
199000 -- (-390.622) (-392.013) [-390.517] (-389.740) * [-390.372] (-392.595) (-393.608) (-389.607) -- 0:00:48
199500 -- (-390.196) [-391.163] (-390.432) (-394.056) * [-390.577] (-391.736) (-394.440) (-389.813) -- 0:00:48
200000 -- (-391.238) (-392.222) (-392.358) [-394.095] * (-391.308) [-390.348] (-390.566) (-396.492) -- 0:00:48
Average standard deviation of split frequencies: 0.017227
200500 -- (-390.691) (-390.362) [-390.241] (-393.144) * (-390.474) (-390.538) [-390.977] (-390.590) -- 0:00:47
201000 -- (-391.870) (-391.003) [-391.199] (-392.811) * (-393.563) [-389.755] (-390.993) (-393.648) -- 0:00:47
201500 -- (-394.767) [-393.636] (-392.097) (-395.276) * (-392.209) (-389.187) [-389.245] (-390.477) -- 0:00:47
202000 -- (-394.678) (-389.686) [-389.319] (-392.555) * [-392.091] (-390.212) (-389.480) (-395.214) -- 0:00:47
202500 -- [-393.000] (-392.093) (-389.643) (-390.718) * [-391.736] (-392.945) (-390.167) (-390.395) -- 0:00:47
203000 -- (-391.767) [-390.060] (-389.787) (-391.087) * (-395.146) (-392.908) [-395.507] (-392.685) -- 0:00:47
203500 -- [-390.203] (-390.528) (-392.084) (-391.908) * [-391.104] (-391.757) (-393.402) (-389.437) -- 0:00:46
204000 -- [-389.652] (-391.983) (-390.486) (-392.488) * (-393.160) (-390.380) [-394.884] (-390.969) -- 0:00:46
204500 -- (-392.547) (-391.289) [-390.135] (-394.129) * (-389.941) (-390.006) [-395.621] (-392.332) -- 0:00:46
205000 -- (-389.242) (-389.932) (-389.933) [-393.183] * [-392.395] (-389.760) (-391.401) (-389.905) -- 0:00:46
Average standard deviation of split frequencies: 0.015778
205500 -- (-389.445) (-391.783) [-391.484] (-390.830) * [-392.108] (-392.329) (-389.938) (-389.955) -- 0:00:46
206000 -- (-391.632) (-391.012) [-389.272] (-390.634) * (-390.965) [-389.501] (-393.151) (-391.392) -- 0:00:46
206500 -- (-391.464) (-392.008) [-389.906] (-392.599) * (-391.126) (-391.726) (-391.816) [-391.352] -- 0:00:46
207000 -- (-390.243) (-393.383) (-391.174) [-390.970] * [-393.739] (-392.646) (-390.636) (-393.615) -- 0:00:45
207500 -- (-394.786) (-390.928) [-390.199] (-390.482) * [-392.370] (-390.110) (-391.118) (-391.426) -- 0:00:45
208000 -- (-391.916) (-393.232) (-390.074) [-390.551] * [-391.466] (-389.864) (-391.506) (-390.804) -- 0:00:45
208500 -- (-391.616) (-393.659) (-390.716) [-391.021] * [-389.632] (-390.209) (-392.273) (-390.129) -- 0:00:45
209000 -- [-393.317] (-390.103) (-390.709) (-394.224) * (-394.186) (-391.178) [-396.166] (-392.245) -- 0:00:49
209500 -- (-391.582) [-390.838] (-393.947) (-395.199) * (-390.964) [-392.698] (-395.075) (-393.308) -- 0:00:49
210000 -- (-392.377) [-390.981] (-392.629) (-391.399) * (-393.021) [-389.196] (-393.899) (-391.066) -- 0:00:48
Average standard deviation of split frequencies: 0.020007
210500 -- [-391.359] (-391.451) (-389.285) (-392.142) * [-389.869] (-390.128) (-391.753) (-391.837) -- 0:00:48
211000 -- (-390.917) [-391.710] (-391.207) (-391.950) * (-389.604) (-390.605) [-391.719] (-389.972) -- 0:00:48
211500 -- (-395.633) (-392.143) (-392.358) [-389.817] * (-391.131) (-391.316) (-392.405) [-390.030] -- 0:00:48
212000 -- (-391.224) [-390.529] (-393.814) (-392.522) * (-389.568) (-390.207) [-391.776] (-394.970) -- 0:00:48
212500 -- [-389.544] (-389.722) (-391.436) (-390.822) * (-390.866) (-391.280) (-394.001) [-395.947] -- 0:00:48
213000 -- (-394.428) (-392.216) [-391.765] (-391.471) * (-390.382) [-391.578] (-392.317) (-392.681) -- 0:00:48
213500 -- (-389.411) [-391.764] (-390.956) (-393.798) * [-391.031] (-392.465) (-390.185) (-396.110) -- 0:00:47
214000 -- (-390.473) [-390.991] (-393.487) (-396.439) * (-390.615) (-392.131) [-390.342] (-398.239) -- 0:00:47
214500 -- (-390.566) (-390.638) [-390.294] (-398.208) * [-389.945] (-392.909) (-392.866) (-392.836) -- 0:00:47
215000 -- (-392.041) (-392.234) (-390.402) [-393.463] * [-390.452] (-390.149) (-390.213) (-392.338) -- 0:00:47
Average standard deviation of split frequencies: 0.018308
215500 -- (-391.282) (-393.031) (-389.598) [-390.396] * (-390.357) [-393.863] (-390.467) (-392.666) -- 0:00:47
216000 -- (-392.762) (-390.949) [-391.638] (-391.947) * [-389.568] (-392.439) (-389.613) (-391.208) -- 0:00:47
216500 -- (-391.237) (-389.963) [-390.759] (-391.781) * [-389.452] (-391.466) (-391.692) (-390.672) -- 0:00:47
217000 -- [-389.900] (-390.866) (-390.266) (-391.260) * (-391.544) (-391.114) (-391.796) [-389.832] -- 0:00:46
217500 -- (-398.680) (-390.787) (-393.067) [-391.267] * (-392.694) (-391.292) (-390.705) [-390.517] -- 0:00:46
218000 -- (-390.938) (-391.186) (-389.726) [-390.517] * [-393.843] (-389.289) (-392.317) (-390.992) -- 0:00:46
218500 -- (-397.811) (-391.756) [-391.538] (-391.314) * (-389.396) (-391.121) [-389.133] (-391.372) -- 0:00:46
219000 -- (-392.387) [-389.578] (-391.727) (-389.882) * (-392.137) [-391.299] (-392.816) (-389.394) -- 0:00:46
219500 -- (-393.182) [-389.872] (-390.272) (-397.759) * (-393.346) (-390.874) (-391.415) [-390.656] -- 0:00:46
220000 -- [-391.480] (-392.522) (-390.334) (-390.514) * (-397.049) [-392.515] (-389.289) (-389.946) -- 0:00:46
Average standard deviation of split frequencies: 0.018472
220500 -- (-391.690) (-390.654) (-392.345) [-391.435] * [-391.678] (-392.068) (-390.906) (-389.648) -- 0:00:45
221000 -- (-392.100) (-391.729) (-390.614) [-392.019] * (-391.112) (-393.471) (-392.437) [-391.528] -- 0:00:45
221500 -- (-389.750) (-390.613) (-394.435) [-391.036] * (-390.744) [-390.577] (-390.578) (-391.247) -- 0:00:45
222000 -- (-390.207) [-390.742] (-390.948) (-389.651) * (-390.519) [-390.393] (-390.851) (-396.412) -- 0:00:45
222500 -- (-393.526) (-390.123) (-392.573) [-391.777] * [-390.444] (-389.826) (-392.506) (-392.065) -- 0:00:45
223000 -- (-392.096) (-393.293) [-390.537] (-391.524) * [-392.328] (-390.532) (-394.661) (-390.982) -- 0:00:45
223500 -- (-392.968) (-391.592) [-394.402] (-390.813) * [-392.018] (-395.690) (-390.228) (-389.943) -- 0:00:45
224000 -- (-391.347) [-392.054] (-390.371) (-393.206) * (-391.144) [-395.442] (-393.291) (-390.996) -- 0:00:45
224500 -- (-390.128) (-395.542) (-392.160) [-391.043] * (-391.812) (-389.739) [-389.244] (-391.577) -- 0:00:44
225000 -- [-392.131] (-389.782) (-394.212) (-391.676) * [-392.322] (-393.184) (-390.000) (-391.922) -- 0:00:44
Average standard deviation of split frequencies: 0.017785
225500 -- (-390.786) (-392.233) (-392.712) [-392.681] * (-391.138) [-390.609] (-390.304) (-394.660) -- 0:00:44
226000 -- (-394.399) (-392.348) [-392.342] (-391.343) * [-389.508] (-389.480) (-390.748) (-394.158) -- 0:00:47
226500 -- (-392.802) [-389.943] (-392.699) (-392.793) * (-390.542) (-393.610) (-389.475) [-391.910] -- 0:00:47
227000 -- (-389.946) [-391.893] (-392.617) (-390.607) * (-391.892) (-392.067) (-390.610) [-390.339] -- 0:00:47
227500 -- (-392.151) (-390.064) [-389.679] (-392.980) * (-391.525) [-390.130] (-391.415) (-390.442) -- 0:00:47
228000 -- (-391.338) [-393.263] (-390.093) (-392.313) * (-396.780) (-390.884) [-389.999] (-391.183) -- 0:00:47
228500 -- (-393.345) [-391.718] (-391.377) (-393.359) * [-391.585] (-390.901) (-392.235) (-389.670) -- 0:00:47
229000 -- (-391.187) [-390.700] (-392.113) (-389.720) * [-390.583] (-390.538) (-389.122) (-390.038) -- 0:00:47
229500 -- (-393.863) (-390.856) (-391.427) [-389.167] * [-389.845] (-389.391) (-392.206) (-390.873) -- 0:00:47
230000 -- (-392.538) (-389.710) (-390.106) [-390.502] * [-389.726] (-392.093) (-393.254) (-390.485) -- 0:00:46
Average standard deviation of split frequencies: 0.017882
230500 -- (-390.651) (-390.244) (-389.920) [-389.801] * (-389.470) (-392.697) (-389.809) [-391.827] -- 0:00:46
231000 -- (-392.118) (-390.177) (-390.903) [-395.692] * (-389.605) [-392.426] (-391.398) (-390.993) -- 0:00:46
231500 -- [-390.905] (-390.019) (-391.833) (-392.428) * [-390.043] (-393.489) (-390.828) (-389.625) -- 0:00:46
232000 -- [-394.716] (-391.869) (-393.401) (-391.716) * [-390.353] (-390.591) (-390.666) (-391.024) -- 0:00:46
232500 -- (-396.616) (-389.155) [-390.530] (-390.792) * (-391.057) [-389.968] (-397.363) (-390.982) -- 0:00:46
233000 -- [-392.250] (-390.811) (-390.080) (-395.080) * (-391.644) [-391.036] (-392.674) (-391.835) -- 0:00:46
233500 -- (-391.540) (-392.092) (-390.492) [-391.718] * (-390.943) (-390.689) [-390.893] (-393.008) -- 0:00:45
234000 -- (-389.658) [-391.706] (-393.929) (-394.485) * (-390.324) (-393.622) (-392.337) [-396.918] -- 0:00:45
234500 -- (-393.401) (-392.530) [-393.053] (-393.189) * (-391.605) (-389.799) [-393.765] (-392.143) -- 0:00:45
235000 -- [-393.657] (-390.973) (-393.456) (-390.558) * [-389.541] (-397.625) (-393.676) (-391.276) -- 0:00:45
Average standard deviation of split frequencies: 0.018976
235500 -- (-393.010) (-391.225) (-395.746) [-391.308] * (-391.308) (-390.309) [-389.626] (-395.788) -- 0:00:45
236000 -- (-389.263) [-390.264] (-393.458) (-394.663) * (-392.173) (-393.551) [-391.065] (-396.306) -- 0:00:45
236500 -- [-389.409] (-390.569) (-393.231) (-390.496) * (-389.477) (-390.220) (-393.096) [-391.459] -- 0:00:45
237000 -- [-389.164] (-390.141) (-392.711) (-390.642) * (-389.452) (-389.322) (-392.629) [-391.618] -- 0:00:45
237500 -- [-390.550] (-390.469) (-390.773) (-389.407) * (-389.058) (-392.792) (-390.472) [-390.648] -- 0:00:44
238000 -- [-390.288] (-391.045) (-389.662) (-393.452) * [-388.987] (-390.853) (-393.310) (-390.695) -- 0:00:44
238500 -- (-390.078) [-389.642] (-391.391) (-393.600) * [-389.869] (-390.077) (-395.635) (-390.237) -- 0:00:44
239000 -- (-391.484) (-389.695) [-390.151] (-392.039) * (-390.618) (-389.825) (-396.593) [-391.403] -- 0:00:44
239500 -- (-392.736) (-389.750) [-390.553] (-393.756) * [-393.713] (-391.498) (-394.323) (-394.047) -- 0:00:44
240000 -- (-394.545) [-390.147] (-389.996) (-389.957) * (-391.348) (-390.575) (-396.730) [-390.092] -- 0:00:44
Average standard deviation of split frequencies: 0.018173
240500 -- (-393.490) (-391.196) (-391.109) [-396.152] * (-391.117) (-392.279) [-392.704] (-389.477) -- 0:00:44
241000 -- (-391.433) (-392.207) [-391.277] (-391.509) * (-391.394) [-391.185] (-397.014) (-390.417) -- 0:00:44
241500 -- (-390.762) (-390.614) (-397.424) [-390.453] * (-392.282) [-389.617] (-391.348) (-391.320) -- 0:00:43
242000 -- (-389.260) (-393.939) (-390.019) [-390.825] * [-390.583] (-395.091) (-389.716) (-391.909) -- 0:00:43
242500 -- (-392.461) [-390.533] (-392.807) (-396.688) * (-396.046) (-391.940) [-390.787] (-392.631) -- 0:00:43
243000 -- (-393.591) [-392.478] (-393.016) (-390.349) * [-392.433] (-394.115) (-393.240) (-390.191) -- 0:00:46
243500 -- (-391.210) (-389.670) (-390.680) [-392.420] * (-393.287) [-391.805] (-396.511) (-388.962) -- 0:00:46
244000 -- (-392.854) (-390.284) [-390.381] (-390.539) * (-392.548) [-391.150] (-392.920) (-389.716) -- 0:00:46
244500 -- (-393.268) (-389.546) (-389.907) [-391.059] * [-390.367] (-392.205) (-390.920) (-390.163) -- 0:00:46
245000 -- (-390.287) [-389.803] (-393.427) (-391.459) * (-391.421) [-395.783] (-391.243) (-391.538) -- 0:00:46
Average standard deviation of split frequencies: 0.016608
245500 -- (-390.587) (-389.897) [-392.268] (-391.984) * (-390.003) (-391.509) [-390.906] (-390.134) -- 0:00:46
246000 -- (-390.240) [-389.570] (-395.395) (-391.493) * [-389.423] (-392.989) (-392.466) (-392.940) -- 0:00:45
246500 -- [-392.895] (-391.746) (-391.684) (-390.543) * (-392.919) (-390.365) [-391.149] (-391.639) -- 0:00:45
247000 -- (-396.939) [-389.365] (-390.421) (-391.510) * [-389.393] (-390.257) (-391.499) (-389.893) -- 0:00:45
247500 -- (-390.941) (-390.065) (-390.517) [-390.781] * (-389.517) [-391.775] (-392.213) (-390.570) -- 0:00:45
248000 -- (-389.599) [-391.423] (-392.414) (-390.707) * [-390.753] (-391.412) (-398.718) (-389.932) -- 0:00:45
248500 -- (-390.585) [-391.081] (-391.804) (-395.681) * (-391.075) (-393.256) [-390.754] (-390.081) -- 0:00:45
249000 -- (-390.186) (-390.278) [-391.238] (-392.869) * (-393.895) [-393.149] (-391.408) (-393.989) -- 0:00:45
249500 -- (-390.571) (-392.511) [-390.758] (-392.492) * (-389.730) (-391.787) [-390.879] (-390.768) -- 0:00:45
250000 -- [-391.142] (-391.043) (-390.322) (-389.985) * (-393.989) [-389.632] (-391.306) (-390.436) -- 0:00:45
Average standard deviation of split frequencies: 0.016233
250500 -- (-396.522) (-390.156) [-393.613] (-391.564) * [-391.459] (-390.535) (-389.618) (-389.941) -- 0:00:44
251000 -- (-399.717) (-389.397) [-391.365] (-390.520) * [-389.868] (-389.944) (-389.582) (-388.955) -- 0:00:44
251500 -- [-396.630] (-390.499) (-390.606) (-390.499) * (-402.091) (-391.313) [-392.154] (-395.061) -- 0:00:44
252000 -- (-392.402) [-390.645] (-389.707) (-393.493) * (-390.605) [-391.049] (-393.698) (-392.486) -- 0:00:44
252500 -- (-392.559) (-392.656) (-395.029) [-395.733] * (-390.771) (-390.691) (-396.647) [-392.222] -- 0:00:44
253000 -- [-389.515] (-389.863) (-390.921) (-390.654) * (-390.876) (-391.651) (-391.278) [-390.431] -- 0:00:44
253500 -- (-391.150) (-390.555) [-390.211] (-389.556) * (-393.081) (-390.629) [-390.859] (-389.694) -- 0:00:44
254000 -- [-395.205] (-390.026) (-390.718) (-390.767) * [-392.019] (-390.332) (-390.517) (-389.542) -- 0:00:44
254500 -- (-395.634) (-390.767) (-391.755) [-389.655] * (-391.776) (-392.575) [-394.774] (-390.429) -- 0:00:43
255000 -- [-391.303] (-391.137) (-390.783) (-391.330) * (-389.694) [-391.039] (-393.454) (-393.278) -- 0:00:43
Average standard deviation of split frequencies: 0.015410
255500 -- (-391.762) (-392.787) [-394.147] (-394.182) * (-393.033) (-396.716) [-393.448] (-394.375) -- 0:00:43
256000 -- (-392.484) (-392.636) [-390.107] (-392.144) * (-395.543) (-392.381) (-390.880) [-395.147] -- 0:00:43
256500 -- [-392.442] (-394.872) (-389.856) (-392.582) * (-397.967) (-392.528) (-392.575) [-391.964] -- 0:00:43
257000 -- [-394.353] (-397.881) (-391.162) (-391.034) * (-391.425) (-391.625) [-391.816] (-390.431) -- 0:00:43
257500 -- (-397.064) (-395.855) [-391.831] (-391.680) * (-389.902) [-390.760] (-395.442) (-391.071) -- 0:00:43
258000 -- (-400.401) [-392.651] (-394.289) (-390.864) * (-393.215) (-390.890) [-394.437] (-393.214) -- 0:00:43
258500 -- (-391.863) (-391.492) [-389.010] (-393.393) * (-390.214) [-392.273] (-392.807) (-391.496) -- 0:00:43
259000 -- (-389.859) (-390.595) [-391.829] (-392.641) * (-391.253) (-391.503) (-391.700) [-390.084] -- 0:00:42
259500 -- (-394.098) [-390.781] (-389.486) (-394.351) * (-392.775) (-389.560) [-390.638] (-390.312) -- 0:00:42
260000 -- (-396.145) (-391.267) [-389.409] (-390.892) * (-390.906) (-391.297) (-392.562) [-390.709] -- 0:00:45
Average standard deviation of split frequencies: 0.014087
260500 -- (-391.486) (-390.022) [-390.240] (-395.146) * [-390.404] (-390.927) (-391.255) (-391.984) -- 0:00:45
261000 -- (-390.519) (-389.340) [-389.911] (-392.537) * (-389.238) [-390.163] (-390.969) (-391.255) -- 0:00:45
261500 -- (-390.408) [-389.984] (-391.711) (-389.790) * [-394.130] (-394.774) (-390.149) (-395.446) -- 0:00:45
262000 -- (-394.288) (-391.428) (-391.848) [-390.389] * (-390.924) (-395.386) [-390.028] (-389.872) -- 0:00:45
262500 -- (-391.105) (-392.192) (-389.084) [-392.184] * (-392.059) [-394.367] (-391.797) (-391.205) -- 0:00:44
263000 -- (-391.657) (-390.484) [-390.771] (-390.128) * (-392.822) (-393.615) (-391.745) [-389.832] -- 0:00:44
263500 -- (-390.331) (-392.630) (-390.273) [-391.303] * (-391.572) (-391.018) (-389.554) [-389.063] -- 0:00:44
264000 -- (-390.206) (-393.227) [-389.515] (-390.266) * [-391.136] (-391.348) (-390.458) (-393.289) -- 0:00:44
264500 -- [-389.655] (-391.606) (-393.282) (-391.678) * (-390.439) (-391.762) (-390.189) [-389.298] -- 0:00:44
265000 -- (-393.402) (-392.993) [-390.503] (-394.513) * (-391.388) (-390.790) [-389.930] (-389.834) -- 0:00:44
Average standard deviation of split frequencies: 0.012898
265500 -- (-391.301) [-389.538] (-397.294) (-390.798) * [-391.051] (-391.527) (-392.085) (-391.714) -- 0:00:44
266000 -- (-392.527) (-390.357) (-394.921) [-389.824] * (-390.477) (-390.700) (-394.500) [-391.457] -- 0:00:44
266500 -- (-391.817) [-390.144] (-394.651) (-392.368) * (-390.511) (-391.704) (-390.454) [-390.571] -- 0:00:44
267000 -- [-390.335] (-391.464) (-393.110) (-390.935) * (-389.904) (-393.666) [-390.283] (-391.483) -- 0:00:43
267500 -- (-390.753) (-393.834) (-393.331) [-390.052] * [-389.659] (-391.156) (-389.621) (-393.059) -- 0:00:43
268000 -- (-390.645) [-392.500] (-394.209) (-392.167) * [-390.759] (-390.541) (-391.365) (-389.262) -- 0:00:43
268500 -- (-390.369) [-392.668] (-392.901) (-389.339) * (-392.181) (-391.232) [-392.446] (-389.234) -- 0:00:43
269000 -- [-390.946] (-392.471) (-392.563) (-390.931) * (-391.283) [-389.767] (-392.098) (-392.321) -- 0:00:43
269500 -- (-394.672) (-390.553) [-392.886] (-390.328) * [-389.984] (-391.512) (-393.010) (-391.138) -- 0:00:43
270000 -- (-391.029) (-390.256) (-390.542) [-390.616] * [-389.971] (-389.965) (-390.867) (-391.811) -- 0:00:43
Average standard deviation of split frequencies: 0.012288
270500 -- (-391.986) [-390.806] (-389.795) (-390.478) * (-391.636) (-391.974) (-390.325) [-391.812] -- 0:00:43
271000 -- (-394.278) (-391.414) [-390.554] (-390.899) * (-390.132) [-392.417] (-391.742) (-392.622) -- 0:00:43
271500 -- (-393.646) (-389.395) [-393.083] (-391.303) * (-391.514) (-391.860) [-390.693] (-392.957) -- 0:00:42
272000 -- (-392.849) [-389.174] (-394.108) (-390.839) * [-392.125] (-395.605) (-392.485) (-392.930) -- 0:00:42
272500 -- (-391.116) (-390.942) (-394.009) [-390.259] * (-392.718) [-389.995] (-392.448) (-390.982) -- 0:00:42
273000 -- (-390.580) (-391.281) (-391.147) [-392.607] * [-390.716] (-394.943) (-390.817) (-391.187) -- 0:00:42
273500 -- (-389.947) (-389.945) [-393.515] (-391.936) * (-392.833) [-392.941] (-392.351) (-392.954) -- 0:00:42
274000 -- [-390.112] (-391.346) (-392.231) (-394.272) * (-393.299) (-389.903) [-391.818] (-392.564) -- 0:00:42
274500 -- (-392.146) [-393.929] (-393.318) (-391.241) * (-395.434) (-394.419) (-391.520) [-389.442] -- 0:00:42
275000 -- (-392.840) (-392.927) [-393.433] (-394.262) * (-390.874) [-389.775] (-390.480) (-390.127) -- 0:00:42
Average standard deviation of split frequencies: 0.013569
275500 -- (-391.892) (-391.059) (-389.165) [-391.094] * [-390.671] (-391.443) (-393.842) (-390.151) -- 0:00:42
276000 -- [-390.501] (-393.153) (-389.283) (-399.263) * (-390.531) (-392.504) [-391.887] (-390.388) -- 0:00:41
276500 -- (-392.033) [-392.877] (-393.220) (-393.708) * (-389.622) [-390.399] (-394.787) (-391.299) -- 0:00:44
277000 -- (-395.545) [-392.942] (-391.855) (-393.987) * (-389.498) [-389.406] (-392.734) (-393.660) -- 0:00:44
277500 -- (-393.729) (-394.333) [-389.889] (-390.536) * (-390.043) [-390.015] (-393.124) (-394.035) -- 0:00:44
278000 -- (-394.002) [-391.584] (-392.457) (-390.337) * (-391.546) (-389.719) (-391.585) [-390.746] -- 0:00:44
278500 -- [-391.423] (-390.907) (-392.929) (-392.690) * [-390.032] (-392.892) (-389.478) (-390.172) -- 0:00:44
279000 -- (-394.889) (-392.663) [-390.168] (-392.692) * (-393.502) (-389.415) (-391.325) [-389.982] -- 0:00:43
279500 -- (-394.403) [-391.092] (-391.238) (-391.068) * [-392.000] (-391.281) (-390.859) (-389.820) -- 0:00:43
280000 -- (-390.892) [-393.211] (-392.982) (-390.253) * (-389.754) (-393.361) [-391.626] (-390.465) -- 0:00:43
Average standard deviation of split frequencies: 0.012844
280500 -- (-391.375) [-390.734] (-391.638) (-394.928) * [-393.406] (-392.127) (-395.507) (-394.640) -- 0:00:43
281000 -- (-390.325) (-394.612) [-393.409] (-389.631) * [-392.391] (-399.553) (-390.369) (-391.114) -- 0:00:43
281500 -- (-390.129) [-392.069] (-393.620) (-392.278) * (-393.262) (-397.535) (-391.790) [-390.585] -- 0:00:43
282000 -- [-390.425] (-390.585) (-393.948) (-388.966) * (-390.516) (-390.861) [-392.614] (-395.275) -- 0:00:43
282500 -- (-389.766) [-393.266] (-398.991) (-390.915) * (-394.107) (-392.668) (-391.319) [-390.900] -- 0:00:43
283000 -- [-392.538] (-390.741) (-392.593) (-391.654) * (-394.884) (-391.310) [-390.531] (-390.952) -- 0:00:43
283500 -- (-391.429) (-390.378) [-390.415] (-390.809) * (-391.124) (-393.020) [-390.083] (-390.167) -- 0:00:42
284000 -- (-390.775) (-391.558) [-394.227] (-389.678) * (-391.470) [-391.128] (-393.021) (-391.082) -- 0:00:42
284500 -- (-391.303) (-392.736) (-397.427) [-390.912] * (-389.682) (-392.183) (-390.229) [-390.273] -- 0:00:42
285000 -- (-390.436) (-391.676) (-389.424) [-392.785] * (-392.716) (-392.615) (-390.597) [-389.665] -- 0:00:42
Average standard deviation of split frequencies: 0.012604
285500 -- (-390.439) [-391.809] (-390.131) (-390.717) * [-390.243] (-391.581) (-391.001) (-390.939) -- 0:00:42
286000 -- (-391.838) (-392.931) (-389.575) [-393.403] * (-393.985) (-392.348) (-389.388) [-392.920] -- 0:00:42
286500 -- (-391.024) [-393.313] (-392.171) (-390.721) * [-395.762] (-394.615) (-392.617) (-391.943) -- 0:00:42
287000 -- [-389.453] (-389.292) (-389.503) (-390.786) * [-392.111] (-398.844) (-396.366) (-392.399) -- 0:00:42
287500 -- (-390.354) [-393.656] (-391.572) (-394.676) * (-391.920) (-393.269) [-391.609] (-392.471) -- 0:00:42
288000 -- (-390.400) (-390.286) (-389.883) [-392.193] * (-399.968) [-393.403] (-394.012) (-391.553) -- 0:00:42
288500 -- (-390.379) (-391.982) (-389.792) [-390.634] * (-390.736) (-394.409) (-389.634) [-391.489] -- 0:00:41
289000 -- (-390.337) (-394.459) [-394.078] (-389.662) * [-391.756] (-390.692) (-392.284) (-392.933) -- 0:00:41
289500 -- (-391.121) (-390.307) (-391.857) [-390.859] * (-392.873) (-389.557) (-392.606) [-389.884] -- 0:00:41
290000 -- (-399.719) (-391.135) (-390.673) [-390.201] * (-391.749) (-389.092) [-390.267] (-389.832) -- 0:00:41
Average standard deviation of split frequencies: 0.013065
290500 -- (-391.348) (-394.342) (-390.101) [-391.212] * (-390.732) (-390.426) [-390.714] (-389.571) -- 0:00:41
291000 -- (-393.458) [-389.370] (-392.919) (-393.638) * [-389.449] (-390.291) (-389.388) (-396.081) -- 0:00:41
291500 -- (-391.368) (-390.268) [-392.644] (-394.274) * [-390.262] (-391.152) (-390.638) (-392.142) -- 0:00:41
292000 -- (-393.291) [-389.720] (-391.005) (-390.599) * [-389.616] (-397.058) (-392.544) (-391.002) -- 0:00:41
292500 -- (-396.674) (-391.205) (-394.839) [-396.179] * (-394.745) (-392.233) (-391.514) [-394.914] -- 0:00:41
293000 -- (-389.231) [-389.264] (-395.177) (-390.736) * (-390.549) (-393.069) (-392.757) [-391.877] -- 0:00:41
293500 -- (-396.565) (-391.516) [-393.056] (-393.290) * (-392.442) (-392.331) (-391.997) [-390.390] -- 0:00:43
294000 -- (-394.124) (-394.006) (-390.633) [-390.299] * (-390.294) (-391.027) [-394.538] (-392.858) -- 0:00:43
294500 -- (-394.168) [-391.956] (-391.235) (-390.156) * (-392.293) (-391.512) [-394.420] (-393.906) -- 0:00:43
295000 -- (-389.550) [-391.455] (-392.127) (-390.086) * (-393.419) (-390.061) (-390.178) [-390.446] -- 0:00:43
Average standard deviation of split frequencies: 0.012243
295500 -- (-392.720) (-390.440) [-395.893] (-392.139) * [-391.557] (-391.249) (-389.995) (-393.459) -- 0:00:42
296000 -- (-391.980) (-390.703) (-391.447) [-390.959] * (-390.119) [-390.075] (-395.428) (-398.380) -- 0:00:42
296500 -- (-391.972) (-392.784) (-392.639) [-389.799] * (-390.715) (-392.072) (-390.330) [-390.398] -- 0:00:42
297000 -- (-389.817) (-389.714) [-390.135] (-395.994) * (-391.966) (-395.025) (-390.604) [-391.450] -- 0:00:42
297500 -- (-390.860) [-391.031] (-393.052) (-389.937) * (-391.797) (-391.289) (-389.677) [-391.238] -- 0:00:42
298000 -- (-393.685) [-391.345] (-393.076) (-393.587) * [-391.390] (-394.564) (-392.350) (-391.303) -- 0:00:42
298500 -- [-390.006] (-392.137) (-392.970) (-393.533) * [-392.268] (-392.423) (-390.574) (-391.151) -- 0:00:42
299000 -- (-390.179) [-392.332] (-390.546) (-389.426) * (-391.318) [-392.778] (-397.227) (-393.182) -- 0:00:42
299500 -- [-390.846] (-391.050) (-390.981) (-390.576) * (-391.036) (-391.033) [-389.372] (-391.975) -- 0:00:42
300000 -- (-390.280) (-395.135) (-389.876) [-389.951] * (-395.542) (-389.469) [-390.614] (-391.176) -- 0:00:42
Average standard deviation of split frequencies: 0.012347
300500 -- (-392.404) (-390.899) [-391.638] (-391.192) * [-391.240] (-397.534) (-389.945) (-390.398) -- 0:00:41
301000 -- (-392.105) [-394.671] (-390.989) (-389.920) * [-392.449] (-392.199) (-390.437) (-392.717) -- 0:00:41
301500 -- (-393.507) (-397.948) [-390.210] (-392.437) * (-397.899) (-391.349) [-391.627] (-390.814) -- 0:00:41
302000 -- (-391.605) (-393.703) (-391.793) [-390.230] * (-393.110) (-390.490) (-390.682) [-390.038] -- 0:00:41
302500 -- (-390.352) (-393.700) (-392.824) [-394.272] * [-390.187] (-391.061) (-391.259) (-391.068) -- 0:00:41
303000 -- (-389.791) (-390.162) [-390.843] (-398.246) * (-391.324) [-390.126] (-390.017) (-393.851) -- 0:00:41
303500 -- (-395.284) [-390.126] (-392.744) (-392.086) * (-390.475) [-389.949] (-391.373) (-393.150) -- 0:00:41
304000 -- (-394.267) [-391.986] (-392.458) (-392.038) * [-390.541] (-390.937) (-389.631) (-392.269) -- 0:00:41
304500 -- [-392.029] (-389.924) (-391.145) (-389.382) * [-391.826] (-394.395) (-392.025) (-392.107) -- 0:00:41
305000 -- [-393.991] (-392.322) (-391.754) (-399.144) * [-391.490] (-391.085) (-392.382) (-395.453) -- 0:00:41
Average standard deviation of split frequencies: 0.012486
305500 -- [-389.873] (-390.535) (-393.941) (-396.502) * (-393.449) [-392.302] (-390.779) (-389.872) -- 0:00:40
306000 -- [-391.304] (-391.166) (-391.250) (-391.016) * (-391.799) (-389.623) (-392.399) [-389.884] -- 0:00:40
306500 -- (-394.335) [-389.676] (-390.310) (-389.372) * (-391.569) (-394.330) [-391.571] (-393.227) -- 0:00:40
307000 -- (-390.042) [-390.167] (-391.898) (-393.951) * [-391.471] (-391.548) (-392.282) (-393.578) -- 0:00:40
307500 -- (-389.752) (-394.147) [-393.845] (-392.030) * [-389.358] (-394.150) (-392.599) (-391.867) -- 0:00:40
308000 -- [-396.366] (-397.846) (-392.830) (-393.372) * [-391.883] (-391.803) (-392.251) (-389.395) -- 0:00:40
308500 -- (-391.579) [-393.682] (-389.573) (-393.303) * (-396.292) [-390.596] (-389.446) (-390.379) -- 0:00:40
309000 -- (-393.093) (-391.869) (-392.399) [-390.682] * (-391.317) (-393.173) (-390.793) [-390.493] -- 0:00:40
309500 -- (-393.762) (-390.723) [-397.299] (-390.077) * [-389.804] (-395.162) (-396.275) (-391.105) -- 0:00:40
310000 -- (-392.197) (-390.312) [-391.364] (-391.899) * (-390.375) (-391.401) [-395.104] (-390.701) -- 0:00:40
Average standard deviation of split frequencies: 0.013741
310500 -- [-390.181] (-391.592) (-392.848) (-392.437) * [-392.198] (-399.300) (-390.715) (-392.618) -- 0:00:42
311000 -- (-391.416) (-390.602) (-392.568) [-391.994] * [-390.135] (-392.963) (-395.912) (-391.601) -- 0:00:42
311500 -- (-389.519) (-392.080) (-390.328) [-390.282] * [-393.515] (-391.013) (-393.936) (-393.186) -- 0:00:41
312000 -- (-391.905) (-390.330) (-394.044) [-390.257] * (-394.083) (-390.550) (-391.201) [-389.591] -- 0:00:41
312500 -- (-390.864) [-390.914] (-392.651) (-390.185) * (-391.284) [-391.092] (-392.162) (-391.966) -- 0:00:41
313000 -- (-390.171) (-391.793) (-392.018) [-392.519] * (-391.501) (-391.336) (-395.824) [-394.052] -- 0:00:41
313500 -- (-393.948) (-396.754) (-392.737) [-391.089] * (-393.840) (-389.377) (-396.221) [-391.146] -- 0:00:41
314000 -- (-395.565) (-389.755) [-389.674] (-391.217) * (-391.964) (-391.093) [-393.953] (-390.615) -- 0:00:41
314500 -- [-393.520] (-390.740) (-389.791) (-391.647) * (-391.215) (-391.923) (-390.461) [-393.291] -- 0:00:41
315000 -- (-389.272) [-390.785] (-391.432) (-391.808) * (-395.924) (-391.709) (-389.911) [-389.231] -- 0:00:41
Average standard deviation of split frequencies: 0.012461
315500 -- (-391.197) [-390.228] (-391.875) (-392.199) * (-389.277) (-389.241) (-392.381) [-392.096] -- 0:00:41
316000 -- (-390.163) (-391.574) (-392.403) [-390.082] * (-390.150) (-389.148) [-394.339] (-390.414) -- 0:00:41
316500 -- [-389.157] (-389.518) (-394.681) (-391.617) * [-390.725] (-389.253) (-390.894) (-390.767) -- 0:00:41
317000 -- [-389.520] (-390.808) (-393.135) (-392.100) * (-391.274) [-393.054] (-389.615) (-393.050) -- 0:00:40
317500 -- [-391.342] (-390.126) (-389.268) (-391.874) * (-391.642) (-391.403) (-390.181) [-391.815] -- 0:00:40
318000 -- (-390.173) [-391.831] (-400.356) (-392.332) * [-392.955] (-394.138) (-394.945) (-392.662) -- 0:00:40
318500 -- (-391.245) (-392.214) (-394.353) [-390.854] * (-392.273) [-395.735] (-391.034) (-392.473) -- 0:00:40
319000 -- (-391.449) (-390.703) [-392.941] (-390.872) * (-391.999) (-389.921) (-389.789) [-391.208] -- 0:00:40
319500 -- (-392.020) [-392.077] (-389.940) (-389.257) * (-391.889) [-390.368] (-392.647) (-391.684) -- 0:00:40
320000 -- [-393.503] (-390.075) (-390.940) (-390.715) * (-391.923) (-389.762) [-389.356] (-391.634) -- 0:00:40
Average standard deviation of split frequencies: 0.012822
320500 -- (-393.832) (-391.055) [-392.948] (-390.827) * (-395.864) (-391.694) [-391.948] (-390.104) -- 0:00:40
321000 -- (-389.767) (-390.435) (-390.115) [-392.525] * [-389.946] (-389.832) (-392.412) (-396.577) -- 0:00:40
321500 -- (-391.823) (-389.244) [-392.243] (-389.759) * (-391.784) (-390.383) [-391.645] (-396.974) -- 0:00:40
322000 -- [-392.987] (-390.679) (-390.350) (-391.435) * (-390.683) [-391.083] (-391.494) (-393.016) -- 0:00:40
322500 -- (-394.338) (-392.006) [-393.016] (-389.448) * (-390.005) (-390.504) [-391.769] (-389.396) -- 0:00:39
323000 -- (-389.632) [-391.128] (-390.765) (-391.676) * (-390.979) (-394.872) [-391.399] (-390.310) -- 0:00:39
323500 -- (-391.257) (-390.078) (-392.126) [-391.010] * (-393.323) (-393.101) [-393.416] (-390.780) -- 0:00:39
324000 -- (-390.450) (-390.502) (-390.733) [-388.979] * (-390.844) (-393.586) [-391.300] (-395.383) -- 0:00:39
324500 -- [-391.303] (-391.677) (-390.904) (-391.872) * (-392.559) [-389.883] (-391.809) (-393.192) -- 0:00:39
325000 -- (-390.623) [-390.718] (-391.900) (-393.989) * (-395.785) [-391.710] (-391.351) (-389.253) -- 0:00:39
Average standard deviation of split frequencies: 0.011653
325500 -- (-390.126) (-389.897) [-394.363] (-390.918) * (-389.143) [-390.397] (-392.134) (-391.173) -- 0:00:39
326000 -- (-389.590) (-389.386) (-397.321) [-395.122] * (-391.609) (-391.467) [-391.750] (-390.402) -- 0:00:39
326500 -- [-391.660] (-392.019) (-393.219) (-390.774) * [-391.264] (-392.931) (-394.064) (-394.449) -- 0:00:39
327000 -- (-390.801) (-394.631) (-390.818) [-391.119] * (-394.028) (-393.665) (-391.985) [-392.430] -- 0:00:39
327500 -- (-391.539) [-389.411] (-391.605) (-391.437) * [-392.877] (-391.202) (-390.505) (-393.704) -- 0:00:41
328000 -- [-390.352] (-389.191) (-389.257) (-389.784) * [-394.251] (-390.401) (-392.080) (-390.453) -- 0:00:40
328500 -- [-390.857] (-393.198) (-394.177) (-391.604) * (-389.190) (-390.203) (-394.558) [-389.111] -- 0:00:40
329000 -- [-390.603] (-390.460) (-395.823) (-389.966) * [-389.205] (-392.410) (-392.799) (-390.815) -- 0:00:40
329500 -- (-389.936) (-390.887) [-391.437] (-390.922) * (-389.298) (-393.577) [-392.013] (-390.435) -- 0:00:40
330000 -- (-390.145) [-390.701] (-389.897) (-391.058) * (-393.245) [-391.814] (-395.336) (-394.156) -- 0:00:40
Average standard deviation of split frequencies: 0.011740
330500 -- (-390.669) (-389.441) [-390.466] (-395.623) * (-393.227) (-391.296) [-390.748] (-390.780) -- 0:00:40
331000 -- (-391.612) (-390.798) [-391.992] (-390.854) * [-389.194] (-391.912) (-390.296) (-389.820) -- 0:00:40
331500 -- (-395.043) (-389.961) (-396.907) [-390.549] * (-390.507) [-391.286] (-391.421) (-393.768) -- 0:00:40
332000 -- (-390.284) (-391.400) (-391.482) [-392.321] * (-394.135) [-390.172] (-389.650) (-392.386) -- 0:00:40
332500 -- (-390.652) (-391.422) (-389.397) [-393.505] * (-390.196) (-392.376) [-389.158] (-392.628) -- 0:00:40
333000 -- (-391.525) (-390.591) (-390.358) [-390.206] * (-393.511) [-390.928] (-391.691) (-390.696) -- 0:00:40
333500 -- (-393.460) (-391.132) [-389.761] (-392.447) * (-394.430) (-389.885) (-392.474) [-392.757] -- 0:00:39
334000 -- (-391.192) (-391.776) (-391.674) [-392.035] * (-394.428) (-390.432) [-391.757] (-394.405) -- 0:00:39
334500 -- (-389.490) [-390.199] (-390.405) (-395.322) * (-395.208) (-389.737) (-391.801) [-394.017] -- 0:00:39
335000 -- (-389.818) (-393.337) (-389.650) [-390.050] * (-389.523) (-390.392) (-392.784) [-389.851] -- 0:00:39
Average standard deviation of split frequencies: 0.011692
335500 -- (-392.600) (-390.499) (-390.715) [-390.599] * (-396.562) (-390.174) [-392.723] (-393.345) -- 0:00:39
336000 -- (-390.652) [-390.033] (-394.792) (-391.094) * (-391.963) [-391.189] (-391.695) (-390.613) -- 0:00:39
336500 -- (-389.856) [-392.052] (-391.451) (-389.462) * (-390.430) (-392.033) (-390.117) [-390.460] -- 0:00:39
337000 -- (-394.273) (-390.499) (-390.728) [-391.614] * (-390.186) [-390.237] (-390.599) (-391.063) -- 0:00:39
337500 -- (-394.015) [-392.790] (-391.056) (-392.873) * [-391.020] (-390.309) (-391.707) (-392.373) -- 0:00:39
338000 -- [-390.101] (-390.269) (-390.257) (-394.042) * (-390.789) (-391.843) [-392.451] (-391.320) -- 0:00:39
338500 -- [-389.696] (-390.388) (-392.423) (-390.742) * (-389.220) [-390.850] (-391.563) (-391.045) -- 0:00:39
339000 -- [-390.876] (-391.215) (-392.210) (-392.869) * (-389.948) (-395.698) (-391.998) [-390.093] -- 0:00:38
339500 -- (-389.733) (-390.931) (-393.669) [-391.219] * (-391.111) (-390.527) (-396.343) [-394.286] -- 0:00:38
340000 -- (-393.648) (-391.796) (-393.884) [-391.338] * [-390.651] (-391.813) (-391.801) (-392.337) -- 0:00:38
Average standard deviation of split frequencies: 0.012608
340500 -- (-391.793) [-391.144] (-391.395) (-391.983) * (-391.465) [-393.330] (-392.411) (-395.899) -- 0:00:38
341000 -- (-395.046) [-391.123] (-392.893) (-389.856) * [-391.539] (-389.857) (-391.622) (-392.164) -- 0:00:38
341500 -- (-391.043) [-391.046] (-391.412) (-391.035) * (-391.771) (-392.845) [-392.260] (-392.920) -- 0:00:38
342000 -- (-394.533) (-390.041) (-393.719) [-390.988] * (-389.135) (-391.371) [-397.630] (-390.897) -- 0:00:38
342500 -- (-393.876) (-391.125) (-390.382) [-391.503] * [-390.119] (-391.882) (-396.439) (-390.028) -- 0:00:38
343000 -- [-395.522] (-393.383) (-390.349) (-390.068) * (-394.369) [-391.600] (-389.515) (-398.001) -- 0:00:38
343500 -- (-395.358) (-391.908) [-390.242] (-390.132) * (-391.488) (-394.484) [-389.922] (-389.814) -- 0:00:38
344000 -- [-390.947] (-391.638) (-393.425) (-392.316) * (-391.508) [-391.715] (-390.718) (-394.670) -- 0:00:38
344500 -- [-394.096] (-393.850) (-394.187) (-391.885) * (-390.883) [-390.145] (-390.476) (-389.955) -- 0:00:39
345000 -- (-390.740) (-392.503) (-392.224) [-389.653] * (-394.389) [-390.520] (-392.235) (-393.547) -- 0:00:39
Average standard deviation of split frequencies: 0.012792
345500 -- (-389.288) (-396.791) (-393.112) [-392.899] * (-395.083) [-389.847] (-392.629) (-389.517) -- 0:00:39
346000 -- [-391.358] (-391.502) (-392.394) (-392.143) * (-392.604) (-390.854) [-394.133] (-394.844) -- 0:00:39
346500 -- (-391.552) [-391.166] (-392.332) (-391.325) * (-389.880) [-395.021] (-394.335) (-392.861) -- 0:00:39
347000 -- (-391.992) (-390.832) (-390.660) [-392.191] * (-390.702) [-390.130] (-390.862) (-390.837) -- 0:00:39
347500 -- (-390.952) (-395.081) (-394.651) [-390.507] * (-391.660) (-391.537) [-390.945] (-391.722) -- 0:00:39
348000 -- (-391.880) (-393.250) (-393.839) [-392.578] * (-391.490) [-389.949] (-390.150) (-391.000) -- 0:00:39
348500 -- [-392.004] (-392.853) (-392.363) (-398.618) * (-389.871) [-389.973] (-391.753) (-389.202) -- 0:00:39
349000 -- [-393.948] (-390.530) (-389.879) (-390.985) * (-389.978) [-389.539] (-395.294) (-390.408) -- 0:00:39
349500 -- (-390.017) [-389.959] (-390.436) (-390.009) * (-389.677) [-391.480] (-393.317) (-393.913) -- 0:00:39
350000 -- [-390.681] (-389.937) (-394.016) (-389.476) * (-392.459) (-390.216) (-397.056) [-391.402] -- 0:00:39
Average standard deviation of split frequencies: 0.012877
350500 -- (-393.434) (-390.459) [-390.684] (-389.992) * (-391.493) (-391.546) (-392.053) [-389.014] -- 0:00:38
351000 -- (-394.084) (-390.327) [-395.680] (-393.604) * (-391.169) [-390.546] (-392.382) (-390.581) -- 0:00:38
351500 -- (-391.993) [-391.159] (-393.361) (-392.751) * [-390.325] (-393.174) (-391.742) (-389.143) -- 0:00:38
352000 -- (-390.320) (-391.575) [-392.311] (-393.192) * (-390.149) [-391.668] (-389.293) (-389.224) -- 0:00:38
352500 -- [-389.520] (-397.194) (-395.024) (-393.558) * (-389.246) (-392.685) [-390.381] (-394.162) -- 0:00:38
353000 -- (-390.628) (-393.689) (-393.722) [-393.614] * (-390.383) (-393.129) (-393.637) [-390.149] -- 0:00:38
353500 -- (-390.734) (-390.954) (-394.785) [-392.051] * [-390.549] (-392.676) (-390.375) (-393.827) -- 0:00:38
354000 -- [-390.414] (-395.486) (-397.001) (-389.544) * [-391.432] (-393.541) (-389.497) (-390.973) -- 0:00:38
354500 -- (-392.052) (-393.096) [-392.324] (-390.532) * (-393.130) [-392.935] (-389.019) (-395.957) -- 0:00:38
355000 -- (-392.141) (-390.790) (-389.406) [-389.364] * [-391.951] (-392.519) (-390.724) (-394.588) -- 0:00:38
Average standard deviation of split frequencies: 0.012506
355500 -- (-389.779) (-391.169) (-393.144) [-390.700] * (-395.440) (-390.834) (-390.930) [-392.536] -- 0:00:38
356000 -- (-392.614) (-389.705) (-393.268) [-391.397] * (-390.808) [-395.417] (-391.258) (-390.094) -- 0:00:37
356500 -- (-392.359) (-391.649) [-392.162] (-390.941) * (-393.581) [-390.094] (-393.794) (-390.981) -- 0:00:37
357000 -- (-389.907) [-390.610] (-390.343) (-390.674) * (-389.222) (-392.020) (-391.269) [-391.356] -- 0:00:37
357500 -- [-389.926] (-390.112) (-390.859) (-389.735) * [-390.061] (-391.444) (-390.347) (-392.694) -- 0:00:37
358000 -- (-392.916) (-390.730) [-390.856] (-394.435) * (-391.276) [-392.332] (-390.917) (-393.836) -- 0:00:37
358500 -- (-392.344) [-393.066] (-392.013) (-393.942) * (-390.501) (-390.219) (-390.459) [-394.470] -- 0:00:37
359000 -- (-391.384) (-390.311) [-395.178] (-390.805) * (-395.726) (-393.656) (-389.981) [-392.028] -- 0:00:37
359500 -- [-391.456] (-392.471) (-393.710) (-391.672) * (-391.343) [-395.745] (-392.371) (-391.209) -- 0:00:37
360000 -- (-389.551) [-391.867] (-389.363) (-390.414) * (-393.796) [-394.687] (-392.361) (-391.040) -- 0:00:37
Average standard deviation of split frequencies: 0.012107
360500 -- [-389.922] (-390.263) (-391.092) (-390.558) * (-390.230) (-393.368) (-390.907) [-392.834] -- 0:00:37
361000 -- [-390.648] (-389.149) (-394.519) (-392.006) * [-392.292] (-392.816) (-391.476) (-389.401) -- 0:00:37
361500 -- [-393.399] (-390.878) (-393.245) (-391.757) * (-390.138) [-390.978] (-394.292) (-390.322) -- 0:00:38
362000 -- [-389.514] (-393.760) (-389.507) (-391.040) * [-390.287] (-392.801) (-392.474) (-391.336) -- 0:00:38
362500 -- (-394.769) (-389.831) (-391.714) [-389.914] * [-390.548] (-392.195) (-390.525) (-394.894) -- 0:00:38
363000 -- (-394.937) (-389.900) [-389.333] (-391.044) * (-391.042) [-389.765] (-394.191) (-398.626) -- 0:00:38
363500 -- (-391.214) (-390.936) [-390.197] (-391.874) * [-393.313] (-391.110) (-394.245) (-392.483) -- 0:00:38
364000 -- (-390.950) (-390.555) [-394.046] (-390.089) * [-390.680] (-391.456) (-392.576) (-390.196) -- 0:00:38
364500 -- (-390.635) (-392.745) (-389.133) [-391.475] * [-391.414] (-392.901) (-394.862) (-389.371) -- 0:00:38
365000 -- (-392.989) [-391.724] (-394.557) (-393.810) * (-392.502) (-392.218) (-389.909) [-390.307] -- 0:00:38
Average standard deviation of split frequencies: 0.012737
365500 -- (-393.037) (-389.598) [-391.202] (-391.922) * (-391.967) (-390.551) (-393.158) [-392.363] -- 0:00:38
366000 -- (-391.583) (-391.276) (-393.431) [-391.984] * (-390.670) (-390.324) [-392.555] (-392.737) -- 0:00:38
366500 -- (-393.767) (-392.045) (-389.443) [-393.858] * (-390.018) [-390.716] (-390.982) (-392.520) -- 0:00:38
367000 -- (-389.928) (-394.137) [-389.982] (-391.448) * (-394.624) (-391.579) (-393.647) [-391.758] -- 0:00:37
367500 -- (-391.625) [-390.062] (-389.975) (-394.507) * (-391.464) (-392.471) [-390.429] (-390.835) -- 0:00:37
368000 -- (-391.197) (-390.121) [-392.497] (-392.161) * (-394.200) (-393.175) (-398.452) [-395.632] -- 0:00:37
368500 -- (-393.326) [-391.959] (-390.451) (-390.591) * (-390.517) [-392.025] (-393.268) (-390.299) -- 0:00:37
369000 -- [-390.257] (-390.989) (-392.675) (-390.683) * (-389.097) (-389.879) [-391.581] (-393.471) -- 0:00:37
369500 -- (-391.501) (-393.743) [-394.122] (-393.916) * (-393.423) (-390.683) [-392.728] (-394.269) -- 0:00:37
370000 -- (-390.964) (-391.623) (-390.137) [-390.703] * (-392.754) (-392.344) (-390.775) [-391.883] -- 0:00:37
Average standard deviation of split frequencies: 0.013283
370500 -- (-394.681) (-391.709) [-391.266] (-390.882) * [-391.476] (-390.645) (-392.558) (-390.985) -- 0:00:37
371000 -- [-390.602] (-391.288) (-391.663) (-390.011) * (-392.469) (-389.647) [-392.827] (-392.699) -- 0:00:37
371500 -- (-390.896) (-390.439) (-392.070) [-389.253] * (-392.793) [-389.873] (-394.861) (-393.894) -- 0:00:37
372000 -- [-392.556] (-390.792) (-397.745) (-389.801) * (-396.753) (-394.326) [-391.880] (-391.864) -- 0:00:37
372500 -- [-391.322] (-391.875) (-391.302) (-394.774) * [-391.370] (-390.130) (-389.478) (-390.322) -- 0:00:37
373000 -- [-390.407] (-390.176) (-392.408) (-390.711) * (-392.056) (-390.902) [-390.742] (-390.692) -- 0:00:36
373500 -- (-390.802) (-391.558) (-389.885) [-390.343] * (-390.672) [-391.214] (-390.697) (-392.030) -- 0:00:36
374000 -- (-391.001) (-390.169) (-390.384) [-390.078] * (-389.874) (-394.309) (-392.790) [-390.861] -- 0:00:36
374500 -- (-391.067) (-390.198) [-390.059] (-393.529) * [-389.589] (-393.332) (-392.191) (-391.449) -- 0:00:36
375000 -- (-391.088) (-391.776) (-390.486) [-395.673] * (-389.736) (-390.290) (-395.750) [-390.859] -- 0:00:36
Average standard deviation of split frequencies: 0.013304
375500 -- (-393.148) (-390.971) [-390.895] (-393.376) * (-390.634) [-391.639] (-391.815) (-390.945) -- 0:00:36
376000 -- (-390.692) (-389.387) (-394.513) [-390.384] * [-392.361] (-391.766) (-390.810) (-391.418) -- 0:00:36
376500 -- (-390.087) [-391.118] (-391.088) (-390.453) * (-393.847) (-390.310) [-391.703] (-397.603) -- 0:00:36
377000 -- [-389.704] (-391.537) (-389.806) (-391.254) * (-392.078) (-391.259) (-391.340) [-392.528] -- 0:00:36
377500 -- [-392.877] (-393.545) (-389.132) (-391.108) * (-392.458) [-394.603] (-390.990) (-391.768) -- 0:00:36
378000 -- (-392.114) (-389.769) [-390.639] (-392.852) * [-390.643] (-390.353) (-389.930) (-392.344) -- 0:00:36
378500 -- [-391.439] (-391.396) (-392.482) (-396.371) * [-392.247] (-390.165) (-390.492) (-391.295) -- 0:00:37
379000 -- (-388.895) (-393.307) [-392.762] (-390.587) * [-392.373] (-392.819) (-391.429) (-390.360) -- 0:00:37
379500 -- (-389.734) (-392.689) (-391.951) [-393.176] * (-391.519) (-391.539) (-389.295) [-392.174] -- 0:00:37
380000 -- [-389.818] (-391.475) (-390.047) (-392.896) * (-390.934) (-392.372) (-390.466) [-391.580] -- 0:00:37
Average standard deviation of split frequencies: 0.012384
380500 -- (-389.758) (-390.021) [-389.189] (-390.242) * (-394.205) (-394.908) [-390.412] (-390.171) -- 0:00:37
381000 -- (-393.542) (-390.352) [-391.941] (-391.124) * (-390.343) (-394.694) [-391.083] (-395.533) -- 0:00:37
381500 -- (-389.738) (-390.583) (-393.490) [-390.380] * (-392.885) (-390.016) (-392.403) [-390.546] -- 0:00:37
382000 -- (-390.999) [-391.731] (-394.894) (-392.189) * [-390.009] (-390.673) (-390.008) (-391.445) -- 0:00:37
382500 -- (-393.408) [-389.662] (-393.911) (-392.308) * (-389.634) (-390.078) [-391.894] (-391.293) -- 0:00:37
383000 -- (-391.314) (-390.725) (-393.294) [-391.200] * (-389.051) (-393.676) [-392.502] (-394.202) -- 0:00:37
383500 -- [-390.492] (-391.090) (-392.172) (-392.533) * (-390.165) (-390.122) [-390.167] (-392.400) -- 0:00:36
384000 -- (-390.120) (-390.145) [-389.808] (-389.189) * (-391.300) (-392.557) (-391.793) [-389.731] -- 0:00:36
384500 -- (-389.466) [-391.020] (-390.435) (-390.344) * (-393.051) (-392.931) [-392.283] (-390.516) -- 0:00:36
385000 -- [-389.871] (-390.726) (-393.159) (-391.896) * [-390.475] (-392.501) (-394.779) (-390.908) -- 0:00:36
Average standard deviation of split frequencies: 0.012552
385500 -- [-391.584] (-391.745) (-394.316) (-392.439) * (-396.916) (-391.920) (-390.977) [-389.290] -- 0:00:36
386000 -- (-390.084) [-390.108] (-392.819) (-395.972) * [-389.782] (-389.428) (-390.464) (-389.528) -- 0:00:36
386500 -- [-389.438] (-392.584) (-396.175) (-393.111) * (-390.685) (-392.334) (-393.334) [-393.714] -- 0:00:36
387000 -- (-389.773) [-391.852] (-393.143) (-390.535) * [-390.864] (-392.905) (-391.927) (-391.711) -- 0:00:36
387500 -- (-389.844) (-390.620) [-393.581] (-392.625) * (-390.802) (-392.775) (-390.973) [-389.706] -- 0:00:36
388000 -- (-391.032) [-390.383] (-390.985) (-392.614) * (-390.497) (-389.166) (-393.518) [-391.976] -- 0:00:36
388500 -- (-390.414) [-391.478] (-391.086) (-390.227) * [-392.357] (-390.521) (-393.644) (-392.321) -- 0:00:36
389000 -- [-390.924] (-390.945) (-391.712) (-389.066) * (-390.787) (-389.370) (-394.039) [-391.997] -- 0:00:36
389500 -- (-390.959) (-393.782) (-392.100) [-390.678] * (-390.292) [-393.522] (-390.686) (-389.301) -- 0:00:36
390000 -- (-390.631) [-390.039] (-393.350) (-390.374) * (-390.400) (-391.412) [-395.022] (-390.639) -- 0:00:35
Average standard deviation of split frequencies: 0.012603
390500 -- (-390.728) (-390.037) (-390.477) [-390.814] * [-389.757] (-390.689) (-390.644) (-393.041) -- 0:00:35
391000 -- (-394.952) (-393.596) [-392.852] (-391.127) * (-390.767) [-390.597] (-393.900) (-397.551) -- 0:00:35
391500 -- (-393.246) [-392.465] (-391.303) (-394.999) * (-390.417) [-390.249] (-394.637) (-394.411) -- 0:00:35
392000 -- [-394.945] (-390.961) (-392.290) (-393.400) * [-390.788] (-394.405) (-392.945) (-393.197) -- 0:00:35
392500 -- (-391.737) (-392.443) [-389.882] (-392.736) * (-392.049) [-392.576] (-392.637) (-390.242) -- 0:00:35
393000 -- (-390.927) (-392.353) [-389.812] (-392.482) * (-389.725) (-390.516) (-392.303) [-392.256] -- 0:00:35
393500 -- (-393.212) (-391.460) (-389.343) [-392.326] * (-392.294) (-394.480) [-392.593] (-398.128) -- 0:00:35
394000 -- (-391.167) (-391.361) [-389.988] (-391.873) * (-392.003) [-392.137] (-395.094) (-396.675) -- 0:00:35
394500 -- (-392.826) [-390.716] (-389.736) (-392.069) * (-389.415) [-396.690] (-390.702) (-394.730) -- 0:00:35
395000 -- [-392.605] (-392.363) (-390.916) (-394.132) * (-391.691) (-390.289) [-390.825] (-390.993) -- 0:00:35
Average standard deviation of split frequencies: 0.011640
395500 -- (-390.217) [-390.733] (-392.348) (-392.639) * (-392.418) (-389.457) (-392.085) [-392.074] -- 0:00:36
396000 -- (-390.642) (-390.998) (-390.610) [-389.222] * (-398.552) [-390.856] (-394.177) (-390.192) -- 0:00:36
396500 -- (-391.567) (-392.518) [-390.915] (-391.319) * (-390.808) (-390.184) [-391.868] (-389.215) -- 0:00:36
397000 -- [-394.252] (-392.999) (-390.811) (-391.450) * (-393.436) (-391.082) [-390.339] (-390.132) -- 0:00:36
397500 -- (-390.880) [-391.493] (-392.716) (-394.236) * [-392.240] (-392.639) (-389.808) (-390.355) -- 0:00:36
398000 -- (-395.913) [-391.415] (-391.094) (-390.311) * (-391.367) [-391.417] (-391.495) (-389.484) -- 0:00:36
398500 -- (-392.448) (-390.351) (-395.153) [-390.337] * (-394.805) (-395.733) [-392.272] (-391.542) -- 0:00:36
399000 -- (-389.922) [-389.998] (-391.256) (-389.395) * [-391.532] (-396.422) (-389.723) (-396.747) -- 0:00:36
399500 -- (-391.988) (-394.722) [-392.507] (-395.048) * (-389.910) [-392.707] (-392.186) (-397.693) -- 0:00:36
400000 -- (-390.617) [-391.829] (-393.212) (-391.113) * (-391.672) (-393.147) (-391.288) [-390.204] -- 0:00:36
Average standard deviation of split frequencies: 0.013457
400500 -- (-392.227) (-392.717) (-390.725) [-390.204] * (-390.444) (-391.821) [-389.379] (-390.326) -- 0:00:35
401000 -- (-391.874) (-392.375) (-390.819) [-395.986] * (-396.249) (-391.262) (-390.806) [-389.584] -- 0:00:35
401500 -- (-391.603) [-394.347] (-390.189) (-392.935) * (-394.830) (-391.875) (-389.977) [-389.572] -- 0:00:35
402000 -- [-390.405] (-390.317) (-393.239) (-390.708) * (-390.802) (-391.380) (-391.214) [-389.650] -- 0:00:35
402500 -- (-390.325) (-391.023) (-392.803) [-392.091] * (-390.892) (-389.921) (-390.948) [-392.764] -- 0:00:35
403000 -- (-390.225) (-390.518) [-391.155] (-395.950) * (-395.273) (-394.282) (-393.040) [-391.952] -- 0:00:35
403500 -- (-391.937) (-395.431) (-391.571) [-394.650] * (-394.218) (-390.848) [-389.535] (-391.158) -- 0:00:35
404000 -- (-392.323) [-390.555] (-394.528) (-392.390) * (-393.756) [-391.535] (-389.413) (-390.022) -- 0:00:35
404500 -- (-393.669) (-390.418) (-392.698) [-391.598] * [-393.816] (-395.368) (-393.917) (-390.104) -- 0:00:35
405000 -- [-390.530] (-390.103) (-390.966) (-394.812) * (-394.831) (-389.402) [-396.068] (-390.476) -- 0:00:35
Average standard deviation of split frequencies: 0.013135
405500 -- (-390.187) [-394.132] (-395.876) (-390.026) * (-391.240) (-392.793) [-394.656] (-392.278) -- 0:00:35
406000 -- (-390.535) (-391.620) (-392.146) [-394.085] * (-390.936) (-390.645) [-392.709] (-393.040) -- 0:00:35
406500 -- (-389.983) (-393.238) [-390.174] (-392.742) * (-391.533) (-391.856) [-391.301] (-390.784) -- 0:00:35
407000 -- (-393.480) (-394.835) [-391.393] (-391.353) * [-390.168] (-389.632) (-390.280) (-391.293) -- 0:00:34
407500 -- (-390.208) [-393.112] (-395.239) (-389.867) * (-392.475) (-392.850) [-390.391] (-391.846) -- 0:00:34
408000 -- (-390.714) (-391.328) (-394.423) [-393.303] * [-392.530] (-393.154) (-390.464) (-391.074) -- 0:00:34
408500 -- (-392.823) (-390.967) (-397.095) [-390.619] * [-390.672] (-390.968) (-391.727) (-392.577) -- 0:00:34
409000 -- [-393.147] (-391.667) (-390.592) (-391.589) * (-398.649) [-393.756] (-394.456) (-392.097) -- 0:00:34
409500 -- (-395.358) (-390.735) (-393.756) [-391.282] * (-391.862) (-392.054) [-394.641] (-390.265) -- 0:00:34
410000 -- (-392.960) (-391.420) [-390.654] (-395.302) * (-390.653) (-391.372) (-391.970) [-389.130] -- 0:00:34
Average standard deviation of split frequencies: 0.012627
410500 -- (-391.737) [-391.447] (-391.308) (-390.306) * (-389.713) [-390.069] (-390.555) (-389.980) -- 0:00:34
411000 -- (-392.217) (-390.217) (-390.309) [-392.952] * (-393.579) [-389.475] (-390.690) (-392.295) -- 0:00:34
411500 -- (-390.537) (-392.867) [-391.934] (-392.311) * (-391.254) (-389.493) [-390.006] (-390.243) -- 0:00:34
412000 -- (-396.160) (-390.367) (-390.040) [-389.474] * [-391.494] (-391.436) (-390.226) (-392.253) -- 0:00:34
412500 -- (-392.641) (-394.191) (-389.810) [-390.461] * [-390.704] (-394.024) (-392.886) (-392.792) -- 0:00:35
413000 -- (-392.138) (-395.189) (-392.597) [-392.249] * (-392.067) [-389.954] (-389.786) (-394.601) -- 0:00:35
413500 -- (-391.457) [-391.800] (-392.644) (-389.306) * [-391.830] (-393.244) (-391.977) (-390.242) -- 0:00:35
414000 -- (-391.689) (-391.228) [-389.961] (-389.169) * (-392.047) [-395.175] (-392.904) (-390.884) -- 0:00:35
414500 -- [-391.088] (-390.296) (-390.815) (-391.773) * (-394.943) (-389.778) (-392.235) [-393.300] -- 0:00:35
415000 -- (-390.862) (-390.751) (-390.117) [-397.276] * (-391.236) (-394.773) (-395.063) [-389.995] -- 0:00:35
Average standard deviation of split frequencies: 0.012253
415500 -- (-391.798) (-390.964) [-389.814] (-395.831) * [-393.486] (-391.935) (-396.206) (-389.693) -- 0:00:35
416000 -- (-391.376) [-393.522] (-389.787) (-391.665) * (-398.537) (-389.472) [-392.031] (-391.126) -- 0:00:35
416500 -- (-389.985) [-392.181] (-392.255) (-393.016) * (-391.928) [-390.075] (-397.371) (-392.248) -- 0:00:35
417000 -- (-392.193) (-392.998) (-392.881) [-392.134] * [-398.918] (-390.372) (-394.911) (-390.218) -- 0:00:34
417500 -- (-394.490) (-391.061) (-392.626) [-389.844] * [-390.392] (-392.820) (-390.093) (-394.183) -- 0:00:34
418000 -- (-391.956) (-392.145) [-389.927] (-390.699) * (-393.230) (-398.734) (-392.160) [-389.268] -- 0:00:34
418500 -- (-393.976) [-389.315] (-394.646) (-389.941) * (-391.145) [-390.847] (-389.963) (-388.994) -- 0:00:34
419000 -- [-393.056] (-390.850) (-393.475) (-394.375) * (-390.501) [-392.540] (-390.686) (-391.392) -- 0:00:34
419500 -- (-391.203) (-393.263) (-390.791) [-393.321] * [-390.725] (-393.115) (-390.211) (-391.166) -- 0:00:34
420000 -- (-394.398) (-391.315) [-390.945] (-390.647) * [-389.819] (-392.942) (-395.309) (-392.248) -- 0:00:34
Average standard deviation of split frequencies: 0.010926
420500 -- (-391.508) [-389.570] (-391.856) (-392.095) * (-391.237) (-390.419) [-394.466] (-397.453) -- 0:00:34
421000 -- (-390.216) (-391.398) [-389.546] (-389.366) * (-395.937) (-390.024) [-393.577] (-391.493) -- 0:00:34
421500 -- (-390.312) (-389.673) [-390.101] (-392.826) * (-392.898) (-390.208) [-391.089] (-393.222) -- 0:00:34
422000 -- (-392.020) (-388.985) (-391.033) [-393.867] * [-389.907] (-395.140) (-389.912) (-394.092) -- 0:00:34
422500 -- (-395.870) [-390.404] (-391.758) (-394.876) * (-391.790) (-396.621) [-389.496] (-393.698) -- 0:00:34
423000 -- (-390.099) [-389.600] (-390.275) (-389.429) * (-393.604) [-391.912] (-389.693) (-390.932) -- 0:00:34
423500 -- (-391.254) [-391.301] (-391.971) (-390.726) * (-394.003) (-393.417) [-390.384] (-389.714) -- 0:00:34
424000 -- [-390.309] (-396.105) (-392.466) (-395.074) * (-389.741) (-393.203) (-391.346) [-390.051] -- 0:00:33
424500 -- [-391.455] (-389.452) (-391.097) (-394.535) * (-396.769) [-392.564] (-390.935) (-389.393) -- 0:00:33
425000 -- [-391.057] (-389.984) (-390.315) (-390.855) * [-392.785] (-389.434) (-392.663) (-389.941) -- 0:00:33
Average standard deviation of split frequencies: 0.010285
425500 -- (-392.355) (-390.655) [-391.217] (-389.460) * (-392.329) (-389.929) (-389.710) [-390.016] -- 0:00:33
426000 -- (-390.239) [-392.548] (-394.834) (-389.550) * (-394.827) [-393.884] (-391.002) (-390.349) -- 0:00:33
426500 -- (-389.877) (-389.518) (-390.770) [-390.574] * (-396.433) [-394.123] (-390.913) (-390.724) -- 0:00:33
427000 -- (-391.086) [-390.302] (-390.039) (-389.515) * (-390.789) (-395.640) (-391.909) [-392.119] -- 0:00:33
427500 -- (-390.391) (-390.558) (-389.241) [-390.054] * (-391.640) (-398.004) [-390.144] (-390.068) -- 0:00:33
428000 -- [-390.279] (-389.724) (-391.211) (-389.866) * (-392.317) (-390.905) [-391.419] (-390.422) -- 0:00:33
428500 -- (-390.398) [-390.701] (-395.618) (-391.971) * [-389.192] (-393.336) (-390.038) (-393.899) -- 0:00:33
429000 -- [-390.052] (-390.604) (-392.873) (-389.962) * [-390.770] (-392.290) (-392.896) (-393.684) -- 0:00:33
429500 -- (-390.491) (-394.613) (-393.111) [-390.396] * (-390.561) (-392.734) [-392.099] (-393.150) -- 0:00:34
430000 -- (-390.437) (-395.712) (-389.812) [-390.002] * (-389.385) (-393.337) [-389.264] (-391.911) -- 0:00:34
Average standard deviation of split frequencies: 0.009980
430500 -- (-390.905) (-392.420) [-390.130] (-393.653) * (-391.065) (-393.418) [-389.775] (-391.974) -- 0:00:34
431000 -- (-393.061) [-389.837] (-389.868) (-392.201) * (-393.145) [-392.619] (-393.465) (-390.690) -- 0:00:34
431500 -- (-393.257) (-391.361) (-391.911) [-391.705] * (-390.109) (-392.453) (-389.168) [-390.409] -- 0:00:34
432000 -- (-394.776) [-389.865] (-390.013) (-396.337) * (-394.256) [-392.041] (-390.364) (-388.927) -- 0:00:34
432500 -- (-391.557) (-392.126) [-390.778] (-390.223) * (-392.001) [-390.854] (-391.429) (-392.337) -- 0:00:34
433000 -- (-390.432) (-389.850) [-392.221] (-393.153) * (-389.638) (-389.864) (-394.365) [-389.751] -- 0:00:34
433500 -- (-394.273) (-390.117) (-389.841) [-390.522] * (-389.690) (-392.718) (-394.601) [-390.163] -- 0:00:33
434000 -- (-390.467) [-389.892] (-390.983) (-389.687) * (-393.101) (-391.185) [-392.693] (-391.466) -- 0:00:33
434500 -- (-391.514) [-390.870] (-392.106) (-391.568) * (-391.540) [-391.832] (-390.888) (-390.997) -- 0:00:33
435000 -- (-390.812) (-390.027) (-394.426) [-394.125] * (-391.876) (-390.370) [-391.552] (-391.310) -- 0:00:33
Average standard deviation of split frequencies: 0.010112
435500 -- (-391.795) (-394.348) [-390.046] (-390.111) * (-394.271) (-392.888) [-392.492] (-391.842) -- 0:00:33
436000 -- (-392.109) (-390.279) [-390.213] (-390.112) * (-390.704) (-394.899) (-396.860) [-392.632] -- 0:00:33
436500 -- (-389.394) [-392.348] (-393.051) (-391.311) * [-396.218] (-392.197) (-393.614) (-393.202) -- 0:00:33
437000 -- (-390.648) (-392.750) (-390.710) [-394.106] * (-394.870) (-390.473) (-391.590) [-389.300] -- 0:00:33
437500 -- [-390.450] (-395.536) (-395.557) (-398.962) * [-392.432] (-389.702) (-394.094) (-393.401) -- 0:00:33
438000 -- (-390.608) (-392.682) (-391.141) [-390.519] * (-390.656) (-390.426) [-390.847] (-390.670) -- 0:00:33
438500 -- (-390.219) [-390.358] (-391.223) (-393.128) * (-390.263) (-390.074) [-389.721] (-392.477) -- 0:00:33
439000 -- (-390.162) [-390.005] (-390.562) (-394.097) * (-394.333) (-389.642) [-390.092] (-398.597) -- 0:00:33
439500 -- (-390.968) (-389.736) (-390.695) [-400.748] * (-392.639) [-392.597] (-389.503) (-391.291) -- 0:00:33
440000 -- (-390.858) [-389.337] (-395.779) (-389.901) * (-391.539) (-391.168) (-390.482) [-390.512] -- 0:00:33
Average standard deviation of split frequencies: 0.010631
440500 -- [-392.355] (-390.738) (-396.939) (-393.882) * (-390.128) (-391.828) [-391.793] (-394.734) -- 0:00:33
441000 -- (-391.614) (-392.010) [-392.752] (-389.993) * (-391.664) (-390.905) (-395.089) [-389.105] -- 0:00:32
441500 -- (-397.657) [-390.747] (-390.850) (-390.321) * (-390.229) [-396.343] (-392.595) (-388.930) -- 0:00:32
442000 -- (-396.663) [-390.188] (-393.930) (-391.124) * (-390.962) (-390.532) (-389.634) [-389.542] -- 0:00:32
442500 -- (-394.631) (-389.685) [-392.376] (-389.961) * [-390.399] (-390.394) (-391.297) (-391.172) -- 0:00:32
443000 -- (-397.983) (-390.045) [-391.359] (-391.418) * (-390.343) [-390.747] (-394.202) (-393.626) -- 0:00:32
443500 -- (-393.859) (-389.334) (-396.759) [-394.968] * [-391.430] (-391.424) (-390.423) (-394.401) -- 0:00:32
444000 -- [-397.444] (-395.663) (-390.640) (-390.961) * (-391.504) (-392.667) [-390.602] (-391.882) -- 0:00:32
444500 -- [-397.376] (-397.395) (-399.793) (-392.189) * (-394.086) [-389.758] (-394.010) (-391.003) -- 0:00:32
445000 -- (-395.148) (-397.381) (-392.026) [-392.391] * (-390.607) (-389.965) [-391.866] (-390.284) -- 0:00:32
Average standard deviation of split frequencies: 0.010694
445500 -- (-390.966) (-396.627) [-391.941] (-393.872) * (-389.053) (-390.405) (-393.693) [-391.408] -- 0:00:32
446000 -- [-391.114] (-392.039) (-393.462) (-390.615) * (-389.926) (-390.759) (-391.403) [-391.169] -- 0:00:33
446500 -- (-391.000) (-394.330) (-395.008) [-390.483] * (-390.659) (-392.184) (-390.794) [-391.107] -- 0:00:33
447000 -- (-389.639) (-396.027) [-392.550] (-389.862) * (-393.471) (-393.158) (-392.564) [-392.207] -- 0:00:33
447500 -- (-390.640) [-395.672] (-389.767) (-392.063) * (-394.277) (-391.848) [-392.052] (-391.601) -- 0:00:33
448000 -- (-390.518) (-393.080) (-392.359) [-390.207] * (-392.039) (-395.199) (-391.699) [-390.202] -- 0:00:33
448500 -- (-392.834) (-394.140) [-393.297] (-389.387) * (-390.506) [-391.353] (-389.639) (-393.313) -- 0:00:33
449000 -- [-391.012] (-390.958) (-393.727) (-390.510) * (-390.410) [-390.838] (-389.889) (-390.469) -- 0:00:33
449500 -- (-395.320) (-391.969) (-391.213) [-390.221] * (-392.254) (-393.181) (-391.572) [-390.066] -- 0:00:33
450000 -- (-390.344) (-392.413) [-391.462] (-393.961) * (-395.349) (-390.004) (-390.943) [-393.509] -- 0:00:33
Average standard deviation of split frequencies: 0.011049
450500 -- (-390.711) (-391.688) (-390.406) [-390.119] * (-391.907) [-391.966] (-390.024) (-390.756) -- 0:00:32
451000 -- (-393.045) (-393.095) [-390.016] (-389.354) * (-391.694) (-391.406) [-393.654] (-390.925) -- 0:00:32
451500 -- (-389.513) (-389.848) (-390.403) [-391.345] * [-393.822] (-392.404) (-393.298) (-390.310) -- 0:00:32
452000 -- (-392.771) (-390.601) (-392.639) [-389.682] * (-389.227) (-389.180) (-395.633) [-390.850] -- 0:00:32
452500 -- (-393.276) (-391.463) (-392.520) [-390.194] * [-393.945] (-390.671) (-393.508) (-392.016) -- 0:00:32
453000 -- (-391.544) [-393.330] (-393.757) (-389.688) * (-395.383) (-389.816) [-390.262] (-390.396) -- 0:00:32
453500 -- (-391.093) [-391.298] (-390.928) (-389.724) * (-391.678) (-390.177) [-391.329] (-389.548) -- 0:00:32
454000 -- (-390.997) (-392.824) (-392.716) [-390.071] * [-391.782] (-392.670) (-389.941) (-391.505) -- 0:00:32
454500 -- (-395.337) (-390.183) [-390.655] (-392.927) * (-393.507) (-390.059) (-393.542) [-389.894] -- 0:00:32
455000 -- (-389.948) (-390.815) (-391.194) [-390.339] * (-393.630) [-390.958] (-389.255) (-390.004) -- 0:00:32
Average standard deviation of split frequencies: 0.010144
455500 -- (-392.841) [-391.872] (-392.483) (-389.976) * (-395.695) [-391.358] (-389.342) (-390.035) -- 0:00:32
456000 -- (-394.987) [-394.477] (-397.596) (-390.629) * [-391.568] (-391.679) (-390.167) (-395.060) -- 0:00:32
456500 -- (-392.926) (-391.224) (-389.578) [-393.983] * [-389.367] (-392.667) (-394.655) (-395.526) -- 0:00:32
457000 -- (-391.902) (-392.374) (-390.641) [-392.221] * (-394.757) [-392.049] (-390.976) (-392.225) -- 0:00:32
457500 -- [-390.646] (-393.249) (-392.996) (-389.479) * (-390.508) (-389.458) (-390.385) [-391.188] -- 0:00:32
458000 -- [-391.690] (-392.138) (-391.674) (-390.936) * (-391.568) (-392.859) [-395.272] (-393.068) -- 0:00:31
458500 -- (-395.811) (-393.716) (-391.678) [-393.276] * [-394.318] (-392.602) (-392.613) (-391.389) -- 0:00:31
459000 -- [-392.780] (-391.132) (-393.379) (-390.898) * (-391.267) [-394.771] (-392.292) (-389.880) -- 0:00:31
459500 -- (-391.430) [-389.885] (-390.152) (-389.777) * (-391.299) [-390.782] (-392.638) (-390.558) -- 0:00:31
460000 -- (-394.710) [-389.752] (-393.270) (-391.414) * (-392.201) (-389.059) (-396.516) [-390.886] -- 0:00:31
Average standard deviation of split frequencies: 0.009466
460500 -- [-389.990] (-391.071) (-390.160) (-390.221) * (-390.447) (-390.818) (-392.557) [-393.342] -- 0:00:31
461000 -- [-390.142] (-390.054) (-389.307) (-392.589) * (-390.433) (-393.314) (-393.552) [-394.655] -- 0:00:31
461500 -- (-390.302) [-389.743] (-393.000) (-393.299) * (-389.423) (-391.563) [-389.456] (-389.854) -- 0:00:31
462000 -- (-390.778) (-390.149) [-393.659] (-392.722) * (-390.669) (-390.120) (-397.396) [-389.849] -- 0:00:31
462500 -- (-391.154) (-391.212) [-389.761] (-394.081) * (-395.670) [-392.068] (-396.470) (-390.703) -- 0:00:31
463000 -- [-390.408] (-390.089) (-390.554) (-397.177) * (-394.665) (-396.272) [-389.666] (-391.385) -- 0:00:32
463500 -- (-389.918) (-390.339) (-391.645) [-389.707] * (-392.532) (-391.228) [-391.806] (-391.879) -- 0:00:32
464000 -- [-393.614] (-389.368) (-389.862) (-393.137) * [-390.280] (-392.660) (-389.874) (-393.160) -- 0:00:32
464500 -- (-393.243) (-391.369) [-389.377] (-393.240) * (-392.238) [-394.027] (-389.754) (-392.339) -- 0:00:32
465000 -- [-392.559] (-394.785) (-390.970) (-389.690) * (-396.027) [-395.038] (-391.720) (-390.859) -- 0:00:32
Average standard deviation of split frequencies: 0.009104
465500 -- [-392.416] (-392.119) (-391.473) (-390.575) * (-392.393) (-393.294) [-391.137] (-390.555) -- 0:00:32
466000 -- [-391.019] (-390.798) (-392.287) (-391.828) * [-393.171] (-393.798) (-390.350) (-390.534) -- 0:00:32
466500 -- (-393.456) (-391.871) (-395.855) [-392.818] * (-392.190) (-391.304) (-390.572) [-390.617] -- 0:00:32
467000 -- (-394.161) [-390.235] (-390.442) (-393.534) * (-390.367) (-389.654) (-394.920) [-391.196] -- 0:00:31
467500 -- (-392.289) [-390.936] (-389.815) (-391.841) * (-389.842) (-390.418) (-392.505) [-391.090] -- 0:00:31
468000 -- (-393.271) (-391.795) (-392.577) [-390.184] * (-394.833) (-389.994) [-390.564] (-393.045) -- 0:00:31
468500 -- (-396.062) [-391.336] (-391.609) (-391.327) * (-389.841) (-392.987) [-392.689] (-392.215) -- 0:00:31
469000 -- [-392.689] (-397.513) (-392.180) (-394.242) * (-391.601) (-390.221) (-391.411) [-392.545] -- 0:00:31
469500 -- [-392.249] (-390.174) (-393.607) (-390.135) * (-394.901) [-389.690] (-390.219) (-392.042) -- 0:00:31
470000 -- (-391.776) [-389.770] (-391.680) (-391.871) * (-394.614) [-389.897] (-390.867) (-391.790) -- 0:00:31
Average standard deviation of split frequencies: 0.008764
470500 -- (-390.294) (-391.935) (-392.693) [-392.030] * (-391.757) (-390.998) (-389.875) [-390.503] -- 0:00:31
471000 -- (-390.396) [-390.942] (-392.229) (-391.828) * (-392.989) [-391.494] (-390.017) (-389.663) -- 0:00:31
471500 -- (-391.015) (-390.586) [-390.932] (-393.374) * (-393.162) (-392.820) [-389.989] (-390.112) -- 0:00:31
472000 -- (-392.155) (-390.628) (-390.060) [-389.668] * (-389.314) (-392.070) (-390.721) [-391.010] -- 0:00:31
472500 -- [-390.313] (-389.853) (-389.575) (-389.447) * [-389.510] (-389.264) (-389.115) (-397.819) -- 0:00:31
473000 -- (-390.785) (-390.516) (-394.685) [-389.538] * [-390.174] (-390.502) (-389.059) (-390.065) -- 0:00:31
473500 -- (-391.616) [-390.317] (-392.341) (-390.330) * (-392.414) (-397.059) [-391.516] (-390.876) -- 0:00:31
474000 -- (-391.187) [-393.979] (-391.247) (-390.222) * (-392.153) (-395.907) [-390.383] (-390.456) -- 0:00:31
474500 -- (-390.482) [-391.635] (-392.313) (-391.665) * (-394.285) (-392.290) (-390.728) [-390.634] -- 0:00:31
475000 -- (-392.232) (-390.139) (-391.416) [-391.936] * (-391.534) [-390.003] (-389.465) (-391.639) -- 0:00:30
Average standard deviation of split frequencies: 0.009037
475500 -- (-392.772) (-390.461) (-389.851) [-391.694] * (-395.309) (-390.306) (-390.513) [-389.958] -- 0:00:30
476000 -- (-391.323) (-393.263) [-390.234] (-393.702) * (-391.536) [-391.329] (-391.524) (-394.485) -- 0:00:30
476500 -- (-391.200) (-391.735) (-391.808) [-390.946] * (-395.705) [-390.461] (-390.494) (-391.060) -- 0:00:30
477000 -- (-389.845) [-391.500] (-393.028) (-389.991) * [-390.958] (-389.416) (-393.674) (-391.162) -- 0:00:30
477500 -- [-392.595] (-393.752) (-392.135) (-392.763) * (-391.163) [-390.089] (-389.388) (-389.434) -- 0:00:30
478000 -- [-396.942] (-392.495) (-391.108) (-391.600) * (-389.700) [-390.507] (-391.849) (-390.451) -- 0:00:30
478500 -- (-393.312) (-390.372) (-391.128) [-392.423] * [-390.393] (-393.815) (-390.281) (-393.261) -- 0:00:30
479000 -- [-389.977] (-391.581) (-390.618) (-392.872) * (-392.010) (-392.252) (-394.278) [-391.978] -- 0:00:30
479500 -- (-390.006) (-391.023) (-390.834) [-393.486] * (-392.718) (-389.656) (-389.768) [-395.067] -- 0:00:30
480000 -- [-392.130] (-389.788) (-391.025) (-396.495) * (-390.093) (-390.930) [-390.931] (-393.352) -- 0:00:31
Average standard deviation of split frequencies: 0.009501
480500 -- [-390.055] (-392.800) (-390.781) (-392.614) * (-392.166) [-388.976] (-390.294) (-390.887) -- 0:00:31
481000 -- (-390.459) (-392.957) [-390.619] (-391.546) * [-394.682] (-393.073) (-392.378) (-390.679) -- 0:00:31
481500 -- (-390.704) (-390.797) (-390.779) [-392.152] * (-393.876) (-392.576) [-394.813] (-390.741) -- 0:00:31
482000 -- (-392.364) (-393.279) (-390.069) [-392.835] * [-390.801] (-395.096) (-391.909) (-390.161) -- 0:00:31
482500 -- (-391.370) [-391.960] (-389.696) (-390.391) * (-399.564) (-391.357) (-391.308) [-392.160] -- 0:00:31
483000 -- (-390.816) (-391.830) [-392.550] (-389.431) * [-391.886] (-390.865) (-394.144) (-393.107) -- 0:00:31
483500 -- (-391.927) (-389.504) [-391.134] (-389.732) * (-392.141) (-389.657) (-390.795) [-391.453] -- 0:00:30
484000 -- [-390.268] (-390.853) (-390.442) (-394.874) * [-393.704] (-389.621) (-391.614) (-395.024) -- 0:00:30
484500 -- (-390.149) (-392.039) [-389.562] (-390.345) * (-394.338) (-390.778) (-390.139) [-393.487] -- 0:00:30
485000 -- (-390.329) (-391.008) (-389.673) [-392.340] * (-389.809) [-389.419] (-394.457) (-397.965) -- 0:00:30
Average standard deviation of split frequencies: 0.008790
485500 -- (-391.562) (-390.259) (-394.651) [-390.564] * (-389.101) [-389.839] (-392.780) (-391.304) -- 0:00:30
486000 -- (-390.477) (-390.245) (-391.433) [-390.909] * (-390.900) (-389.231) [-390.316] (-389.650) -- 0:00:30
486500 -- (-391.663) (-389.376) (-391.300) [-391.186] * (-396.696) [-390.746] (-390.311) (-390.992) -- 0:00:30
487000 -- (-390.391) (-389.962) [-390.950] (-390.635) * [-390.048] (-390.226) (-390.893) (-390.088) -- 0:00:30
487500 -- (-390.877) [-390.282] (-390.257) (-391.819) * (-391.209) (-391.579) [-390.792] (-389.569) -- 0:00:30
488000 -- [-390.630] (-391.712) (-390.971) (-390.788) * (-392.807) [-390.835] (-397.477) (-389.874) -- 0:00:30
488500 -- (-391.912) (-391.118) (-392.565) [-390.440] * [-392.559] (-391.486) (-392.506) (-389.068) -- 0:00:30
489000 -- (-389.572) [-391.472] (-390.516) (-390.706) * (-389.786) [-390.743] (-394.234) (-391.976) -- 0:00:30
489500 -- (-389.870) [-392.538] (-390.726) (-390.227) * (-396.076) (-394.665) (-391.367) [-389.651] -- 0:00:30
490000 -- (-390.970) (-393.654) (-394.790) [-390.619] * (-390.565) (-390.724) (-390.537) [-392.968] -- 0:00:30
Average standard deviation of split frequencies: 0.008587
490500 -- (-393.037) [-391.927] (-400.529) (-395.213) * (-396.881) [-390.139] (-393.475) (-392.106) -- 0:00:30
491000 -- (-389.512) (-393.433) [-390.550] (-395.035) * [-390.429] (-389.700) (-389.895) (-393.386) -- 0:00:30
491500 -- (-391.269) (-390.405) (-390.859) [-393.505] * (-390.578) [-394.608] (-393.513) (-395.799) -- 0:00:30
492000 -- (-389.762) (-392.041) (-391.336) [-392.914] * (-392.285) (-392.836) (-391.104) [-391.138] -- 0:00:29
492500 -- [-393.242] (-390.140) (-392.172) (-389.594) * (-390.439) (-391.389) [-392.880] (-393.730) -- 0:00:29
493000 -- (-391.038) (-390.098) (-390.922) [-389.975] * (-391.441) [-389.441] (-395.114) (-392.805) -- 0:00:29
493500 -- (-390.414) (-391.857) (-390.856) [-393.145] * (-389.708) (-390.717) [-390.261] (-392.807) -- 0:00:29
494000 -- (-390.085) (-390.254) [-391.401] (-390.920) * (-390.859) (-395.407) (-391.722) [-391.440] -- 0:00:29
494500 -- [-390.903] (-394.427) (-393.686) (-394.640) * (-390.641) (-390.481) (-390.962) [-391.676] -- 0:00:29
495000 -- [-390.394] (-395.909) (-392.232) (-390.186) * (-390.610) (-389.870) (-391.682) [-389.564] -- 0:00:29
Average standard deviation of split frequencies: 0.008490
495500 -- (-390.424) (-393.831) [-393.799] (-392.666) * (-394.499) (-395.123) (-391.834) [-389.508] -- 0:00:29
496000 -- (-392.014) (-393.255) [-389.627] (-391.012) * (-392.707) (-390.248) (-390.254) [-391.590] -- 0:00:29
496500 -- [-390.592] (-393.011) (-390.942) (-392.233) * (-391.432) [-389.605] (-391.725) (-392.522) -- 0:00:29
497000 -- [-389.755] (-390.454) (-390.857) (-391.372) * [-390.953] (-393.573) (-394.065) (-393.701) -- 0:00:30
497500 -- (-389.344) (-390.444) (-392.918) [-394.150] * (-391.753) (-394.181) [-391.646] (-391.910) -- 0:00:30
498000 -- (-393.462) [-391.841] (-392.142) (-392.024) * [-394.294] (-394.242) (-396.268) (-392.852) -- 0:00:30
498500 -- [-392.366] (-389.976) (-391.648) (-394.297) * [-394.597] (-395.049) (-396.662) (-391.459) -- 0:00:30
499000 -- (-390.140) [-390.928] (-392.161) (-395.008) * (-394.833) (-390.772) (-389.977) [-391.377] -- 0:00:30
499500 -- (-389.461) (-391.086) (-390.429) [-390.575] * (-389.289) (-389.673) (-390.905) [-390.501] -- 0:00:30
500000 -- [-392.400] (-393.211) (-392.583) (-394.101) * [-390.640] (-391.439) (-390.693) (-393.523) -- 0:00:30
Average standard deviation of split frequencies: 0.007407
500500 -- (-391.196) (-389.851) (-390.799) [-391.241] * (-389.516) [-392.530] (-391.159) (-389.848) -- 0:00:29
501000 -- (-391.176) [-389.898] (-391.989) (-390.482) * (-390.602) (-390.498) (-394.304) [-394.942] -- 0:00:29
501500 -- (-394.359) [-390.867] (-392.424) (-391.590) * (-391.050) (-390.216) [-393.391] (-389.696) -- 0:00:29
502000 -- [-390.393] (-389.274) (-390.551) (-393.953) * [-389.594] (-391.326) (-392.830) (-391.463) -- 0:00:29
502500 -- (-391.740) (-394.701) (-390.231) [-398.701] * [-389.453] (-394.554) (-394.988) (-392.303) -- 0:00:29
503000 -- (-390.818) (-389.330) (-389.884) [-391.065] * [-390.794] (-390.509) (-390.817) (-391.296) -- 0:00:29
503500 -- (-390.101) [-389.298] (-389.500) (-389.662) * (-391.499) (-391.051) (-398.230) [-389.897] -- 0:00:29
504000 -- (-392.153) (-392.032) (-389.664) [-390.118] * (-389.378) (-391.952) [-393.110] (-393.177) -- 0:00:29
504500 -- (-392.310) (-390.903) [-390.638] (-393.847) * (-390.067) [-391.727] (-392.434) (-391.749) -- 0:00:29
505000 -- (-394.186) (-390.795) [-391.446] (-391.032) * (-392.630) (-395.447) [-391.623] (-391.500) -- 0:00:29
Average standard deviation of split frequencies: 0.007453
505500 -- (-391.949) [-391.052] (-394.530) (-392.284) * [-390.670] (-392.294) (-391.755) (-390.469) -- 0:00:29
506000 -- (-395.227) (-389.404) [-391.153] (-390.146) * (-390.895) (-394.047) (-394.550) [-389.828] -- 0:00:29
506500 -- (-391.414) (-389.979) (-394.309) [-390.708] * (-391.058) (-391.365) (-391.640) [-389.349] -- 0:00:29
507000 -- (-392.243) (-390.019) [-391.816] (-397.626) * (-391.750) [-392.493] (-391.978) (-391.983) -- 0:00:29
507500 -- [-390.461] (-390.538) (-393.762) (-391.810) * [-391.568] (-391.251) (-390.152) (-392.387) -- 0:00:29
508000 -- (-393.069) (-390.742) [-392.348] (-391.875) * (-391.242) [-393.144] (-392.022) (-390.645) -- 0:00:29
508500 -- (-391.868) (-389.313) [-390.631] (-398.353) * (-390.419) (-394.529) (-390.546) [-390.057] -- 0:00:28
509000 -- (-390.454) (-389.590) [-393.353] (-390.608) * (-391.185) [-392.041] (-391.537) (-391.513) -- 0:00:28
509500 -- (-390.096) (-391.964) (-393.965) [-390.625] * (-390.664) (-393.307) (-389.356) [-390.466] -- 0:00:28
510000 -- (-391.886) (-392.757) (-392.935) [-390.210] * (-390.433) (-398.054) (-394.966) [-390.252] -- 0:00:28
Average standard deviation of split frequencies: 0.007693
510500 -- (-391.117) [-392.050] (-392.480) (-391.573) * (-397.075) [-393.195] (-392.457) (-390.712) -- 0:00:28
511000 -- [-393.890] (-394.078) (-391.220) (-389.632) * (-393.324) (-394.825) [-389.863] (-391.323) -- 0:00:28
511500 -- (-396.408) (-395.373) [-390.268] (-390.312) * [-390.455] (-392.583) (-391.482) (-391.198) -- 0:00:28
512000 -- (-392.039) [-391.674] (-390.942) (-390.256) * [-389.420] (-392.262) (-390.130) (-393.788) -- 0:00:28
512500 -- (-394.415) (-392.178) (-394.565) [-391.762] * (-389.463) [-391.773] (-391.301) (-389.921) -- 0:00:28
513000 -- (-395.252) (-392.898) [-390.195] (-392.259) * (-389.615) (-390.520) (-393.914) [-391.392] -- 0:00:28
513500 -- (-390.503) (-396.450) [-391.375] (-390.893) * (-390.893) (-391.427) (-397.104) [-389.865] -- 0:00:28
514000 -- (-393.912) [-395.787] (-391.216) (-394.026) * [-389.857] (-390.878) (-393.494) (-389.595) -- 0:00:29
514500 -- (-391.959) (-392.506) [-390.474] (-389.444) * (-391.978) [-390.516] (-390.003) (-391.068) -- 0:00:29
515000 -- [-392.757] (-392.531) (-392.370) (-390.701) * (-390.214) [-389.973] (-389.727) (-391.649) -- 0:00:29
Average standard deviation of split frequencies: 0.008161
515500 -- [-391.535] (-392.774) (-390.733) (-390.596) * (-393.230) (-392.639) [-392.311] (-389.983) -- 0:00:29
516000 -- (-391.096) (-393.099) (-391.240) [-391.295] * (-390.085) [-392.068] (-392.664) (-392.099) -- 0:00:29
516500 -- (-390.288) (-395.364) [-392.258] (-389.902) * (-393.716) (-391.623) (-393.033) [-389.655] -- 0:00:29
517000 -- [-391.503] (-390.863) (-391.403) (-390.568) * (-391.371) (-393.297) [-391.011] (-389.822) -- 0:00:28
517500 -- (-390.570) [-389.880] (-391.895) (-390.168) * (-389.874) [-395.393] (-394.017) (-391.415) -- 0:00:28
518000 -- (-389.952) (-390.103) [-389.886] (-391.427) * (-391.150) (-393.125) [-395.244] (-390.296) -- 0:00:28
518500 -- (-390.530) (-392.018) (-389.538) [-393.243] * (-389.798) (-392.633) (-396.114) [-390.278] -- 0:00:28
519000 -- [-391.843] (-395.611) (-389.803) (-391.789) * (-390.217) (-390.513) [-391.386] (-389.419) -- 0:00:28
519500 -- (-389.891) (-394.265) (-390.729) [-392.330] * (-392.774) (-390.105) [-389.576] (-393.980) -- 0:00:28
520000 -- [-390.043] (-392.747) (-392.976) (-395.315) * (-391.969) [-391.304] (-389.340) (-393.178) -- 0:00:28
Average standard deviation of split frequencies: 0.008390
520500 -- [-393.221] (-393.151) (-391.727) (-393.764) * (-390.330) (-389.823) (-391.575) [-390.355] -- 0:00:28
521000 -- (-390.490) (-390.153) [-390.296] (-395.060) * (-390.015) [-391.328] (-392.936) (-391.853) -- 0:00:28
521500 -- (-389.393) [-392.049] (-390.311) (-393.500) * (-391.397) (-390.141) (-390.503) [-392.980] -- 0:00:28
522000 -- (-389.915) (-390.247) (-394.398) [-390.180] * [-389.762] (-391.648) (-390.349) (-390.483) -- 0:00:28
522500 -- (-390.118) (-391.176) (-391.054) [-394.124] * (-392.983) [-390.767] (-390.402) (-391.184) -- 0:00:28
523000 -- (-396.861) (-395.878) (-390.281) [-390.976] * (-392.921) (-393.031) (-390.740) [-389.947] -- 0:00:28
523500 -- (-392.049) (-394.037) (-391.508) [-390.527] * (-390.237) [-393.533] (-392.150) (-392.384) -- 0:00:28
524000 -- (-392.263) (-390.800) [-391.105] (-390.350) * (-392.567) (-389.632) [-391.275] (-393.202) -- 0:00:28
524500 -- (-389.948) (-394.324) [-391.149] (-391.861) * (-389.798) (-392.601) [-390.438] (-394.972) -- 0:00:28
525000 -- (-391.335) [-392.018] (-394.889) (-389.758) * (-391.113) [-394.501] (-393.048) (-392.148) -- 0:00:28
Average standard deviation of split frequencies: 0.008245
525500 -- (-391.304) (-390.333) [-391.234] (-391.269) * (-395.240) [-388.877] (-390.349) (-392.268) -- 0:00:27
526000 -- (-392.823) (-390.510) (-393.216) [-389.960] * (-392.638) (-392.961) [-392.286] (-390.727) -- 0:00:27
526500 -- (-391.786) (-393.719) [-389.967] (-392.643) * (-390.574) (-391.216) (-390.304) [-391.501] -- 0:00:27
527000 -- [-390.984] (-392.992) (-391.139) (-390.596) * [-390.342] (-392.004) (-390.834) (-393.023) -- 0:00:27
527500 -- (-393.756) (-394.839) (-395.377) [-393.156] * (-389.547) [-389.787] (-389.441) (-395.752) -- 0:00:27
528000 -- [-391.748] (-392.567) (-390.194) (-393.837) * (-393.836) [-390.703] (-389.951) (-396.530) -- 0:00:27
528500 -- (-390.076) [-391.062] (-390.764) (-389.985) * [-393.416] (-389.538) (-393.053) (-391.520) -- 0:00:27
529000 -- (-389.896) (-396.850) [-390.351] (-396.379) * (-392.476) (-392.139) (-392.466) [-390.936] -- 0:00:27
529500 -- [-390.443] (-392.012) (-390.705) (-390.672) * (-391.285) (-391.864) (-396.518) [-389.862] -- 0:00:27
530000 -- (-391.619) (-390.659) [-395.992] (-390.754) * (-391.836) [-390.577] (-390.846) (-391.729) -- 0:00:27
Average standard deviation of split frequencies: 0.008350
530500 -- (-390.453) [-390.036] (-391.869) (-393.950) * (-398.055) [-389.576] (-391.415) (-392.099) -- 0:00:27
531000 -- [-391.466] (-390.530) (-389.280) (-391.427) * [-392.286] (-389.951) (-389.739) (-389.434) -- 0:00:28
531500 -- (-392.488) (-390.375) [-393.866] (-391.377) * [-391.672] (-390.282) (-391.702) (-392.655) -- 0:00:28
532000 -- [-389.574] (-393.492) (-390.881) (-389.604) * [-390.736] (-391.174) (-392.166) (-391.151) -- 0:00:28
532500 -- (-392.956) [-391.600] (-390.342) (-391.338) * (-391.821) (-390.044) [-389.818] (-395.158) -- 0:00:28
533000 -- (-389.022) (-391.175) (-389.280) [-389.986] * [-390.593] (-391.524) (-391.504) (-392.607) -- 0:00:28
533500 -- (-392.447) [-390.391] (-389.067) (-392.053) * [-390.684] (-389.284) (-391.627) (-393.303) -- 0:00:27
534000 -- (-390.664) (-390.212) [-392.107] (-392.388) * (-394.331) (-389.264) (-392.583) [-389.986] -- 0:00:27
534500 -- (-394.571) (-392.310) (-390.729) [-393.550] * [-391.496] (-394.410) (-391.085) (-391.001) -- 0:00:27
535000 -- [-393.088] (-393.139) (-390.975) (-395.295) * (-394.944) [-393.100] (-391.960) (-390.675) -- 0:00:27
Average standard deviation of split frequencies: 0.007915
535500 -- (-391.349) [-396.431] (-394.393) (-392.129) * (-393.902) (-391.155) (-391.760) [-395.529] -- 0:00:27
536000 -- (-392.418) [-394.742] (-392.170) (-393.033) * (-391.833) (-394.413) (-392.719) [-392.231] -- 0:00:27
536500 -- (-392.644) (-389.668) [-390.904] (-393.868) * (-389.829) (-394.383) (-392.031) [-390.747] -- 0:00:27
537000 -- (-392.633) [-390.036] (-393.544) (-395.081) * (-394.072) (-392.801) (-389.571) [-390.981] -- 0:00:27
537500 -- [-391.415] (-389.575) (-391.819) (-389.789) * [-391.663] (-392.166) (-389.913) (-392.905) -- 0:00:27
538000 -- (-391.286) [-391.812] (-391.020) (-390.828) * (-392.527) (-391.326) [-391.578] (-394.197) -- 0:00:27
538500 -- (-390.694) (-389.697) [-391.176] (-390.753) * (-392.912) (-390.651) [-390.080] (-391.346) -- 0:00:27
539000 -- [-390.082] (-392.325) (-392.457) (-391.572) * (-393.084) (-390.712) [-389.539] (-390.243) -- 0:00:27
539500 -- (-390.775) (-391.133) [-389.859] (-391.867) * (-389.885) (-390.486) [-398.133] (-392.665) -- 0:00:27
540000 -- (-391.872) [-390.758] (-391.644) (-394.913) * (-391.218) (-394.163) (-390.298) [-392.299] -- 0:00:27
Average standard deviation of split frequencies: 0.007963
540500 -- [-390.884] (-390.179) (-390.118) (-390.245) * [-390.391] (-392.838) (-393.872) (-392.233) -- 0:00:27
541000 -- (-392.393) (-389.770) [-391.327] (-393.901) * [-392.407] (-393.683) (-389.356) (-392.395) -- 0:00:27
541500 -- (-390.932) (-390.561) [-391.944] (-391.550) * (-395.184) (-393.968) [-390.059] (-396.559) -- 0:00:27
542000 -- (-390.470) [-392.129] (-389.628) (-392.450) * (-389.925) (-394.815) [-391.138] (-392.332) -- 0:00:27
542500 -- [-391.310] (-391.235) (-389.345) (-392.149) * (-390.440) (-394.978) (-393.624) [-391.185] -- 0:00:26
543000 -- (-394.538) (-391.860) (-391.674) [-393.756] * (-391.234) (-394.077) (-394.269) [-390.471] -- 0:00:26
543500 -- (-393.463) (-391.534) [-392.338] (-391.270) * [-390.817] (-393.326) (-391.917) (-394.496) -- 0:00:26
544000 -- (-391.331) (-393.457) (-391.864) [-391.864] * (-393.981) (-393.376) [-390.063] (-395.033) -- 0:00:26
544500 -- (-391.137) (-392.709) (-389.398) [-395.917] * (-390.925) [-389.979] (-390.725) (-393.737) -- 0:00:26
545000 -- (-391.499) (-390.071) (-389.397) [-390.521] * (-390.878) (-390.826) [-391.546] (-394.845) -- 0:00:26
Average standard deviation of split frequencies: 0.008364
545500 -- (-389.141) (-389.521) [-389.150] (-390.857) * (-391.392) [-393.945] (-391.820) (-390.503) -- 0:00:26
546000 -- (-391.913) (-390.052) [-389.611] (-395.316) * (-390.020) (-394.383) [-389.700] (-389.904) -- 0:00:26
546500 -- (-391.665) [-390.029] (-390.226) (-392.005) * (-391.316) [-390.642] (-390.428) (-389.780) -- 0:00:26
547000 -- (-389.888) (-391.097) (-395.070) [-390.574] * (-390.670) (-389.405) (-390.661) [-391.818] -- 0:00:26
547500 -- (-391.074) (-394.948) (-392.675) [-389.729] * (-393.262) (-390.704) [-391.842] (-390.912) -- 0:00:26
548000 -- (-390.156) (-389.805) (-390.404) [-392.780] * (-390.765) [-391.332] (-389.471) (-393.020) -- 0:00:27
548500 -- (-389.762) [-390.224] (-390.308) (-394.299) * (-391.129) [-389.614] (-389.739) (-393.491) -- 0:00:27
549000 -- [-390.238] (-391.910) (-393.222) (-392.127) * (-390.020) [-391.144] (-389.350) (-393.967) -- 0:00:27
549500 -- [-392.432] (-390.035) (-391.458) (-390.692) * (-393.176) (-390.877) [-390.033] (-393.706) -- 0:00:27
550000 -- [-392.682] (-390.118) (-394.415) (-389.109) * (-391.652) [-391.145] (-389.331) (-397.348) -- 0:00:27
Average standard deviation of split frequencies: 0.007972
550500 -- (-389.232) [-390.404] (-394.819) (-395.130) * [-389.840] (-392.804) (-392.709) (-390.501) -- 0:00:26
551000 -- [-391.083] (-392.248) (-391.687) (-390.779) * (-390.831) (-392.009) [-390.458] (-390.425) -- 0:00:26
551500 -- (-391.808) (-393.770) (-390.670) [-391.226] * (-392.193) (-389.422) (-391.923) [-390.488] -- 0:00:26
552000 -- (-390.633) [-391.149] (-390.634) (-390.601) * (-391.411) (-391.232) [-390.532] (-391.214) -- 0:00:26
552500 -- (-390.863) (-394.600) [-392.496] (-389.734) * [-389.646] (-391.488) (-390.494) (-392.022) -- 0:00:26
553000 -- (-391.733) (-391.224) [-389.887] (-396.720) * (-392.528) [-391.464] (-390.226) (-391.766) -- 0:00:26
553500 -- [-391.861] (-390.510) (-392.244) (-395.931) * (-397.180) [-390.113] (-391.395) (-391.624) -- 0:00:26
554000 -- (-390.405) (-395.180) [-392.091] (-392.271) * [-390.592] (-391.432) (-390.422) (-393.520) -- 0:00:26
554500 -- [-391.826] (-392.237) (-391.714) (-390.644) * [-390.335] (-389.279) (-391.668) (-389.979) -- 0:00:26
555000 -- (-390.509) [-395.224] (-389.199) (-391.025) * (-390.522) (-390.088) [-391.940] (-389.457) -- 0:00:26
Average standard deviation of split frequencies: 0.007631
555500 -- (-390.120) (-393.497) [-390.061] (-393.533) * (-389.874) [-390.894] (-390.943) (-390.499) -- 0:00:26
556000 -- (-393.614) (-390.349) [-390.387] (-391.746) * (-391.253) [-389.655] (-390.688) (-389.267) -- 0:00:26
556500 -- (-389.689) (-390.445) (-389.820) [-393.759] * (-389.982) [-390.224] (-390.309) (-389.891) -- 0:00:26
557000 -- (-390.961) (-391.778) [-390.529] (-390.136) * (-391.639) [-393.816] (-394.952) (-389.445) -- 0:00:26
557500 -- (-389.266) (-389.792) (-389.185) [-391.484] * (-392.707) [-391.432] (-393.543) (-395.388) -- 0:00:26
558000 -- (-395.360) (-391.711) [-390.223] (-393.750) * (-392.137) (-390.722) (-390.331) [-394.629] -- 0:00:26
558500 -- (-391.821) (-390.877) (-394.316) [-389.775] * [-390.788] (-392.507) (-390.895) (-391.607) -- 0:00:26
559000 -- (-390.131) [-390.374] (-393.341) (-390.966) * [-391.202] (-389.945) (-392.844) (-400.902) -- 0:00:26
559500 -- (-390.035) [-390.070] (-394.681) (-394.453) * (-390.562) [-393.799] (-390.661) (-390.422) -- 0:00:25
560000 -- (-391.736) [-392.299] (-393.323) (-391.424) * (-390.703) [-391.831] (-391.562) (-391.590) -- 0:00:25
Average standard deviation of split frequencies: 0.008408
560500 -- (-390.742) (-393.256) [-390.409] (-391.517) * (-389.508) (-392.630) [-389.316] (-389.148) -- 0:00:25
561000 -- (-390.863) [-396.400] (-389.964) (-390.627) * [-390.894] (-391.667) (-391.854) (-391.258) -- 0:00:25
561500 -- (-391.662) (-397.513) (-391.168) [-390.740] * (-390.769) (-393.661) (-390.392) [-390.724] -- 0:00:25
562000 -- (-394.789) (-390.899) (-389.525) [-389.565] * (-398.635) (-392.798) [-390.999] (-393.733) -- 0:00:25
562500 -- (-392.600) [-390.286] (-391.262) (-395.500) * (-391.348) [-393.510] (-391.089) (-390.642) -- 0:00:25
563000 -- (-390.859) [-393.413] (-391.611) (-389.881) * (-393.211) [-393.593] (-391.136) (-390.533) -- 0:00:25
563500 -- (-390.163) [-390.573] (-391.297) (-389.500) * (-392.024) [-392.018] (-394.590) (-389.834) -- 0:00:25
564000 -- (-391.771) (-389.311) [-389.311] (-389.211) * (-390.641) (-393.793) [-390.086] (-390.814) -- 0:00:25
564500 -- (-391.989) (-390.025) (-390.054) [-389.801] * (-395.550) (-393.940) (-391.991) [-390.128] -- 0:00:25
565000 -- (-393.476) (-394.619) [-391.159] (-389.546) * (-394.309) (-395.528) [-392.527] (-390.956) -- 0:00:26
Average standard deviation of split frequencies: 0.008173
565500 -- (-391.024) [-389.588] (-392.168) (-389.982) * (-390.810) (-390.397) [-389.790] (-391.255) -- 0:00:26
566000 -- [-392.059] (-392.698) (-394.480) (-393.345) * (-392.644) [-390.143] (-390.532) (-390.400) -- 0:00:26
566500 -- [-390.131] (-395.189) (-391.642) (-390.608) * (-391.264) [-391.120] (-390.916) (-389.455) -- 0:00:26
567000 -- (-391.043) (-395.846) [-392.176] (-391.103) * (-391.099) (-389.911) [-389.640] (-391.677) -- 0:00:25
567500 -- (-389.547) [-392.742] (-391.924) (-389.966) * (-391.359) [-389.401] (-391.712) (-391.913) -- 0:00:25
568000 -- (-391.892) (-392.144) [-395.929] (-396.103) * (-391.199) (-391.861) [-390.544] (-394.897) -- 0:00:25
568500 -- (-391.541) [-391.732] (-390.569) (-391.848) * [-389.066] (-390.917) (-389.693) (-389.795) -- 0:00:25
569000 -- (-391.058) (-391.663) [-391.075] (-393.257) * (-389.334) (-393.869) [-391.890] (-390.743) -- 0:00:25
569500 -- (-393.489) (-392.436) [-390.497] (-390.373) * [-389.262] (-390.233) (-390.765) (-390.025) -- 0:00:25
570000 -- (-391.248) (-390.510) (-393.338) [-392.892] * (-389.480) [-392.598] (-389.785) (-390.481) -- 0:00:25
Average standard deviation of split frequencies: 0.008106
570500 -- (-389.344) (-395.547) (-394.301) [-390.878] * [-391.727] (-393.295) (-391.172) (-389.615) -- 0:00:25
571000 -- (-391.696) [-394.066] (-391.946) (-393.763) * [-394.883] (-394.872) (-389.745) (-391.986) -- 0:00:25
571500 -- (-390.388) (-393.126) [-391.154] (-392.554) * (-394.287) [-389.452] (-389.427) (-390.538) -- 0:00:25
572000 -- [-389.399] (-392.741) (-395.894) (-393.532) * (-390.141) (-389.608) (-390.739) [-390.107] -- 0:00:25
572500 -- (-390.870) (-389.237) (-389.914) [-392.063] * (-390.989) (-389.887) (-390.778) [-391.078] -- 0:00:25
573000 -- (-395.973) (-390.600) (-391.448) [-390.436] * [-392.388] (-391.149) (-391.608) (-390.496) -- 0:00:25
573500 -- (-393.044) [-391.486] (-391.180) (-393.270) * (-390.484) [-394.644] (-391.395) (-391.126) -- 0:00:25
574000 -- [-395.314] (-390.108) (-390.165) (-390.186) * [-389.017] (-390.306) (-391.704) (-395.853) -- 0:00:25
574500 -- (-402.408) (-389.870) [-393.631] (-392.255) * [-390.409] (-390.388) (-390.232) (-392.283) -- 0:00:25
575000 -- (-402.103) (-390.639) (-391.437) [-391.155] * (-389.713) (-391.568) [-390.760] (-394.811) -- 0:00:25
Average standard deviation of split frequencies: 0.007724
575500 -- (-394.115) [-390.252] (-395.292) (-393.411) * [-389.671] (-392.047) (-390.645) (-390.277) -- 0:00:25
576000 -- (-389.713) (-390.672) [-389.854] (-394.012) * (-391.597) (-390.555) [-390.861] (-390.128) -- 0:00:25
576500 -- (-389.382) (-389.568) [-390.165] (-392.554) * [-392.186] (-390.906) (-392.902) (-390.613) -- 0:00:24
577000 -- [-389.781] (-389.865) (-392.368) (-390.873) * [-390.910] (-397.793) (-390.545) (-389.375) -- 0:00:24
577500 -- (-392.662) (-390.710) (-391.241) [-391.745] * (-394.416) (-392.326) [-390.709] (-390.209) -- 0:00:24
578000 -- (-390.967) (-390.930) (-392.813) [-392.564] * (-394.895) (-390.588) (-393.192) [-389.075] -- 0:00:24
578500 -- [-390.618] (-390.331) (-390.994) (-390.723) * [-393.733] (-392.606) (-391.945) (-389.933) -- 0:00:24
579000 -- (-392.774) [-390.257] (-390.939) (-391.299) * (-392.860) (-390.582) (-393.069) [-391.637] -- 0:00:24
579500 -- (-390.578) (-390.968) [-391.214] (-390.912) * (-393.289) (-390.717) (-389.351) [-390.511] -- 0:00:24
580000 -- (-393.184) [-389.371] (-390.750) (-390.803) * [-392.189] (-390.112) (-390.051) (-394.168) -- 0:00:24
Average standard deviation of split frequencies: 0.007560
580500 -- (-393.406) (-389.204) [-390.765] (-391.495) * (-392.181) [-389.583] (-393.202) (-392.973) -- 0:00:24
581000 -- (-392.449) [-392.276] (-392.667) (-392.828) * (-391.364) (-392.069) [-392.880] (-393.223) -- 0:00:24
581500 -- [-392.471] (-392.106) (-390.782) (-391.172) * (-392.918) [-391.939] (-393.150) (-391.327) -- 0:00:24
582000 -- (-392.268) (-392.886) [-390.082] (-389.546) * (-390.877) (-389.335) [-390.224] (-391.419) -- 0:00:25
582500 -- (-391.286) [-389.626] (-391.228) (-392.097) * (-390.197) [-390.504] (-389.428) (-390.892) -- 0:00:25
583000 -- (-389.332) (-391.041) [-393.095] (-395.380) * [-394.564] (-391.173) (-394.444) (-389.994) -- 0:00:25
583500 -- (-391.306) (-391.667) (-391.367) [-391.161] * [-389.075] (-393.802) (-395.129) (-392.194) -- 0:00:24
584000 -- [-389.681] (-390.378) (-393.864) (-392.336) * (-389.114) (-395.212) [-392.830] (-391.335) -- 0:00:24
584500 -- (-392.207) (-389.231) [-393.749] (-390.860) * (-389.114) (-392.676) [-390.541] (-390.602) -- 0:00:24
585000 -- [-390.541] (-389.899) (-390.822) (-392.053) * [-389.324] (-395.376) (-393.771) (-390.964) -- 0:00:24
Average standard deviation of split frequencies: 0.007491
585500 -- (-389.377) (-392.351) (-390.455) [-394.436] * [-393.884] (-389.612) (-391.094) (-390.534) -- 0:00:24
586000 -- (-390.447) [-393.308] (-389.583) (-389.329) * (-395.099) (-390.920) [-390.315] (-390.219) -- 0:00:24
586500 -- (-393.399) [-390.862] (-394.298) (-390.177) * (-391.931) (-389.790) [-390.572] (-390.684) -- 0:00:24
587000 -- [-392.634] (-391.641) (-393.642) (-391.208) * (-392.139) (-391.685) (-390.374) [-389.602] -- 0:00:24
587500 -- (-392.138) [-390.830] (-391.818) (-396.900) * (-389.614) (-392.645) (-392.122) [-389.700] -- 0:00:24
588000 -- (-390.622) (-392.779) [-390.882] (-391.125) * (-389.343) [-395.533] (-390.551) (-392.284) -- 0:00:24
588500 -- (-393.101) (-391.757) [-389.958] (-391.026) * (-390.310) (-393.723) (-390.938) [-389.509] -- 0:00:24
589000 -- (-393.628) (-391.806) [-389.329] (-392.623) * (-391.473) [-392.876] (-390.767) (-394.819) -- 0:00:24
589500 -- (-390.162) (-389.366) [-389.767] (-393.018) * (-392.043) (-390.134) [-391.000] (-392.396) -- 0:00:24
590000 -- [-391.382] (-394.111) (-390.259) (-393.318) * (-390.948) [-391.054] (-390.570) (-390.321) -- 0:00:24
Average standard deviation of split frequencies: 0.007033
590500 -- [-390.759] (-391.101) (-390.336) (-392.538) * (-390.628) [-393.798] (-390.187) (-389.260) -- 0:00:24
591000 -- (-392.490) (-394.436) [-392.920] (-395.448) * [-390.131] (-390.106) (-392.281) (-392.218) -- 0:00:24
591500 -- (-391.498) (-391.790) [-391.560] (-391.267) * (-391.198) (-394.180) [-390.141] (-390.467) -- 0:00:24
592000 -- [-391.604] (-390.635) (-391.892) (-393.254) * (-390.631) (-390.772) (-390.880) [-393.873] -- 0:00:24
592500 -- [-389.814] (-391.009) (-391.447) (-394.569) * (-390.800) [-393.609] (-391.178) (-396.092) -- 0:00:24
593000 -- [-390.070] (-390.091) (-391.176) (-394.316) * (-393.476) (-391.624) [-391.660] (-394.427) -- 0:00:24
593500 -- (-390.959) (-391.194) [-392.842] (-391.676) * (-391.961) [-390.882] (-396.626) (-391.632) -- 0:00:23
594000 -- (-389.868) [-392.629] (-390.075) (-389.584) * (-393.141) (-392.809) [-389.607] (-391.146) -- 0:00:23
594500 -- (-390.965) (-389.782) (-391.776) [-390.180] * [-391.614] (-391.817) (-392.897) (-393.846) -- 0:00:23
595000 -- [-392.536] (-392.287) (-392.592) (-391.549) * (-392.186) [-391.746] (-396.323) (-390.151) -- 0:00:23
Average standard deviation of split frequencies: 0.007816
595500 -- (-392.875) (-389.929) [-393.011] (-390.713) * (-392.753) (-393.394) [-392.515] (-394.332) -- 0:00:23
596000 -- (-392.119) (-392.877) (-394.496) [-390.201] * (-393.995) (-394.260) (-391.926) [-392.769] -- 0:00:23
596500 -- [-389.411] (-391.122) (-392.311) (-392.933) * [-390.283] (-393.024) (-389.855) (-392.565) -- 0:00:23
597000 -- (-391.471) [-390.885] (-392.318) (-389.856) * (-390.947) [-389.766] (-391.699) (-393.014) -- 0:00:23
597500 -- (-392.854) (-391.953) [-390.416] (-393.878) * (-392.777) (-390.563) (-395.783) [-391.200] -- 0:00:23
598000 -- (-393.335) (-391.282) (-394.108) [-398.269] * (-394.117) (-395.283) (-394.000) [-389.709] -- 0:00:23
598500 -- (-390.296) (-391.318) [-390.199] (-393.018) * [-391.614] (-392.363) (-395.039) (-392.688) -- 0:00:23
599000 -- (-390.572) (-393.350) (-389.365) [-389.950] * (-390.119) (-391.260) (-392.376) [-389.146] -- 0:00:24
599500 -- (-392.942) (-391.207) [-389.902] (-390.105) * (-390.838) [-393.160] (-391.046) (-390.910) -- 0:00:24
600000 -- [-393.470] (-391.398) (-395.412) (-392.780) * (-392.648) (-391.606) (-390.905) [-392.542] -- 0:00:24
Average standard deviation of split frequencies: 0.007701
600500 -- (-398.825) (-390.937) [-391.070] (-391.523) * (-391.172) [-390.540] (-393.785) (-392.723) -- 0:00:23
601000 -- (-393.843) (-390.923) (-391.284) [-392.652] * (-391.387) (-392.212) [-390.613] (-392.137) -- 0:00:23
601500 -- (-389.902) [-389.485] (-391.184) (-396.343) * (-390.145) (-396.280) (-390.332) [-391.523] -- 0:00:23
602000 -- (-389.461) (-392.078) [-390.275] (-389.331) * [-390.268] (-393.773) (-390.951) (-392.324) -- 0:00:23
602500 -- (-390.692) (-392.322) [-389.670] (-393.742) * (-392.571) (-396.152) (-394.410) [-395.171] -- 0:00:23
603000 -- [-392.524] (-392.987) (-390.267) (-390.800) * (-401.639) (-394.834) (-390.240) [-393.532] -- 0:00:23
603500 -- (-391.419) (-392.393) [-389.502] (-396.247) * (-389.643) (-391.568) [-390.259] (-396.921) -- 0:00:23
604000 -- (-392.341) [-391.099] (-393.267) (-390.364) * (-393.629) (-393.018) [-392.608] (-391.085) -- 0:00:23
604500 -- (-390.415) (-391.589) [-389.351] (-389.951) * [-389.523] (-392.461) (-392.173) (-390.485) -- 0:00:23
605000 -- (-391.947) (-389.992) [-389.678] (-390.280) * (-394.111) (-392.546) [-393.525] (-391.033) -- 0:00:23
Average standard deviation of split frequencies: 0.007293
605500 -- (-391.153) (-391.347) [-390.314] (-391.808) * [-389.714] (-395.325) (-394.327) (-392.004) -- 0:00:23
606000 -- (-389.503) (-389.529) (-391.949) [-390.023] * (-388.961) (-390.640) (-393.513) [-390.860] -- 0:00:23
606500 -- (-397.276) [-390.369] (-391.285) (-392.450) * (-390.106) (-397.490) (-390.915) [-391.524] -- 0:00:23
607000 -- (-391.597) [-391.920] (-393.267) (-391.033) * [-391.709] (-395.773) (-389.666) (-389.466) -- 0:00:23
607500 -- (-391.132) (-390.875) (-393.605) [-391.871] * (-390.915) (-395.348) [-390.562] (-390.879) -- 0:00:23
608000 -- [-391.646] (-389.891) (-395.582) (-392.834) * [-390.712] (-391.262) (-390.000) (-392.485) -- 0:00:23
608500 -- (-389.108) [-391.164] (-390.209) (-389.342) * (-390.186) (-393.312) (-391.999) [-389.491] -- 0:00:23
609000 -- (-391.625) [-392.859] (-393.077) (-394.421) * (-390.983) (-391.449) [-390.517] (-389.330) -- 0:00:23
609500 -- (-391.227) (-391.266) (-392.260) [-393.639] * (-393.722) [-389.524] (-389.393) (-396.203) -- 0:00:23
610000 -- (-390.997) [-390.157] (-390.073) (-393.033) * (-392.409) (-389.711) (-390.287) [-392.292] -- 0:00:23
Average standard deviation of split frequencies: 0.006899
610500 -- (-389.513) (-389.446) (-392.101) [-391.987] * (-390.284) (-389.770) [-391.134] (-390.481) -- 0:00:22
611000 -- [-389.759] (-393.078) (-393.323) (-389.889) * [-390.493] (-391.911) (-393.090) (-390.935) -- 0:00:22
611500 -- (-389.777) (-391.107) [-391.719] (-390.268) * [-391.789] (-392.147) (-391.758) (-391.337) -- 0:00:22
612000 -- (-389.546) (-389.940) (-390.424) [-389.201] * (-390.028) (-392.321) [-392.000] (-389.823) -- 0:00:22
612500 -- (-389.877) (-389.328) [-391.403] (-390.389) * (-389.807) [-392.751] (-389.703) (-393.029) -- 0:00:22
613000 -- (-393.783) [-391.919] (-389.645) (-390.053) * (-390.275) [-391.491] (-389.095) (-391.967) -- 0:00:22
613500 -- (-393.776) (-390.024) [-389.947] (-389.628) * (-390.585) (-395.325) (-392.506) [-392.996] -- 0:00:22
614000 -- (-391.385) (-390.791) [-391.501] (-392.703) * [-391.019] (-390.084) (-390.549) (-394.224) -- 0:00:22
614500 -- (-390.422) (-392.408) [-392.331] (-392.401) * (-391.625) (-390.249) (-390.026) [-391.750] -- 0:00:22
615000 -- (-392.121) [-393.279] (-390.967) (-390.650) * (-392.423) [-393.632] (-393.209) (-390.547) -- 0:00:22
Average standard deviation of split frequencies: 0.006696
615500 -- (-389.935) (-392.624) [-391.441] (-393.387) * (-395.729) (-391.145) [-391.191] (-394.776) -- 0:00:22
616000 -- (-390.452) (-393.082) [-392.507] (-390.824) * (-392.694) (-391.304) [-392.206] (-394.145) -- 0:00:23
616500 -- (-392.473) (-393.081) (-393.580) [-391.390] * (-395.998) (-390.906) [-389.898] (-390.848) -- 0:00:23
617000 -- [-390.613] (-391.096) (-397.046) (-394.502) * (-390.859) (-390.410) [-390.295] (-391.523) -- 0:00:22
617500 -- [-389.408] (-393.551) (-391.576) (-394.243) * (-390.388) (-390.371) (-389.655) [-391.737] -- 0:00:22
618000 -- (-389.610) [-392.383] (-396.445) (-395.104) * (-391.510) (-389.798) (-389.687) [-394.605] -- 0:00:22
618500 -- (-391.904) (-390.632) (-389.590) [-392.877] * (-389.822) (-390.885) [-393.486] (-390.745) -- 0:00:22
619000 -- (-395.484) [-391.854] (-391.078) (-393.962) * [-391.454] (-391.264) (-391.720) (-390.172) -- 0:00:22
619500 -- (-389.776) (-391.446) (-393.225) [-392.064] * [-391.340] (-391.410) (-391.733) (-390.995) -- 0:00:22
620000 -- (-391.197) [-389.098] (-391.706) (-394.294) * (-391.385) (-390.178) (-392.587) [-391.136] -- 0:00:22
Average standard deviation of split frequencies: 0.006029
620500 -- (-394.354) (-390.997) [-389.689] (-390.277) * (-390.236) (-390.552) [-396.881] (-389.861) -- 0:00:22
621000 -- [-399.169] (-397.273) (-391.676) (-390.922) * (-390.989) [-389.515] (-391.092) (-391.041) -- 0:00:22
621500 -- (-395.620) (-390.905) [-391.916] (-393.222) * [-390.228] (-389.487) (-395.002) (-392.196) -- 0:00:22
622000 -- (-394.804) [-390.784] (-393.456) (-389.323) * (-392.465) (-393.163) (-391.707) [-391.099] -- 0:00:22
622500 -- (-391.659) [-391.867] (-393.711) (-390.153) * (-391.983) (-392.220) [-389.532] (-391.581) -- 0:00:22
623000 -- (-389.980) [-391.955] (-394.512) (-390.866) * [-391.165] (-395.159) (-390.004) (-389.878) -- 0:00:22
623500 -- (-392.969) (-398.146) (-389.558) [-390.429] * (-390.498) (-395.404) [-390.936] (-392.109) -- 0:00:22
624000 -- (-391.749) (-396.549) [-391.055] (-393.727) * (-389.617) [-392.277] (-391.718) (-393.998) -- 0:00:22
624500 -- (-389.809) (-391.784) [-393.273] (-392.156) * (-390.251) (-389.942) [-391.000] (-392.503) -- 0:00:22
625000 -- (-390.217) [-394.407] (-390.855) (-392.261) * (-393.072) [-390.011] (-394.453) (-389.450) -- 0:00:22
Average standard deviation of split frequencies: 0.006118
625500 -- [-390.144] (-391.335) (-390.033) (-394.266) * (-389.450) [-389.417] (-394.914) (-389.450) -- 0:00:22
626000 -- (-390.759) (-389.454) [-392.072] (-390.655) * (-390.179) (-390.233) [-389.674] (-389.206) -- 0:00:22
626500 -- (-392.957) (-391.479) (-389.379) [-391.045] * (-390.691) (-390.231) (-390.362) [-392.117] -- 0:00:22
627000 -- (-397.084) [-389.034] (-392.197) (-391.772) * (-390.526) (-390.173) [-390.400] (-390.046) -- 0:00:22
627500 -- (-396.549) (-392.418) (-393.166) [-394.096] * (-393.389) (-390.232) (-391.192) [-390.636] -- 0:00:21
628000 -- (-393.882) (-389.885) (-393.842) [-391.024] * (-392.228) (-389.876) (-391.220) [-391.489] -- 0:00:21
628500 -- [-393.518] (-392.727) (-390.784) (-390.828) * (-392.768) (-392.315) [-389.775] (-389.338) -- 0:00:21
629000 -- (-392.251) (-392.047) (-390.280) [-393.892] * (-390.444) (-390.763) (-392.959) [-390.236] -- 0:00:21
629500 -- (-390.115) (-390.002) [-392.057] (-391.392) * (-390.378) [-393.084] (-390.336) (-390.913) -- 0:00:21
630000 -- [-390.023] (-389.768) (-396.215) (-391.611) * (-389.595) (-391.295) [-391.079] (-392.973) -- 0:00:21
Average standard deviation of split frequencies: 0.005466
630500 -- (-391.943) (-392.746) [-391.304] (-392.636) * [-391.679] (-390.814) (-390.434) (-391.398) -- 0:00:21
631000 -- (-389.784) (-393.235) (-389.518) [-391.285] * (-390.126) (-395.066) [-391.827] (-389.925) -- 0:00:21
631500 -- [-391.697] (-390.933) (-393.961) (-391.037) * (-393.005) (-395.209) (-395.137) [-390.944] -- 0:00:21
632000 -- (-393.321) [-389.739] (-391.241) (-393.187) * (-391.084) (-390.190) [-391.180] (-391.298) -- 0:00:22
632500 -- [-391.145] (-392.636) (-389.863) (-394.640) * (-391.175) (-390.903) (-389.667) [-390.149] -- 0:00:22
633000 -- [-391.393] (-396.330) (-390.748) (-393.509) * [-390.004] (-395.522) (-391.672) (-390.935) -- 0:00:22
633500 -- [-389.138] (-398.517) (-389.990) (-392.094) * (-390.133) [-393.596] (-393.233) (-396.988) -- 0:00:21
634000 -- (-391.645) (-390.336) [-389.363] (-390.719) * (-390.061) (-394.792) [-391.434] (-393.486) -- 0:00:21
634500 -- [-391.832] (-391.287) (-390.246) (-390.538) * [-393.617] (-389.702) (-390.348) (-392.239) -- 0:00:21
635000 -- (-393.060) [-391.158] (-394.286) (-390.379) * (-389.936) (-391.431) [-390.980] (-390.704) -- 0:00:21
Average standard deviation of split frequencies: 0.005837
635500 -- [-391.645] (-391.683) (-391.095) (-392.824) * (-390.152) [-393.114] (-390.956) (-391.749) -- 0:00:21
636000 -- (-391.233) [-392.646] (-392.265) (-393.957) * (-395.245) (-391.667) [-392.015] (-389.955) -- 0:00:21
636500 -- [-390.626] (-393.010) (-392.896) (-389.837) * (-396.928) (-389.285) [-390.028] (-390.250) -- 0:00:21
637000 -- (-392.598) (-392.026) (-392.825) [-390.216] * (-396.168) (-394.590) (-390.732) [-394.722] -- 0:00:21
637500 -- (-390.171) (-390.206) [-393.168] (-392.475) * (-391.144) (-389.398) (-390.361) [-390.609] -- 0:00:21
638000 -- (-390.500) (-390.162) [-391.088] (-391.632) * [-389.652] (-390.768) (-393.839) (-391.146) -- 0:00:21
638500 -- (-391.633) (-390.448) [-391.031] (-390.581) * (-390.180) [-394.598] (-392.657) (-392.091) -- 0:00:21
639000 -- (-390.437) [-390.314] (-393.395) (-390.457) * (-391.502) (-390.387) (-389.416) [-390.539] -- 0:00:21
639500 -- (-391.705) (-390.614) (-393.242) [-395.373] * [-390.605] (-391.054) (-391.212) (-390.978) -- 0:00:21
640000 -- (-390.842) (-390.347) [-392.655] (-389.410) * [-392.419] (-390.388) (-392.598) (-393.832) -- 0:00:21
Average standard deviation of split frequencies: 0.005641
640500 -- [-390.101] (-389.933) (-390.756) (-390.280) * (-395.923) (-389.068) [-391.071] (-389.580) -- 0:00:21
641000 -- (-392.954) (-388.973) (-393.092) [-391.953] * (-391.759) (-390.329) (-391.433) [-391.377] -- 0:00:21
641500 -- (-390.698) (-389.000) (-394.584) [-391.530] * (-393.536) [-390.890] (-389.136) (-389.835) -- 0:00:21
642000 -- (-389.544) (-391.362) (-395.648) [-393.165] * (-392.585) (-390.979) (-391.876) [-390.681] -- 0:00:21
642500 -- [-392.500] (-393.114) (-393.732) (-389.445) * (-392.890) (-395.195) (-393.669) [-391.854] -- 0:00:21
643000 -- [-390.288] (-399.313) (-396.438) (-392.937) * [-391.524] (-389.313) (-392.197) (-391.902) -- 0:00:21
643500 -- (-389.523) (-391.587) (-391.109) [-389.665] * (-390.672) [-390.639] (-395.707) (-391.887) -- 0:00:21
644000 -- (-389.666) (-391.364) [-389.478] (-392.039) * [-389.678] (-398.326) (-392.627) (-391.975) -- 0:00:21
644500 -- (-395.021) (-390.196) [-391.072] (-390.935) * (-391.870) [-392.088] (-392.290) (-392.900) -- 0:00:20
645000 -- [-389.219] (-390.009) (-390.259) (-394.109) * (-390.243) (-390.981) [-391.519] (-391.843) -- 0:00:20
Average standard deviation of split frequencies: 0.006294
645500 -- (-390.594) (-391.256) (-394.000) [-391.686] * (-390.501) (-390.674) (-396.385) [-394.035] -- 0:00:20
646000 -- (-396.633) (-391.562) (-391.852) [-390.576] * (-390.974) (-391.505) [-393.037] (-391.806) -- 0:00:20
646500 -- (-389.935) (-389.800) [-390.929] (-396.891) * (-393.537) (-389.689) (-395.693) [-391.439] -- 0:00:20
647000 -- [-392.129] (-392.492) (-391.550) (-395.662) * (-391.854) (-389.942) (-391.152) [-390.090] -- 0:00:20
647500 -- (-392.468) (-391.033) [-390.784] (-392.451) * (-389.725) (-396.429) (-395.817) [-392.301] -- 0:00:20
648000 -- (-391.413) [-393.871] (-389.334) (-392.554) * (-390.995) [-392.970] (-394.476) (-392.309) -- 0:00:20
648500 -- (-391.094) [-390.341] (-389.925) (-392.666) * (-391.458) [-389.924] (-390.565) (-392.367) -- 0:00:20
649000 -- (-390.545) (-390.242) (-392.751) [-392.094] * (-394.919) (-391.098) [-391.337] (-398.231) -- 0:00:21
649500 -- (-392.113) (-390.975) [-391.237] (-393.040) * (-389.469) (-390.654) (-393.092) [-390.405] -- 0:00:21
650000 -- (-391.255) (-391.779) [-392.548] (-397.125) * [-390.433] (-391.568) (-391.865) (-393.118) -- 0:00:21
Average standard deviation of split frequencies: 0.006656
650500 -- (-391.087) [-395.609] (-390.262) (-392.461) * (-390.219) (-391.238) (-390.928) [-390.167] -- 0:00:20
651000 -- (-390.621) [-394.957] (-390.587) (-393.186) * (-395.921) (-391.352) [-390.408] (-391.279) -- 0:00:20
651500 -- (-389.872) (-391.936) (-391.768) [-389.959] * (-390.450) (-391.587) (-391.992) [-391.095] -- 0:00:20
652000 -- [-391.925] (-390.648) (-389.856) (-390.176) * (-390.573) [-392.084] (-392.051) (-389.492) -- 0:00:20
652500 -- (-394.022) (-395.387) [-389.538] (-390.680) * [-390.331] (-392.224) (-393.372) (-392.945) -- 0:00:20
653000 -- (-393.560) [-391.550] (-391.273) (-391.789) * (-391.064) (-391.896) (-394.604) [-389.621] -- 0:00:20
653500 -- [-390.719] (-390.282) (-390.449) (-389.293) * (-392.001) (-395.391) (-393.060) [-390.097] -- 0:00:20
654000 -- (-392.545) (-391.814) (-396.253) [-392.268] * [-389.565] (-397.047) (-391.893) (-392.607) -- 0:00:20
654500 -- (-395.318) (-392.531) [-394.007] (-390.995) * [-391.435] (-390.077) (-389.944) (-394.013) -- 0:00:20
655000 -- (-392.351) (-390.540) [-392.749] (-391.201) * (-395.761) (-393.410) (-389.519) [-393.611] -- 0:00:20
Average standard deviation of split frequencies: 0.006198
655500 -- [-392.217] (-390.830) (-393.385) (-391.166) * [-389.360] (-394.411) (-391.836) (-390.515) -- 0:00:20
656000 -- (-389.897) [-392.530] (-390.904) (-390.775) * [-389.503] (-390.654) (-391.213) (-391.876) -- 0:00:20
656500 -- (-391.803) [-394.060] (-391.183) (-394.201) * (-395.643) [-392.514] (-395.102) (-390.938) -- 0:00:20
657000 -- (-393.570) (-395.295) [-394.659] (-394.683) * [-390.848] (-395.342) (-390.457) (-390.984) -- 0:00:20
657500 -- [-392.454] (-392.004) (-391.291) (-390.779) * (-393.463) [-392.182] (-392.892) (-392.501) -- 0:00:20
658000 -- [-393.641] (-401.492) (-392.226) (-391.017) * (-391.171) [-396.239] (-390.922) (-392.375) -- 0:00:20
658500 -- (-391.724) (-396.248) [-390.978] (-392.174) * (-391.208) (-390.698) (-393.070) [-390.278] -- 0:00:20
659000 -- (-391.996) [-391.654] (-393.057) (-395.592) * [-390.104] (-395.161) (-390.102) (-391.640) -- 0:00:20
659500 -- (-390.576) [-391.495] (-394.288) (-390.948) * (-391.565) [-389.959] (-392.398) (-398.424) -- 0:00:20
660000 -- (-394.056) (-393.454) [-393.779] (-389.485) * [-392.965] (-392.962) (-391.000) (-395.358) -- 0:00:20
Average standard deviation of split frequencies: 0.005566
660500 -- (-391.360) (-391.471) [-390.200] (-392.140) * (-393.699) [-395.668] (-392.893) (-390.126) -- 0:00:20
661000 -- (-391.692) (-391.726) (-392.375) [-391.099] * (-392.610) [-389.999] (-393.255) (-392.602) -- 0:00:20
661500 -- (-391.718) (-391.579) [-392.840] (-389.423) * (-394.780) [-389.947] (-391.910) (-392.160) -- 0:00:19
662000 -- (-394.955) [-390.484] (-391.483) (-395.367) * (-394.899) (-392.858) (-389.037) [-391.817] -- 0:00:19
662500 -- [-392.083] (-393.659) (-391.822) (-390.394) * (-393.511) [-393.569] (-390.633) (-391.629) -- 0:00:19
663000 -- (-392.322) (-389.706) (-391.777) [-390.142] * [-392.023] (-389.412) (-392.609) (-391.848) -- 0:00:19
663500 -- (-395.380) [-391.367] (-392.527) (-389.679) * (-389.788) (-389.391) [-389.328] (-391.374) -- 0:00:19
664000 -- (-391.693) (-391.034) (-391.434) [-391.058] * (-389.444) (-390.360) [-390.095] (-390.218) -- 0:00:19
664500 -- (-390.751) (-394.673) [-390.194] (-391.305) * (-389.780) (-392.999) (-390.181) [-391.098] -- 0:00:19
665000 -- (-391.890) [-390.805] (-391.865) (-392.778) * (-390.306) [-392.939] (-394.989) (-390.616) -- 0:00:19
Average standard deviation of split frequencies: 0.005238
665500 -- (-396.129) [-389.344] (-392.533) (-390.686) * (-389.300) (-393.824) [-392.688] (-392.775) -- 0:00:19
666000 -- (-392.507) [-389.749] (-389.911) (-391.387) * (-390.211) [-390.862] (-394.426) (-391.537) -- 0:00:20
666500 -- (-391.973) (-391.666) (-390.358) [-394.376] * (-392.645) [-390.410] (-391.568) (-391.363) -- 0:00:20
667000 -- [-389.870] (-392.840) (-393.410) (-390.636) * (-391.217) [-390.282] (-390.894) (-392.139) -- 0:00:19
667500 -- (-391.190) (-389.927) [-392.521] (-393.271) * [-391.780] (-392.087) (-393.113) (-391.566) -- 0:00:19
668000 -- (-389.613) (-390.303) [-391.911] (-394.487) * (-393.554) [-392.594] (-393.453) (-391.909) -- 0:00:19
668500 -- (-390.995) [-395.196] (-390.928) (-392.582) * (-391.425) (-399.249) (-392.650) [-390.540] -- 0:00:19
669000 -- [-391.567] (-393.795) (-391.505) (-392.206) * (-389.591) [-393.776] (-391.333) (-390.103) -- 0:00:19
669500 -- (-393.298) (-390.249) (-392.693) [-392.023] * [-389.992] (-390.403) (-389.786) (-390.193) -- 0:00:19
670000 -- (-391.441) (-391.600) [-390.231] (-391.398) * (-392.163) (-390.677) [-390.557] (-392.718) -- 0:00:19
Average standard deviation of split frequencies: 0.005342
670500 -- (-389.963) (-391.578) (-393.468) [-391.537] * (-393.141) (-390.635) (-390.516) [-391.016] -- 0:00:19
671000 -- (-391.683) [-391.341] (-394.347) (-389.786) * (-391.256) (-391.629) (-391.820) [-391.578] -- 0:00:19
671500 -- (-390.110) (-390.485) (-390.977) [-391.574] * (-392.614) (-392.027) [-392.334] (-390.742) -- 0:00:19
672000 -- (-393.730) (-390.862) [-392.286] (-392.425) * [-391.118] (-390.553) (-391.989) (-392.574) -- 0:00:19
672500 -- (-390.985) (-392.622) (-390.396) [-394.042] * [-389.849] (-392.788) (-392.296) (-391.228) -- 0:00:19
673000 -- [-390.468] (-390.742) (-393.202) (-391.281) * [-391.572] (-391.536) (-392.525) (-393.850) -- 0:00:19
673500 -- (-394.145) (-391.004) [-392.126] (-396.306) * (-390.136) (-390.856) [-390.078] (-389.915) -- 0:00:19
674000 -- (-390.874) (-393.550) [-389.943] (-393.093) * (-389.516) (-390.912) (-390.673) [-391.757] -- 0:00:19
674500 -- [-392.812] (-398.188) (-390.704) (-390.719) * [-389.294] (-392.637) (-391.765) (-393.019) -- 0:00:19
675000 -- (-395.143) (-390.336) (-390.688) [-392.317] * (-389.600) [-389.782] (-390.728) (-390.241) -- 0:00:19
Average standard deviation of split frequencies: 0.005753
675500 -- (-390.647) [-390.627] (-390.194) (-392.001) * (-390.742) [-392.309] (-390.879) (-390.853) -- 0:00:19
676000 -- (-391.545) (-391.198) (-393.067) [-389.842] * [-390.691] (-392.410) (-389.330) (-391.673) -- 0:00:19
676500 -- [-390.899] (-392.445) (-392.238) (-391.059) * (-391.490) (-389.901) (-389.892) [-390.477] -- 0:00:19
677000 -- [-392.148] (-389.564) (-389.905) (-391.896) * (-391.690) (-390.815) (-391.464) [-389.802] -- 0:00:19
677500 -- (-393.949) (-391.222) [-390.990] (-390.131) * (-391.302) (-389.752) [-394.579] (-389.735) -- 0:00:19
678000 -- (-390.721) (-390.229) (-389.339) [-389.828] * (-391.711) [-389.742] (-390.954) (-390.330) -- 0:00:18
678500 -- (-393.011) (-393.662) [-389.743] (-392.320) * (-394.938) (-390.260) (-393.976) [-391.321] -- 0:00:18
679000 -- [-391.955] (-392.254) (-389.583) (-391.290) * (-389.857) [-389.755] (-395.085) (-391.677) -- 0:00:18
679500 -- (-390.888) (-389.357) (-390.733) [-391.115] * (-389.501) [-389.650] (-390.444) (-389.565) -- 0:00:18
680000 -- (-392.258) (-394.246) (-390.952) [-392.831] * (-389.557) [-393.544] (-390.860) (-390.998) -- 0:00:18
Average standard deviation of split frequencies: 0.005310
680500 -- (-389.814) [-391.665] (-389.900) (-390.070) * (-391.483) [-395.299] (-389.549) (-391.879) -- 0:00:18
681000 -- [-389.406] (-390.764) (-389.277) (-390.743) * (-390.569) (-392.283) (-391.112) [-391.070] -- 0:00:18
681500 -- (-391.693) (-389.242) [-392.297] (-390.243) * (-391.952) [-390.209] (-391.160) (-391.305) -- 0:00:18
682000 -- [-390.358] (-390.222) (-390.040) (-390.294) * (-390.851) (-389.425) (-395.831) [-391.092] -- 0:00:18
682500 -- (-390.094) [-391.856] (-389.910) (-393.465) * (-397.072) [-390.901] (-392.115) (-389.369) -- 0:00:18
683000 -- [-390.524] (-392.836) (-389.367) (-399.950) * (-392.033) (-389.862) (-392.814) [-390.581] -- 0:00:19
683500 -- [-391.226] (-391.086) (-389.953) (-392.385) * [-391.816] (-390.553) (-392.790) (-393.813) -- 0:00:18
684000 -- (-391.905) (-394.001) (-389.247) [-391.105] * (-389.708) [-390.655] (-391.286) (-391.515) -- 0:00:18
684500 -- (-390.656) (-390.336) [-390.515] (-390.764) * (-389.725) (-390.565) (-389.718) [-391.515] -- 0:00:18
685000 -- (-395.155) (-390.423) (-392.721) [-392.181] * (-393.240) (-389.904) (-394.434) [-393.748] -- 0:00:18
Average standard deviation of split frequencies: 0.005268
685500 -- (-395.657) [-391.836] (-393.237) (-397.309) * (-390.511) [-389.350] (-391.601) (-390.851) -- 0:00:18
686000 -- (-395.357) [-392.251] (-393.077) (-390.199) * [-392.817] (-392.480) (-390.283) (-390.045) -- 0:00:18
686500 -- (-390.178) (-389.733) (-391.932) [-391.641] * (-389.863) (-393.699) (-391.121) [-395.435] -- 0:00:18
687000 -- (-392.927) [-391.263] (-394.058) (-390.063) * (-391.235) [-391.776] (-389.807) (-393.994) -- 0:00:18
687500 -- [-390.516] (-393.276) (-390.792) (-390.428) * (-391.797) (-394.328) [-390.610] (-393.243) -- 0:00:18
688000 -- (-393.217) (-391.195) [-391.063] (-390.589) * [-392.133] (-396.954) (-394.173) (-390.173) -- 0:00:18
688500 -- [-392.540] (-392.125) (-392.991) (-392.378) * [-390.764] (-394.517) (-390.297) (-390.591) -- 0:00:18
689000 -- [-392.639] (-390.987) (-394.043) (-394.574) * [-391.547] (-391.684) (-389.748) (-389.787) -- 0:00:18
689500 -- (-390.993) (-390.640) [-392.088] (-390.472) * (-391.916) (-389.592) (-391.610) [-389.060] -- 0:00:18
690000 -- (-391.209) [-392.097] (-390.961) (-391.987) * (-391.599) (-390.866) [-390.901] (-389.824) -- 0:00:18
Average standard deviation of split frequencies: 0.005187
690500 -- (-392.465) (-390.045) [-390.780] (-391.891) * [-389.739] (-392.000) (-389.777) (-391.802) -- 0:00:18
691000 -- (-390.204) [-393.130] (-395.547) (-389.696) * (-393.428) [-390.523] (-390.669) (-397.167) -- 0:00:18
691500 -- (-390.017) (-393.717) (-393.181) [-390.572] * (-392.020) [-390.295] (-395.830) (-389.590) -- 0:00:18
692000 -- (-393.399) (-393.450) (-391.339) [-394.599] * [-390.444] (-389.458) (-390.815) (-391.206) -- 0:00:18
692500 -- [-393.143] (-390.348) (-390.411) (-392.040) * (-390.996) [-390.831] (-394.101) (-393.952) -- 0:00:18
693000 -- [-394.374] (-390.064) (-392.897) (-392.960) * (-390.201) (-393.072) (-391.937) [-389.983] -- 0:00:18
693500 -- [-389.670] (-392.331) (-392.876) (-390.653) * [-391.946] (-392.525) (-391.095) (-391.658) -- 0:00:18
694000 -- (-390.984) [-390.654] (-392.957) (-391.128) * (-394.083) [-391.246] (-390.295) (-393.185) -- 0:00:18
694500 -- (-389.238) (-390.614) [-394.730] (-391.310) * (-393.511) [-390.908] (-389.009) (-391.570) -- 0:00:18
695000 -- [-393.316] (-391.283) (-392.219) (-393.597) * (-391.832) (-393.376) [-390.559] (-391.545) -- 0:00:17
Average standard deviation of split frequencies: 0.005238
695500 -- (-392.137) (-390.141) (-392.511) [-393.613] * (-394.890) [-389.382] (-391.114) (-393.168) -- 0:00:17
696000 -- [-397.056] (-391.317) (-395.921) (-393.070) * (-392.251) (-398.008) [-389.458] (-390.611) -- 0:00:17
696500 -- (-391.392) (-393.352) (-394.820) [-390.372] * (-395.193) (-397.934) (-390.015) [-390.315] -- 0:00:17
697000 -- (-393.376) (-391.671) [-391.027] (-392.623) * (-392.606) (-392.966) [-391.290] (-390.119) -- 0:00:17
697500 -- (-390.075) (-394.727) [-392.565] (-392.528) * [-393.212] (-393.592) (-389.706) (-390.768) -- 0:00:17
698000 -- (-394.803) (-393.831) [-390.504] (-390.241) * [-392.204] (-394.165) (-390.705) (-391.491) -- 0:00:17
698500 -- (-391.056) [-393.083] (-390.952) (-391.536) * (-390.546) (-391.701) [-393.131] (-391.585) -- 0:00:17
699000 -- (-392.794) (-389.962) [-391.157] (-389.035) * (-389.673) (-390.854) (-394.171) [-391.886] -- 0:00:17
699500 -- (-399.179) [-391.777] (-390.946) (-390.617) * [-391.279] (-396.880) (-389.665) (-392.908) -- 0:00:17
700000 -- (-392.908) [-390.554] (-390.852) (-390.448) * (-391.878) (-395.965) [-389.974] (-399.888) -- 0:00:17
Average standard deviation of split frequencies: 0.004979
700500 -- (-391.835) (-391.192) (-394.036) [-390.154] * (-392.537) [-390.671] (-390.691) (-396.671) -- 0:00:17
701000 -- (-395.006) [-390.171] (-392.768) (-393.405) * (-394.057) (-390.314) (-390.333) [-392.521] -- 0:00:17
701500 -- [-392.674] (-390.977) (-390.208) (-396.266) * (-391.390) [-391.192] (-390.270) (-391.323) -- 0:00:17
702000 -- (-394.228) (-393.499) [-391.453] (-395.940) * (-389.484) (-390.914) [-391.902] (-391.711) -- 0:00:17
702500 -- (-392.014) [-389.613] (-392.391) (-393.630) * (-390.663) [-391.285] (-395.299) (-390.440) -- 0:00:17
703000 -- [-390.301] (-390.076) (-389.563) (-389.257) * (-390.999) (-393.334) (-393.799) [-390.277] -- 0:00:17
703500 -- (-393.078) (-394.581) (-391.540) [-392.026] * (-389.946) (-391.595) [-391.466] (-390.690) -- 0:00:17
704000 -- [-393.171] (-396.637) (-391.062) (-391.921) * (-395.148) (-390.441) (-389.591) [-389.764] -- 0:00:17
704500 -- [-392.690] (-394.969) (-391.088) (-390.535) * (-392.114) (-392.830) (-392.248) [-390.197] -- 0:00:17
705000 -- (-395.015) [-390.451] (-391.228) (-392.518) * (-391.185) (-390.472) [-390.704] (-390.448) -- 0:00:17
Average standard deviation of split frequencies: 0.004763
705500 -- [-392.054] (-392.210) (-393.367) (-391.460) * (-390.318) (-389.473) (-391.837) [-393.522] -- 0:00:17
706000 -- (-391.208) (-390.860) [-394.769] (-391.112) * [-391.013] (-394.117) (-389.157) (-391.633) -- 0:00:17
706500 -- (-391.625) (-390.412) [-392.668] (-389.644) * (-391.283) [-393.080] (-389.250) (-393.627) -- 0:00:17
707000 -- [-389.130] (-396.560) (-394.624) (-391.692) * (-392.523) (-390.515) [-389.861] (-394.896) -- 0:00:17
707500 -- (-391.869) (-396.224) (-392.090) [-390.695] * (-392.516) (-390.218) [-390.825] (-393.251) -- 0:00:17
708000 -- (-393.261) (-392.748) (-390.718) [-392.391] * (-392.316) [-391.335] (-392.485) (-393.440) -- 0:00:17
708500 -- (-391.225) (-393.157) (-391.377) [-390.297] * (-389.870) [-392.217] (-391.732) (-395.079) -- 0:00:17
709000 -- (-393.845) (-389.866) [-391.810] (-399.657) * (-393.241) (-391.801) [-390.755] (-389.302) -- 0:00:17
709500 -- (-393.147) (-390.157) (-392.177) [-390.790] * [-391.886] (-392.289) (-390.445) (-392.653) -- 0:00:17
710000 -- (-389.475) (-393.549) [-394.513] (-390.713) * (-390.516) (-390.877) (-392.140) [-392.717] -- 0:00:17
Average standard deviation of split frequencies: 0.004732
710500 -- (-393.073) (-394.468) [-392.761] (-390.245) * (-394.440) (-390.087) [-393.370] (-391.076) -- 0:00:17
711000 -- (-395.900) (-391.126) [-391.380] (-389.940) * [-391.091] (-390.095) (-392.219) (-391.816) -- 0:00:17
711500 -- (-394.059) [-389.510] (-390.970) (-390.472) * [-392.246] (-389.603) (-393.286) (-391.444) -- 0:00:17
712000 -- (-391.384) [-391.221] (-390.759) (-394.718) * (-391.214) (-390.633) [-390.256] (-390.706) -- 0:00:16
712500 -- (-390.052) (-389.572) (-390.452) [-391.682] * (-392.719) [-391.857] (-390.855) (-390.109) -- 0:00:16
713000 -- [-390.329] (-391.087) (-390.010) (-391.055) * (-390.971) (-391.806) [-389.651] (-393.735) -- 0:00:16
713500 -- (-389.373) (-391.225) [-392.645] (-390.879) * (-391.595) (-393.230) (-392.099) [-396.389] -- 0:00:16
714000 -- (-392.130) (-390.671) (-390.415) [-390.732] * (-389.249) (-391.059) [-393.896] (-394.574) -- 0:00:16
714500 -- [-399.529] (-392.615) (-391.316) (-392.680) * [-390.510] (-393.664) (-391.000) (-390.939) -- 0:00:16
715000 -- [-392.617] (-392.103) (-391.389) (-394.923) * (-390.932) (-393.724) (-390.898) [-392.877] -- 0:00:16
Average standard deviation of split frequencies: 0.004828
715500 -- [-390.278] (-393.501) (-394.707) (-394.933) * (-392.945) [-390.323] (-389.532) (-390.265) -- 0:00:16
716000 -- (-389.824) (-391.710) (-390.815) [-392.569] * (-390.484) (-390.695) [-393.909] (-390.683) -- 0:00:16
716500 -- (-389.334) (-391.082) [-390.364] (-391.023) * (-390.586) [-392.792] (-389.282) (-391.765) -- 0:00:16
717000 -- (-389.950) (-393.338) (-390.819) [-394.570] * (-390.027) [-391.002] (-396.525) (-391.937) -- 0:00:16
717500 -- (-393.460) [-392.776] (-390.293) (-391.004) * [-392.043] (-392.724) (-395.997) (-391.937) -- 0:00:16
718000 -- (-391.457) (-393.860) (-389.651) [-391.099] * [-392.356] (-390.447) (-390.166) (-389.823) -- 0:00:16
718500 -- (-391.028) [-391.296] (-390.668) (-394.179) * (-390.490) (-390.797) (-390.786) [-389.980] -- 0:00:16
719000 -- (-390.969) [-391.939] (-394.313) (-390.299) * [-390.940] (-390.888) (-389.688) (-393.480) -- 0:00:16
719500 -- (-393.620) (-390.442) [-392.456] (-389.871) * (-391.546) [-390.447] (-395.780) (-392.073) -- 0:00:16
720000 -- (-393.312) (-390.995) (-393.598) [-390.494] * [-394.266] (-395.013) (-391.803) (-392.943) -- 0:00:16
Average standard deviation of split frequencies: 0.004535
720500 -- (-391.428) [-389.588] (-395.168) (-389.635) * (-390.140) [-395.790] (-391.770) (-391.956) -- 0:00:16
721000 -- (-394.049) [-390.269] (-396.469) (-389.739) * (-390.633) (-396.725) (-390.120) [-392.442] -- 0:00:16
721500 -- (-390.486) [-393.705] (-392.487) (-393.369) * (-391.881) (-390.537) (-391.253) [-392.559] -- 0:00:16
722000 -- [-389.136] (-395.570) (-394.535) (-394.629) * [-389.576] (-391.402) (-395.266) (-391.808) -- 0:00:16
722500 -- [-389.684] (-391.704) (-390.213) (-391.673) * (-391.954) (-389.732) [-392.267] (-393.891) -- 0:00:16
723000 -- (-390.424) (-391.321) (-390.420) [-390.909] * (-389.596) (-391.189) (-391.138) [-391.882] -- 0:00:16
723500 -- (-390.139) (-390.055) (-396.130) [-389.645] * (-389.819) (-389.407) (-389.977) [-390.717] -- 0:00:16
724000 -- [-393.961] (-394.830) (-392.530) (-392.580) * [-391.657] (-390.167) (-389.992) (-392.302) -- 0:00:16
724500 -- (-390.192) (-390.493) [-393.331] (-390.805) * (-392.041) (-390.244) [-389.976] (-390.784) -- 0:00:16
725000 -- (-390.818) (-392.643) [-392.961] (-392.767) * (-391.126) [-390.126] (-389.302) (-406.668) -- 0:00:16
Average standard deviation of split frequencies: 0.005021
725500 -- [-391.938] (-390.869) (-394.023) (-391.930) * (-397.075) (-391.406) [-392.149] (-391.641) -- 0:00:16
726000 -- [-396.725] (-391.599) (-392.940) (-392.186) * (-390.428) [-390.448] (-394.397) (-394.278) -- 0:00:16
726500 -- [-390.791] (-395.676) (-391.073) (-393.500) * (-389.711) [-389.346] (-395.230) (-392.259) -- 0:00:16
727000 -- [-389.377] (-395.029) (-391.553) (-394.044) * (-390.503) (-390.640) (-391.352) [-394.811] -- 0:00:16
727500 -- [-394.305] (-392.436) (-391.472) (-392.563) * (-390.303) (-398.168) (-389.806) [-389.181] -- 0:00:16
728000 -- (-394.259) [-391.034] (-391.514) (-392.255) * (-390.870) [-389.896] (-389.663) (-389.940) -- 0:00:16
728500 -- (-394.937) (-390.448) (-390.952) [-392.516] * (-390.746) (-390.448) [-391.544] (-391.033) -- 0:00:16
729000 -- [-390.372] (-390.891) (-392.137) (-390.524) * (-391.231) (-389.815) (-391.482) [-390.107] -- 0:00:15
729500 -- (-394.714) (-395.029) (-391.720) [-389.625] * [-391.197] (-389.663) (-394.761) (-390.633) -- 0:00:15
730000 -- (-391.889) (-390.194) [-390.603] (-392.913) * (-390.589) (-391.377) [-389.342] (-391.135) -- 0:00:15
Average standard deviation of split frequencies: 0.005161
730500 -- (-391.341) [-390.455] (-391.337) (-390.716) * (-390.059) [-397.300] (-391.272) (-392.936) -- 0:00:15
731000 -- (-390.895) (-393.186) (-390.732) [-392.773] * (-389.580) (-392.390) (-393.542) [-395.300] -- 0:00:15
731500 -- (-392.007) (-391.756) [-389.207] (-391.828) * (-390.138) (-390.702) (-394.377) [-390.183] -- 0:00:15
732000 -- (-391.482) (-391.120) [-390.300] (-389.998) * (-397.257) [-393.556] (-391.582) (-391.044) -- 0:00:15
732500 -- (-390.140) (-389.850) [-390.224] (-392.362) * [-389.650] (-390.927) (-391.860) (-390.782) -- 0:00:15
733000 -- (-390.722) (-390.436) (-394.133) [-389.707] * (-389.855) (-391.779) (-390.131) [-391.351] -- 0:00:15
733500 -- (-390.059) (-391.450) (-392.873) [-389.744] * (-390.649) (-390.888) (-390.186) [-394.896] -- 0:00:15
734000 -- [-391.851] (-390.715) (-391.955) (-390.873) * (-389.526) [-396.574] (-393.179) (-392.434) -- 0:00:15
734500 -- (-391.093) (-391.345) (-392.532) [-394.537] * (-395.276) [-390.475] (-390.312) (-391.893) -- 0:00:15
735000 -- (-393.140) [-391.924] (-394.999) (-393.418) * (-392.533) [-389.969] (-391.883) (-392.459) -- 0:00:15
Average standard deviation of split frequencies: 0.005807
735500 -- (-391.772) (-394.395) [-390.139] (-390.189) * [-391.963] (-391.062) (-392.709) (-394.229) -- 0:00:15
736000 -- (-390.585) (-389.849) [-390.846] (-392.582) * [-391.569] (-392.128) (-391.178) (-396.844) -- 0:00:15
736500 -- (-392.550) (-392.695) [-392.330] (-390.153) * [-391.710] (-390.373) (-390.604) (-393.112) -- 0:00:15
737000 -- (-394.311) [-391.701] (-393.864) (-392.029) * (-390.325) (-391.597) (-389.820) [-391.751] -- 0:00:15
737500 -- (-390.750) [-391.092] (-392.017) (-392.671) * (-394.737) (-391.159) (-390.186) [-389.825] -- 0:00:15
738000 -- (-390.590) (-396.816) (-390.313) [-389.441] * (-389.501) [-390.047] (-390.838) (-390.689) -- 0:00:15
738500 -- (-393.054) [-389.726] (-389.308) (-390.602) * [-390.026] (-389.448) (-390.277) (-391.707) -- 0:00:15
739000 -- (-390.709) (-391.966) [-389.754] (-391.377) * (-390.499) [-390.467] (-390.274) (-389.288) -- 0:00:15
739500 -- (-391.406) (-391.457) [-390.968] (-393.968) * [-390.707] (-390.731) (-390.560) (-395.599) -- 0:00:15
740000 -- (-391.755) (-390.893) [-390.836] (-390.519) * (-391.983) (-392.881) [-390.276] (-394.442) -- 0:00:15
Average standard deviation of split frequencies: 0.005601
740500 -- (-393.365) (-389.646) (-392.456) [-391.466] * [-389.734] (-394.178) (-392.169) (-390.714) -- 0:00:15
741000 -- (-390.591) [-390.159] (-389.525) (-391.945) * (-390.962) (-391.616) (-391.794) [-390.190] -- 0:00:15
741500 -- (-390.732) (-389.380) [-390.605] (-396.140) * [-393.027] (-389.260) (-392.312) (-389.728) -- 0:00:15
742000 -- (-393.587) [-390.157] (-390.563) (-397.040) * [-389.343] (-389.856) (-395.205) (-393.962) -- 0:00:15
742500 -- (-392.709) (-391.593) (-392.991) [-406.480] * (-391.346) (-391.824) [-391.085] (-392.875) -- 0:00:15
743000 -- [-390.446] (-391.411) (-390.659) (-394.115) * (-389.722) (-390.824) (-391.604) [-392.342] -- 0:00:15
743500 -- (-392.318) [-393.199] (-391.889) (-390.977) * [-391.711] (-390.597) (-391.508) (-391.754) -- 0:00:15
744000 -- (-395.590) (-390.885) [-392.390] (-393.688) * (-389.708) (-392.289) [-390.970] (-390.549) -- 0:00:15
744500 -- (-392.951) (-393.008) [-391.543] (-390.121) * [-391.416] (-392.711) (-391.764) (-390.020) -- 0:00:15
745000 -- [-392.023] (-391.692) (-392.308) (-391.584) * (-389.292) (-395.284) [-389.950] (-391.584) -- 0:00:15
Average standard deviation of split frequencies: 0.006082
745500 -- (-395.892) (-391.306) (-391.800) [-391.797] * (-390.665) [-391.862] (-393.172) (-390.527) -- 0:00:15
746000 -- (-393.787) (-391.837) [-391.567] (-392.884) * (-395.080) (-391.822) (-392.096) [-390.786] -- 0:00:14
746500 -- (-392.659) (-392.798) (-392.043) [-392.912] * (-392.803) (-390.240) (-389.606) [-393.076] -- 0:00:14
747000 -- (-390.082) (-391.520) [-389.545] (-394.144) * [-391.121] (-392.680) (-389.249) (-391.515) -- 0:00:14
747500 -- (-392.170) (-390.002) [-390.947] (-394.711) * (-394.595) (-390.071) (-391.046) [-389.306] -- 0:00:14
748000 -- [-391.120] (-391.156) (-389.585) (-390.998) * (-392.101) (-397.203) (-390.902) [-392.491] -- 0:00:14
748500 -- (-392.613) (-391.371) (-390.912) [-390.642] * (-394.291) (-390.682) (-392.452) [-389.737] -- 0:00:14
749000 -- [-391.266] (-389.615) (-390.427) (-389.708) * [-391.034] (-390.048) (-393.319) (-389.950) -- 0:00:14
749500 -- [-392.783] (-394.505) (-389.857) (-391.060) * (-391.010) [-391.415] (-389.494) (-391.303) -- 0:00:14
750000 -- (-391.863) (-391.856) (-389.197) [-390.963] * (-393.357) (-390.816) [-392.793] (-390.881) -- 0:00:14
Average standard deviation of split frequencies: 0.006358
750500 -- [-392.776] (-393.716) (-389.257) (-391.875) * [-390.192] (-393.961) (-392.638) (-390.721) -- 0:00:14
751000 -- (-396.090) (-392.313) (-391.163) [-390.564] * [-389.683] (-391.561) (-398.008) (-392.598) -- 0:00:14
751500 -- (-390.403) [-392.059] (-394.958) (-391.457) * (-393.210) (-393.994) (-390.882) [-392.211] -- 0:00:14
752000 -- [-393.493] (-392.509) (-395.597) (-396.865) * (-390.199) [-393.041] (-394.033) (-391.895) -- 0:00:14
752500 -- (-392.523) [-389.478] (-390.670) (-393.872) * (-390.554) (-389.769) [-393.846] (-392.038) -- 0:00:14
753000 -- [-394.678] (-389.609) (-390.341) (-396.033) * (-393.211) (-393.121) (-393.233) [-390.287] -- 0:00:14
753500 -- (-390.912) (-390.423) (-394.346) [-390.176] * [-391.696] (-390.424) (-389.833) (-389.087) -- 0:00:14
754000 -- (-389.618) [-389.381] (-390.307) (-392.739) * [-391.868] (-395.629) (-391.257) (-394.939) -- 0:00:14
754500 -- (-389.137) (-391.254) [-390.258] (-390.704) * (-390.223) (-390.511) [-389.978] (-392.251) -- 0:00:14
755000 -- (-389.369) (-393.321) [-389.920] (-391.626) * (-395.448) (-397.335) [-391.498] (-390.697) -- 0:00:14
Average standard deviation of split frequencies: 0.006002
755500 -- (-391.001) [-393.080] (-392.581) (-392.102) * (-393.206) (-391.853) [-391.861] (-391.056) -- 0:00:14
756000 -- (-393.779) (-394.692) (-394.732) [-389.354] * (-391.476) (-394.718) [-392.145] (-392.528) -- 0:00:14
756500 -- [-393.436] (-390.224) (-393.456) (-390.412) * (-390.501) (-395.571) [-391.443] (-391.850) -- 0:00:14
757000 -- (-392.501) (-389.945) (-393.303) [-389.442] * (-389.941) [-393.012] (-391.137) (-391.341) -- 0:00:14
757500 -- (-392.019) (-392.751) (-390.142) [-391.141] * (-390.432) (-392.441) (-390.620) [-391.064] -- 0:00:14
758000 -- (-391.879) (-394.041) [-392.595] (-392.348) * (-392.414) [-393.320] (-393.183) (-392.506) -- 0:00:14
758500 -- (-390.646) (-390.703) [-389.939] (-390.801) * [-392.419] (-392.179) (-395.193) (-392.105) -- 0:00:14
759000 -- (-393.789) [-390.748] (-393.010) (-389.822) * (-391.490) [-391.406] (-389.807) (-391.532) -- 0:00:14
759500 -- (-391.645) [-391.514] (-393.287) (-389.540) * (-390.879) (-391.109) [-389.227] (-391.857) -- 0:00:14
760000 -- [-391.567] (-395.563) (-391.082) (-392.818) * (-391.245) (-389.113) [-392.058] (-395.132) -- 0:00:14
Average standard deviation of split frequencies: 0.005784
760500 -- (-389.892) (-394.002) (-390.742) [-390.232] * [-392.908] (-389.584) (-390.868) (-389.401) -- 0:00:14
761000 -- [-390.729] (-391.924) (-392.535) (-396.051) * (-390.774) [-389.097] (-389.813) (-388.956) -- 0:00:14
761500 -- [-390.973] (-393.971) (-391.638) (-393.820) * (-390.404) [-390.457] (-393.534) (-390.308) -- 0:00:14
762000 -- (-392.081) [-393.395] (-390.856) (-390.966) * (-390.696) (-390.981) (-394.474) [-390.823] -- 0:00:14
762500 -- [-392.736] (-390.590) (-393.824) (-392.382) * (-390.305) (-393.484) [-391.728] (-391.406) -- 0:00:14
763000 -- [-397.122] (-392.198) (-392.992) (-393.716) * (-392.174) (-391.000) [-389.339] (-393.210) -- 0:00:13
763500 -- (-392.822) [-394.465] (-391.462) (-390.550) * (-394.523) [-390.440] (-391.526) (-393.422) -- 0:00:13
764000 -- (-389.608) (-394.825) (-391.368) [-393.731] * [-390.608] (-392.149) (-395.907) (-390.583) -- 0:00:13
764500 -- (-390.150) (-393.985) [-396.020] (-390.353) * (-396.002) [-392.541] (-393.391) (-394.031) -- 0:00:13
765000 -- (-397.990) (-391.561) (-391.770) [-394.061] * (-392.116) [-390.924] (-390.753) (-391.142) -- 0:00:13
Average standard deviation of split frequencies: 0.005116
765500 -- [-391.995] (-391.671) (-390.421) (-391.999) * [-392.236] (-390.933) (-394.183) (-391.063) -- 0:00:13
766000 -- (-390.910) [-389.661] (-390.981) (-390.493) * [-390.491] (-391.059) (-390.230) (-391.271) -- 0:00:13
766500 -- (-392.914) (-391.452) [-390.391] (-390.754) * (-390.437) (-394.673) (-395.108) [-392.149] -- 0:00:13
767000 -- (-396.633) [-391.721] (-392.457) (-393.887) * (-391.433) [-394.468] (-390.417) (-392.153) -- 0:00:13
767500 -- [-394.140] (-390.215) (-392.490) (-392.771) * (-391.051) (-389.464) [-391.220] (-392.784) -- 0:00:13
768000 -- (-390.228) (-393.183) [-391.602] (-390.046) * [-390.168] (-392.709) (-391.081) (-392.751) -- 0:00:13
768500 -- (-389.809) [-389.772] (-392.234) (-391.689) * (-393.168) (-392.512) (-393.305) [-389.894] -- 0:00:13
769000 -- (-392.163) (-391.587) [-395.102] (-390.498) * [-390.013] (-390.517) (-390.740) (-391.633) -- 0:00:13
769500 -- [-389.149] (-391.355) (-395.214) (-392.334) * [-389.604] (-391.122) (-392.221) (-394.061) -- 0:00:13
770000 -- (-392.373) (-392.765) [-398.422] (-390.072) * [-389.179] (-390.693) (-392.610) (-390.969) -- 0:00:13
Average standard deviation of split frequencies: 0.004893
770500 -- [-389.626] (-389.979) (-392.617) (-391.417) * (-392.747) (-394.048) (-399.679) [-392.518] -- 0:00:13
771000 -- (-389.819) (-392.093) (-391.345) [-389.939] * (-391.675) [-390.177] (-393.145) (-393.038) -- 0:00:13
771500 -- (-393.019) (-394.251) (-394.862) [-392.638] * (-391.316) (-390.560) [-393.722] (-391.106) -- 0:00:13
772000 -- (-394.559) (-394.429) (-390.205) [-391.786] * (-393.057) (-391.618) [-390.807] (-389.547) -- 0:00:13
772500 -- (-395.362) [-389.696] (-390.695) (-392.530) * (-392.555) (-393.312) (-398.730) [-391.017] -- 0:00:13
773000 -- [-396.388] (-389.832) (-390.629) (-391.385) * [-394.721] (-393.350) (-394.053) (-390.231) -- 0:00:13
773500 -- [-391.309] (-396.232) (-390.365) (-391.125) * [-393.260] (-389.388) (-390.994) (-392.334) -- 0:00:13
774000 -- (-389.977) (-391.618) (-390.129) [-391.607] * (-391.203) [-389.376] (-389.646) (-392.476) -- 0:00:13
774500 -- (-392.553) [-393.293] (-390.780) (-390.197) * (-393.424) [-390.028] (-392.471) (-391.903) -- 0:00:13
775000 -- (-391.444) (-389.491) (-389.566) [-389.449] * (-390.037) (-390.433) (-397.409) [-390.450] -- 0:00:13
Average standard deviation of split frequencies: 0.004974
775500 -- (-391.476) (-389.293) [-389.533] (-390.599) * [-390.818] (-393.900) (-391.094) (-389.489) -- 0:00:13
776000 -- (-390.908) (-390.370) [-389.643] (-390.834) * (-395.037) (-391.169) [-389.470] (-391.810) -- 0:00:13
776500 -- (-390.312) (-390.368) [-390.304] (-390.150) * (-396.725) (-394.193) [-389.455] (-389.479) -- 0:00:13
777000 -- (-390.998) (-391.135) (-390.693) [-389.563] * (-390.847) [-389.498] (-390.088) (-389.802) -- 0:00:13
777500 -- (-393.293) [-389.507] (-392.955) (-393.307) * (-391.822) [-390.160] (-391.264) (-390.270) -- 0:00:13
778000 -- [-390.173] (-391.226) (-393.571) (-392.366) * [-394.201] (-389.628) (-391.398) (-389.833) -- 0:00:13
778500 -- (-393.408) (-391.527) (-390.012) [-390.923] * [-392.572] (-390.412) (-391.476) (-393.456) -- 0:00:13
779000 -- [-397.878] (-390.433) (-391.235) (-389.715) * [-392.086] (-390.625) (-389.566) (-390.503) -- 0:00:13
779500 -- (-389.400) (-389.571) (-392.243) [-393.245] * (-394.295) (-391.098) (-391.507) [-389.789] -- 0:00:13
780000 -- (-390.294) (-392.431) (-390.873) [-390.395] * (-391.823) (-389.147) (-390.993) [-393.209] -- 0:00:12
Average standard deviation of split frequencies: 0.005170
780500 -- [-389.518] (-394.274) (-391.452) (-389.432) * (-394.137) (-391.398) [-391.573] (-397.415) -- 0:00:12
781000 -- (-394.685) (-390.479) (-390.517) [-389.548] * (-391.100) [-393.042] (-389.782) (-391.662) -- 0:00:12
781500 -- (-390.696) [-391.293] (-390.524) (-389.723) * [-389.889] (-391.691) (-389.509) (-389.897) -- 0:00:12
782000 -- (-390.479) (-392.287) (-394.296) [-391.289] * (-391.529) (-389.569) [-389.363] (-392.367) -- 0:00:12
782500 -- (-389.793) [-389.760] (-389.978) (-390.678) * (-393.026) (-391.263) [-390.232] (-392.073) -- 0:00:12
783000 -- (-391.452) (-390.247) [-390.672] (-392.104) * [-395.719] (-393.660) (-389.322) (-391.190) -- 0:00:12
783500 -- [-391.941] (-391.955) (-392.216) (-391.045) * (-393.241) [-390.383] (-389.366) (-389.859) -- 0:00:12
784000 -- (-394.720) (-394.824) [-392.476] (-392.398) * (-391.163) [-391.446] (-390.113) (-392.815) -- 0:00:12
784500 -- [-390.254] (-390.251) (-390.340) (-391.543) * [-392.987] (-389.954) (-391.600) (-393.927) -- 0:00:12
785000 -- (-394.511) [-389.640] (-391.471) (-393.108) * (-390.532) (-390.067) [-391.438] (-391.972) -- 0:00:12
Average standard deviation of split frequencies: 0.004798
785500 -- [-393.772] (-390.808) (-391.420) (-392.321) * [-389.860] (-389.792) (-391.163) (-390.732) -- 0:00:12
786000 -- (-389.729) (-390.278) [-390.820] (-392.372) * (-391.638) [-390.838] (-389.827) (-390.757) -- 0:00:12
786500 -- (-390.782) (-394.140) [-391.740] (-390.964) * (-391.840) [-390.813] (-389.838) (-392.711) -- 0:00:12
787000 -- (-390.892) [-390.884] (-394.154) (-391.313) * (-391.829) (-390.852) (-389.375) [-392.143] -- 0:00:12
787500 -- [-392.477] (-389.538) (-398.549) (-390.912) * [-389.556] (-391.100) (-390.157) (-390.275) -- 0:00:12
788000 -- (-394.657) (-390.547) [-392.558] (-391.616) * [-390.620] (-390.920) (-389.453) (-390.879) -- 0:00:12
788500 -- (-390.867) [-391.234] (-396.241) (-390.329) * [-389.729] (-390.258) (-389.865) (-389.264) -- 0:00:12
789000 -- [-392.710] (-391.223) (-396.316) (-390.052) * [-389.273] (-390.933) (-389.515) (-390.435) -- 0:00:12
789500 -- (-393.229) (-390.378) (-391.944) [-391.108] * [-389.841] (-395.302) (-394.813) (-393.546) -- 0:00:12
790000 -- (-396.422) [-389.182] (-392.061) (-389.836) * (-390.710) [-390.728] (-391.373) (-391.118) -- 0:00:12
Average standard deviation of split frequencies: 0.004849
790500 -- [-390.009] (-393.944) (-396.989) (-392.452) * (-390.840) [-389.294] (-393.580) (-393.265) -- 0:00:12
791000 -- (-389.627) (-392.802) [-391.299] (-391.342) * (-390.821) [-392.228] (-392.753) (-389.529) -- 0:00:12
791500 -- (-389.734) [-392.885] (-389.287) (-390.245) * (-390.666) (-389.146) [-389.621] (-390.967) -- 0:00:12
792000 -- (-392.053) (-390.610) (-390.485) [-389.848] * [-390.789] (-391.910) (-392.329) (-393.600) -- 0:00:12
792500 -- (-394.002) (-390.908) [-389.295] (-391.636) * (-391.926) [-390.015] (-396.433) (-395.764) -- 0:00:12
793000 -- (-391.214) [-390.035] (-389.686) (-391.571) * (-391.593) (-395.239) (-392.575) [-390.906] -- 0:00:12
793500 -- (-391.772) (-397.728) [-389.823] (-389.976) * (-394.775) [-393.049] (-395.381) (-393.967) -- 0:00:12
794000 -- (-391.762) (-391.974) (-389.558) [-395.114] * [-394.226] (-390.378) (-392.648) (-390.759) -- 0:00:12
794500 -- (-394.833) (-390.641) [-392.231] (-390.691) * (-391.413) [-392.242] (-392.878) (-394.731) -- 0:00:12
795000 -- (-393.930) [-390.099] (-392.380) (-391.969) * (-391.810) [-391.419] (-395.242) (-392.824) -- 0:00:12
Average standard deviation of split frequencies: 0.005014
795500 -- (-394.567) (-395.170) [-391.062] (-393.425) * (-391.918) [-390.885] (-393.682) (-394.615) -- 0:00:12
796000 -- [-391.609] (-393.243) (-393.748) (-390.862) * (-391.682) [-390.799] (-391.457) (-391.923) -- 0:00:12
796500 -- (-393.321) (-394.160) (-390.288) [-392.036] * (-393.330) [-391.096] (-395.811) (-392.684) -- 0:00:12
797000 -- (-394.813) (-392.096) (-389.939) [-390.948] * [-393.505] (-390.664) (-390.457) (-388.988) -- 0:00:11
797500 -- (-393.256) (-390.448) (-389.964) [-393.331] * (-389.480) (-391.204) (-390.977) [-390.206] -- 0:00:11
798000 -- (-394.123) (-392.213) (-389.702) [-392.458] * (-391.456) [-389.625] (-390.284) (-389.736) -- 0:00:11
798500 -- (-391.822) (-393.900) [-390.950] (-393.553) * (-391.478) (-390.380) [-391.637] (-393.422) -- 0:00:11
799000 -- (-391.254) (-396.277) [-390.527] (-392.615) * [-390.762] (-391.073) (-390.759) (-390.649) -- 0:00:11
799500 -- (-389.035) (-392.823) (-389.405) [-390.138] * (-390.438) (-392.232) [-389.388] (-392.049) -- 0:00:11
800000 -- (-389.838) (-393.425) (-392.517) [-393.607] * (-390.476) (-391.053) (-391.117) [-390.987] -- 0:00:11
Average standard deviation of split frequencies: 0.004592
800500 -- (-392.088) [-389.604] (-391.828) (-395.054) * [-389.931] (-396.041) (-390.849) (-390.626) -- 0:00:11
801000 -- (-398.308) (-389.652) (-389.905) [-390.785] * (-389.731) (-391.513) (-391.178) [-390.910] -- 0:00:11
801500 -- (-396.317) (-388.920) [-390.248] (-390.050) * (-390.631) (-390.464) (-391.035) [-391.394] -- 0:00:11
802000 -- (-389.740) (-389.701) (-389.928) [-390.736] * [-389.397] (-389.417) (-397.513) (-392.538) -- 0:00:11
802500 -- (-389.488) [-391.160] (-390.852) (-391.616) * (-389.811) [-391.776] (-397.768) (-390.484) -- 0:00:11
803000 -- (-390.601) [-390.149] (-395.661) (-392.881) * [-390.602] (-392.385) (-390.633) (-391.337) -- 0:00:11
803500 -- (-390.160) (-389.593) [-395.619] (-393.721) * (-390.721) [-390.931] (-391.403) (-391.989) -- 0:00:11
804000 -- (-392.685) (-392.731) (-393.778) [-390.086] * (-390.372) [-391.455] (-391.764) (-392.743) -- 0:00:11
804500 -- (-391.863) [-393.264] (-392.089) (-389.992) * (-390.915) (-391.154) (-391.621) [-390.792] -- 0:00:11
805000 -- (-390.821) [-390.861] (-392.061) (-391.411) * (-392.501) (-393.035) (-390.786) [-391.770] -- 0:00:11
Average standard deviation of split frequencies: 0.004874
805500 -- (-393.557) (-390.546) [-390.831] (-395.891) * (-394.398) (-393.397) [-391.459] (-397.345) -- 0:00:11
806000 -- (-391.171) (-389.790) [-389.822] (-391.143) * (-393.422) (-393.955) [-391.777] (-395.752) -- 0:00:11
806500 -- [-391.129] (-390.340) (-392.438) (-394.327) * (-391.668) [-391.118] (-390.981) (-391.198) -- 0:00:11
807000 -- [-390.227] (-390.220) (-390.662) (-394.348) * (-389.251) (-393.479) [-389.973] (-400.022) -- 0:00:11
807500 -- (-390.227) (-391.966) [-391.590] (-389.601) * (-389.488) (-391.549) (-392.018) [-392.761] -- 0:00:11
808000 -- (-390.746) (-389.591) [-391.907] (-389.550) * (-391.661) (-394.744) [-389.852] (-389.856) -- 0:00:11
808500 -- [-389.801] (-391.177) (-392.554) (-395.114) * (-389.709) (-395.317) [-389.653] (-390.644) -- 0:00:11
809000 -- (-390.426) [-389.239] (-392.796) (-395.301) * (-389.727) [-392.343] (-391.728) (-390.862) -- 0:00:11
809500 -- (-389.130) (-389.751) [-391.701] (-397.446) * (-391.484) (-393.093) (-391.263) [-391.895] -- 0:00:11
810000 -- (-389.122) [-391.013] (-392.895) (-396.118) * (-394.024) [-391.468] (-393.105) (-392.512) -- 0:00:11
Average standard deviation of split frequencies: 0.005350
810500 -- (-389.394) (-391.432) [-389.462] (-391.830) * (-391.907) (-389.943) (-392.568) [-390.247] -- 0:00:11
811000 -- (-389.823) [-392.867] (-391.754) (-391.891) * (-391.319) [-389.497] (-393.717) (-392.496) -- 0:00:11
811500 -- [-389.685] (-389.606) (-392.205) (-391.019) * [-389.812] (-390.789) (-391.183) (-389.565) -- 0:00:11
812000 -- (-389.072) (-390.977) [-389.152] (-399.655) * (-394.977) [-393.068] (-393.771) (-390.763) -- 0:00:11
812500 -- (-390.377) (-390.917) [-390.406] (-393.265) * (-391.055) [-394.321] (-400.571) (-398.827) -- 0:00:11
813000 -- [-389.799] (-390.809) (-390.249) (-392.398) * (-395.187) (-402.995) (-391.507) [-390.764] -- 0:00:11
813500 -- (-396.655) [-392.148] (-393.749) (-392.991) * [-392.472] (-393.671) (-390.383) (-392.060) -- 0:00:11
814000 -- (-391.754) [-392.556] (-391.467) (-391.730) * (-390.511) [-394.207] (-390.310) (-394.339) -- 0:00:10
814500 -- [-391.870] (-389.919) (-391.965) (-391.181) * [-394.317] (-393.743) (-391.105) (-394.302) -- 0:00:10
815000 -- [-391.339] (-389.428) (-389.329) (-392.431) * (-390.847) (-392.679) [-390.088] (-395.219) -- 0:00:10
Average standard deviation of split frequencies: 0.005122
815500 -- [-391.559] (-389.374) (-392.196) (-395.746) * (-392.481) (-389.411) [-391.486] (-394.508) -- 0:00:10
816000 -- (-391.408) [-391.579] (-393.101) (-391.843) * [-390.620] (-391.458) (-393.508) (-389.929) -- 0:00:10
816500 -- (-390.666) [-392.178] (-392.981) (-391.232) * (-390.501) (-390.458) (-390.313) [-390.592] -- 0:00:10
817000 -- [-390.750] (-391.579) (-391.695) (-389.356) * (-390.799) [-390.507] (-392.224) (-390.278) -- 0:00:10
817500 -- [-389.585] (-392.240) (-392.742) (-390.723) * (-395.741) (-394.493) [-391.965] (-394.695) -- 0:00:10
818000 -- (-391.103) (-390.462) (-399.414) [-391.616] * [-393.238] (-392.074) (-393.464) (-389.610) -- 0:00:10
818500 -- (-391.144) (-394.445) (-390.125) [-390.706] * (-389.921) (-394.871) [-391.642] (-390.623) -- 0:00:10
819000 -- [-394.425] (-391.065) (-393.129) (-392.469) * (-390.092) (-393.646) [-391.577] (-390.123) -- 0:00:10
819500 -- (-392.192) [-389.405] (-390.483) (-392.405) * (-392.654) (-390.830) [-391.461] (-390.910) -- 0:00:10
820000 -- [-391.708] (-390.885) (-391.956) (-394.331) * (-390.638) (-392.094) [-394.821] (-390.733) -- 0:00:10
Average standard deviation of split frequencies: 0.004863
820500 -- (-391.966) (-390.653) (-394.225) [-391.950] * (-391.744) (-390.472) [-389.111] (-394.137) -- 0:00:10
821000 -- (-393.008) (-390.961) (-391.387) [-391.963] * (-397.209) [-391.607] (-392.171) (-389.896) -- 0:00:10
821500 -- (-390.968) (-389.644) (-390.182) [-393.314] * (-395.202) [-391.889] (-391.605) (-390.566) -- 0:00:10
822000 -- [-390.392] (-389.856) (-392.211) (-392.825) * (-392.261) (-391.697) [-391.633] (-390.279) -- 0:00:10
822500 -- (-392.975) (-391.603) (-391.277) [-392.589] * (-394.516) (-389.635) (-391.056) [-389.660] -- 0:00:10
823000 -- (-392.183) [-392.464] (-389.979) (-393.824) * (-390.639) (-390.792) (-390.564) [-394.152] -- 0:00:10
823500 -- (-390.670) (-390.166) [-390.625] (-391.756) * (-392.091) [-389.648] (-389.494) (-395.589) -- 0:00:10
824000 -- (-391.408) (-393.395) (-391.724) [-390.948] * (-393.623) [-391.448] (-392.941) (-390.399) -- 0:00:10
824500 -- [-390.684] (-394.300) (-391.610) (-389.775) * (-390.623) [-395.415] (-394.606) (-390.690) -- 0:00:10
825000 -- (-390.347) (-396.031) [-393.155] (-389.334) * (-390.088) (-389.907) (-391.235) [-390.726] -- 0:00:10
Average standard deviation of split frequencies: 0.004756
825500 -- (-391.641) [-389.780] (-391.242) (-391.221) * (-392.346) (-394.442) [-391.261] (-394.556) -- 0:00:10
826000 -- (-392.038) [-391.350] (-391.792) (-389.265) * (-397.745) (-390.765) [-394.101] (-394.519) -- 0:00:10
826500 -- (-391.509) [-396.481] (-391.996) (-390.974) * (-392.778) (-389.472) (-389.083) [-393.112] -- 0:00:10
827000 -- (-392.833) [-392.325] (-392.653) (-391.912) * (-390.620) [-390.668] (-392.217) (-389.526) -- 0:00:10
827500 -- (-392.636) (-393.592) [-389.519] (-397.843) * (-390.156) [-391.051] (-392.720) (-394.509) -- 0:00:10
828000 -- (-392.381) [-393.975] (-390.203) (-390.616) * (-390.728) [-390.796] (-395.646) (-391.821) -- 0:00:10
828500 -- (-390.678) (-392.523) (-392.542) [-391.126] * [-388.970] (-390.410) (-393.632) (-390.214) -- 0:00:10
829000 -- (-390.591) (-394.302) (-391.006) [-393.626] * (-392.068) (-390.890) (-389.738) [-389.041] -- 0:00:10
829500 -- [-391.747] (-390.928) (-391.529) (-391.686) * (-391.694) (-390.643) (-393.848) [-390.356] -- 0:00:10
830000 -- [-394.325] (-390.835) (-394.166) (-393.634) * [-389.827] (-392.874) (-396.084) (-389.516) -- 0:00:10
Average standard deviation of split frequencies: 0.004918
830500 -- (-392.713) (-390.985) (-391.348) [-393.531] * (-393.134) (-389.982) [-390.821] (-390.700) -- 0:00:10
831000 -- (-390.862) (-391.565) (-389.789) [-391.153] * (-392.395) (-390.935) (-391.693) [-393.911] -- 0:00:09
831500 -- [-390.930] (-390.860) (-393.867) (-392.645) * (-392.674) (-392.662) (-394.148) [-390.755] -- 0:00:09
832000 -- (-396.322) (-390.586) [-390.118] (-391.949) * (-392.427) [-390.239] (-394.280) (-390.332) -- 0:00:09
832500 -- [-392.509] (-392.839) (-391.750) (-392.230) * (-393.192) (-389.587) [-390.225] (-392.138) -- 0:00:09
833000 -- (-392.018) (-393.012) (-395.701) [-390.942] * (-392.459) (-392.668) [-392.443] (-391.471) -- 0:00:09
833500 -- [-391.716] (-391.058) (-392.258) (-399.972) * (-390.046) (-395.078) [-390.436] (-391.947) -- 0:00:09
834000 -- (-391.248) (-397.113) (-390.764) [-393.548] * (-391.253) (-394.133) (-394.886) [-389.535] -- 0:00:09
834500 -- (-393.536) (-394.643) (-389.407) [-390.800] * (-392.491) (-394.153) (-391.734) [-390.072] -- 0:00:09
835000 -- [-390.325] (-395.524) (-390.945) (-391.040) * (-392.381) (-392.074) (-391.850) [-389.526] -- 0:00:09
Average standard deviation of split frequencies: 0.005000
835500 -- (-391.667) [-390.541] (-393.209) (-390.817) * (-392.088) (-394.561) (-391.170) [-390.205] -- 0:00:09
836000 -- (-390.993) [-391.871] (-390.605) (-390.947) * (-394.193) (-390.687) [-390.907] (-389.223) -- 0:00:09
836500 -- (-392.084) [-390.703] (-390.027) (-394.970) * (-393.724) (-389.288) (-390.548) [-389.372] -- 0:00:09
837000 -- (-394.051) [-390.964] (-393.277) (-391.105) * [-396.317] (-392.408) (-392.428) (-390.153) -- 0:00:09
837500 -- (-395.917) (-389.468) (-397.736) [-391.252] * (-392.524) [-390.564] (-390.232) (-393.327) -- 0:00:09
838000 -- (-394.273) [-391.470] (-389.582) (-393.669) * (-391.278) [-392.403] (-391.206) (-394.216) -- 0:00:09
838500 -- [-391.790] (-390.475) (-392.148) (-389.872) * [-398.397] (-391.270) (-391.670) (-391.905) -- 0:00:09
839000 -- [-392.893] (-392.051) (-390.584) (-392.864) * (-398.831) [-392.361] (-393.406) (-390.638) -- 0:00:09
839500 -- (-394.302) (-393.028) (-395.717) [-390.728] * (-391.556) [-392.232] (-393.365) (-394.327) -- 0:00:09
840000 -- (-390.468) (-394.656) (-396.277) [-389.139] * (-392.175) (-392.209) [-391.592] (-395.919) -- 0:00:09
Average standard deviation of split frequencies: 0.004897
840500 -- [-391.547] (-391.342) (-390.935) (-390.796) * [-393.137] (-392.192) (-391.461) (-390.241) -- 0:00:09
841000 -- (-391.929) [-389.890] (-391.402) (-391.515) * [-389.554] (-391.014) (-390.699) (-392.132) -- 0:00:09
841500 -- (-390.551) [-391.194] (-391.243) (-391.625) * (-389.713) (-391.341) [-393.046] (-390.931) -- 0:00:09
842000 -- (-390.005) [-393.786] (-391.330) (-389.719) * [-391.694] (-392.226) (-393.737) (-391.472) -- 0:00:09
842500 -- [-391.336] (-392.331) (-392.186) (-390.446) * (-395.527) (-390.557) [-391.094] (-392.065) -- 0:00:09
843000 -- (-390.404) (-394.259) [-389.803] (-391.357) * (-392.697) (-392.315) [-392.112] (-392.498) -- 0:00:09
843500 -- (-390.897) (-391.434) [-391.571] (-393.091) * (-391.377) (-391.629) [-391.514] (-393.635) -- 0:00:09
844000 -- (-393.119) (-390.672) (-389.813) [-391.931] * (-391.300) [-390.761] (-393.189) (-390.842) -- 0:00:09
844500 -- (-392.865) [-391.086] (-390.429) (-393.297) * (-391.953) (-394.681) [-389.996] (-390.074) -- 0:00:09
845000 -- (-391.973) [-389.364] (-390.111) (-390.034) * (-393.094) (-392.891) [-390.533] (-393.321) -- 0:00:09
Average standard deviation of split frequencies: 0.004829
845500 -- (-389.390) (-389.913) [-391.370] (-394.579) * (-390.514) (-389.797) (-389.563) [-390.817] -- 0:00:09
846000 -- (-390.146) (-391.216) [-391.169] (-391.764) * (-391.342) (-394.088) [-389.528] (-390.555) -- 0:00:09
846500 -- (-391.029) [-389.460] (-391.146) (-393.929) * (-392.515) (-392.627) [-389.866] (-391.406) -- 0:00:09
847000 -- (-392.449) (-389.938) [-391.132] (-392.193) * (-390.110) (-390.959) [-392.564] (-389.386) -- 0:00:09
847500 -- (-391.656) (-391.859) [-391.287] (-393.515) * [-389.702] (-393.770) (-393.107) (-390.449) -- 0:00:08
848000 -- (-389.809) (-392.379) (-393.614) [-389.762] * (-391.036) (-390.912) [-390.394] (-393.477) -- 0:00:08
848500 -- (-395.930) (-391.419) (-390.990) [-390.820] * (-389.523) [-390.533] (-391.787) (-394.451) -- 0:00:08
849000 -- (-391.810) (-392.525) (-391.782) [-389.499] * (-390.935) (-392.940) [-392.666] (-395.362) -- 0:00:08
849500 -- (-391.002) (-393.513) (-390.747) [-389.695] * (-390.908) (-390.741) (-389.380) [-394.277] -- 0:00:08
850000 -- (-393.532) [-390.324] (-390.543) (-389.564) * (-390.821) (-389.419) [-389.216] (-390.151) -- 0:00:08
Average standard deviation of split frequencies: 0.004544
850500 -- [-393.623] (-393.213) (-390.874) (-393.013) * [-390.737] (-390.188) (-389.216) (-389.893) -- 0:00:08
851000 -- (-393.369) (-390.731) [-393.375] (-392.778) * [-390.088] (-391.226) (-393.136) (-393.387) -- 0:00:08
851500 -- (-391.149) (-394.211) (-392.477) [-388.993] * (-389.774) [-392.859] (-389.750) (-392.653) -- 0:00:08
852000 -- (-391.037) [-391.926] (-390.817) (-389.869) * [-390.487] (-391.964) (-389.716) (-392.891) -- 0:00:08
852500 -- (-395.981) (-390.076) (-391.044) [-391.336] * (-391.239) (-392.016) [-391.628] (-390.725) -- 0:00:08
853000 -- (-390.802) (-394.902) (-392.852) [-391.542] * (-393.068) [-392.814] (-391.846) (-390.833) -- 0:00:08
853500 -- [-392.400] (-389.551) (-396.702) (-393.651) * (-392.410) (-391.375) (-392.145) [-389.863] -- 0:00:08
854000 -- [-393.740] (-392.399) (-396.151) (-389.759) * (-391.458) (-391.424) [-393.902] (-392.048) -- 0:00:08
854500 -- (-392.070) (-392.196) (-391.386) [-390.336] * [-392.308] (-393.200) (-394.516) (-391.048) -- 0:00:08
855000 -- (-389.926) (-391.079) (-392.732) [-390.773] * (-391.170) (-391.830) [-398.147] (-389.641) -- 0:00:08
Average standard deviation of split frequencies: 0.004479
855500 -- (-391.381) (-390.779) (-392.574) [-389.641] * (-390.960) (-391.352) (-398.294) [-390.299] -- 0:00:08
856000 -- [-391.503] (-391.008) (-391.551) (-392.417) * (-390.437) [-391.979] (-394.677) (-392.492) -- 0:00:08
856500 -- (-393.521) (-392.710) (-392.274) [-394.877] * (-391.131) (-392.420) [-391.973] (-390.321) -- 0:00:08
857000 -- (-390.870) [-392.874] (-393.174) (-391.585) * (-390.073) [-392.907] (-394.989) (-391.698) -- 0:00:08
857500 -- (-390.869) [-389.823] (-391.369) (-391.833) * [-389.875] (-390.105) (-392.666) (-390.298) -- 0:00:08
858000 -- (-391.994) (-390.259) (-392.298) [-392.532] * (-392.497) (-389.988) [-394.705] (-395.545) -- 0:00:08
858500 -- (-391.951) (-392.872) (-394.292) [-390.470] * (-392.470) (-391.043) [-390.164] (-393.746) -- 0:00:08
859000 -- (-392.742) [-390.531] (-391.874) (-391.994) * (-391.149) (-392.424) [-390.519] (-393.209) -- 0:00:08
859500 -- (-391.380) [-390.538] (-392.315) (-392.081) * [-392.837] (-390.628) (-391.346) (-394.076) -- 0:00:08
860000 -- (-392.018) (-390.153) (-391.123) [-390.827] * (-392.586) (-391.437) [-390.264] (-392.121) -- 0:00:08
Average standard deviation of split frequencies: 0.004601
860500 -- [-391.794] (-391.069) (-391.847) (-396.090) * (-389.946) (-392.528) (-389.233) [-389.887] -- 0:00:08
861000 -- [-389.634] (-392.015) (-391.043) (-390.093) * (-392.158) [-392.074] (-391.137) (-391.726) -- 0:00:08
861500 -- (-393.083) [-390.765] (-391.296) (-391.474) * (-394.324) (-389.937) [-392.975] (-390.895) -- 0:00:08
862000 -- (-396.018) (-393.188) (-390.610) [-389.947] * (-395.048) (-394.085) (-393.354) [-390.755] -- 0:00:08
862500 -- (-390.551) (-396.494) [-390.341] (-390.861) * (-391.418) (-392.639) (-395.310) [-393.292] -- 0:00:08
863000 -- [-390.199] (-391.962) (-391.390) (-391.836) * (-390.143) (-389.876) (-392.279) [-389.694] -- 0:00:08
863500 -- (-392.823) (-391.644) [-393.143] (-391.423) * [-392.472] (-394.626) (-391.216) (-392.168) -- 0:00:08
864000 -- (-397.076) (-389.697) [-390.032] (-392.871) * (-389.706) [-396.388] (-389.814) (-394.137) -- 0:00:08
864500 -- [-390.580] (-390.924) (-389.347) (-390.192) * (-390.620) (-391.692) [-392.803] (-393.668) -- 0:00:07
865000 -- (-391.227) (-396.902) (-390.872) [-390.329] * (-391.300) (-392.709) (-392.229) [-392.577] -- 0:00:07
Average standard deviation of split frequencies: 0.004609
865500 -- (-391.164) (-394.357) (-389.738) [-394.719] * (-393.241) (-393.114) (-390.922) [-392.140] -- 0:00:07
866000 -- [-390.768] (-393.188) (-393.211) (-390.123) * [-394.330] (-392.277) (-389.340) (-398.755) -- 0:00:07
866500 -- (-398.483) [-393.684] (-391.281) (-389.509) * (-390.495) (-392.624) [-390.187] (-391.295) -- 0:00:07
867000 -- (-398.047) (-395.832) [-392.265] (-390.919) * [-390.024] (-393.386) (-390.014) (-389.826) -- 0:00:07
867500 -- (-397.434) (-391.352) (-389.156) [-391.502] * (-394.589) (-396.714) (-390.918) [-389.763] -- 0:00:07
868000 -- (-392.625) (-394.122) (-391.842) [-390.877] * (-391.206) (-393.225) [-391.012] (-389.432) -- 0:00:07
868500 -- (-390.543) (-392.663) (-391.816) [-394.247] * [-392.858] (-393.661) (-391.035) (-390.296) -- 0:00:07
869000 -- (-389.303) (-390.152) [-391.330] (-391.649) * (-392.079) (-392.399) (-390.306) [-392.110] -- 0:00:07
869500 -- [-391.060] (-390.531) (-390.933) (-389.463) * (-390.995) (-390.067) [-389.704] (-391.562) -- 0:00:07
870000 -- (-393.443) (-391.182) (-390.513) [-390.296] * (-391.339) [-389.838] (-390.894) (-395.189) -- 0:00:07
Average standard deviation of split frequencies: 0.004837
870500 -- (-390.095) [-391.237] (-392.840) (-390.777) * [-389.778] (-389.417) (-391.420) (-391.082) -- 0:00:07
871000 -- (-390.643) (-391.242) (-394.094) [-389.945] * (-391.436) (-392.461) [-391.183] (-393.003) -- 0:00:07
871500 -- (-397.534) (-392.907) (-391.887) [-392.614] * (-393.123) [-390.831] (-393.781) (-390.307) -- 0:00:07
872000 -- (-392.545) (-389.414) [-392.890] (-392.775) * (-391.126) [-390.137] (-391.640) (-394.212) -- 0:00:07
872500 -- (-390.272) (-392.165) (-389.588) [-392.776] * [-392.372] (-391.834) (-391.851) (-394.347) -- 0:00:07
873000 -- (-396.441) (-392.033) (-393.379) [-391.971] * (-392.057) (-389.994) (-392.279) [-391.702] -- 0:00:07
873500 -- (-391.085) (-389.540) (-393.408) [-392.316] * (-392.554) [-392.612] (-389.983) (-393.992) -- 0:00:07
874000 -- (-391.683) [-389.695] (-394.336) (-389.310) * (-389.419) [-390.643] (-391.157) (-389.818) -- 0:00:07
874500 -- [-391.154] (-389.390) (-391.372) (-390.243) * [-393.780] (-393.166) (-391.380) (-391.007) -- 0:00:07
875000 -- (-391.661) (-389.476) [-391.621] (-389.409) * [-392.726] (-389.662) (-390.421) (-392.580) -- 0:00:07
Average standard deviation of split frequencies: 0.004736
875500 -- [-389.980] (-392.795) (-391.015) (-389.767) * (-392.612) (-389.137) [-389.292] (-393.350) -- 0:00:07
876000 -- [-391.873] (-395.289) (-389.758) (-393.521) * (-391.168) (-390.611) [-389.670] (-391.212) -- 0:00:07
876500 -- (-391.368) (-393.008) [-389.187] (-394.459) * (-389.367) (-392.963) [-393.224] (-393.773) -- 0:00:07
877000 -- (-391.173) [-392.278] (-390.888) (-389.913) * (-390.467) (-391.229) (-389.487) [-389.190] -- 0:00:07
877500 -- [-392.367] (-389.862) (-394.008) (-398.892) * (-389.330) (-390.153) [-389.420] (-393.824) -- 0:00:07
878000 -- (-390.304) (-391.419) (-390.111) [-394.159] * (-389.603) (-392.521) (-390.308) [-391.185] -- 0:00:07
878500 -- (-390.012) [-390.926] (-391.312) (-389.884) * (-390.229) (-389.872) [-393.886] (-391.145) -- 0:00:07
879000 -- (-392.060) (-390.541) (-392.544) [-390.700] * (-393.875) (-391.520) (-396.175) [-390.280] -- 0:00:07
879500 -- (-391.073) [-392.118] (-390.818) (-391.965) * (-395.641) (-390.049) (-395.028) [-392.056] -- 0:00:07
880000 -- (-397.603) (-391.810) [-390.434] (-393.176) * (-393.073) (-389.896) [-390.717] (-391.431) -- 0:00:07
Average standard deviation of split frequencies: 0.004996
880500 -- [-392.389] (-393.014) (-391.330) (-390.849) * (-389.713) [-389.428] (-391.155) (-390.699) -- 0:00:07
881000 -- [-391.608] (-393.202) (-395.498) (-389.903) * (-389.347) (-392.973) [-390.545] (-396.047) -- 0:00:07
881500 -- (-391.484) [-391.333] (-391.137) (-390.320) * (-389.349) (-392.498) [-390.940] (-392.384) -- 0:00:06
882000 -- (-391.660) [-389.910] (-391.188) (-390.124) * (-389.167) [-390.585] (-392.807) (-390.817) -- 0:00:06
882500 -- (-391.142) [-389.956] (-392.898) (-394.260) * (-390.556) (-390.141) (-392.460) [-392.679] -- 0:00:06
883000 -- (-390.730) [-391.729] (-391.263) (-391.873) * (-393.834) [-390.586] (-389.978) (-390.691) -- 0:00:06
883500 -- (-390.131) [-391.541] (-391.177) (-390.058) * (-390.827) (-391.685) [-390.447] (-393.445) -- 0:00:06
884000 -- [-390.538] (-396.499) (-392.856) (-393.127) * (-393.949) (-393.368) (-390.419) [-391.694] -- 0:00:06
884500 -- (-399.121) (-391.955) (-393.004) [-391.646] * (-393.357) (-391.917) (-391.039) [-390.762] -- 0:00:06
885000 -- [-391.185] (-393.372) (-393.685) (-394.122) * (-390.634) (-396.704) [-391.357] (-390.632) -- 0:00:06
Average standard deviation of split frequencies: 0.005072
885500 -- (-392.759) (-392.164) [-392.028] (-390.635) * [-390.489] (-393.143) (-397.987) (-390.648) -- 0:00:06
886000 -- (-394.541) (-393.508) (-389.926) [-391.641] * (-393.085) (-391.597) (-391.974) [-390.654] -- 0:00:06
886500 -- (-391.881) (-390.383) [-390.431] (-391.991) * (-390.609) (-391.061) [-392.596] (-389.236) -- 0:00:06
887000 -- (-396.044) (-399.702) [-393.034] (-391.459) * (-392.338) [-397.352] (-392.013) (-391.082) -- 0:00:06
887500 -- (-393.184) (-393.155) [-390.705] (-389.912) * (-390.806) (-392.467) (-391.384) [-391.445] -- 0:00:06
888000 -- (-392.365) (-397.056) (-390.443) [-389.840] * [-389.763] (-390.433) (-390.381) (-390.616) -- 0:00:06
888500 -- (-394.998) (-391.068) (-389.386) [-390.056] * [-389.872] (-390.033) (-391.323) (-390.560) -- 0:00:06
889000 -- (-388.965) (-390.647) (-394.184) [-392.890] * (-390.733) (-390.450) [-393.381] (-391.723) -- 0:00:06
889500 -- (-389.287) (-395.071) [-390.362] (-389.621) * [-389.505] (-390.611) (-393.416) (-392.294) -- 0:00:06
890000 -- (-396.170) (-392.233) (-393.613) [-391.481] * (-392.880) (-391.452) [-391.769] (-390.654) -- 0:00:06
Average standard deviation of split frequencies: 0.005681
890500 -- (-389.794) (-390.449) (-390.199) [-389.728] * [-393.281] (-391.146) (-394.869) (-392.049) -- 0:00:06
891000 -- (-392.560) (-394.971) [-391.009] (-398.280) * (-392.640) (-392.282) (-395.423) [-393.361] -- 0:00:06
891500 -- (-391.772) (-391.722) [-391.307] (-397.928) * (-391.332) (-390.383) [-394.035] (-391.022) -- 0:00:06
892000 -- (-391.070) [-391.125] (-390.818) (-391.862) * (-389.795) [-392.628] (-391.039) (-394.219) -- 0:00:06
892500 -- (-390.480) [-391.387] (-393.636) (-391.922) * (-389.754) (-393.125) (-392.429) [-393.167] -- 0:00:06
893000 -- [-389.970] (-391.371) (-390.918) (-390.441) * (-390.242) [-394.256] (-392.592) (-394.743) -- 0:00:06
893500 -- (-391.231) (-395.055) (-391.392) [-390.829] * (-395.248) [-391.800] (-394.294) (-391.941) -- 0:00:06
894000 -- (-391.080) (-391.032) (-389.581) [-390.083] * (-390.627) (-392.656) [-393.352] (-393.374) -- 0:00:06
894500 -- (-391.583) (-392.597) (-390.045) [-390.587] * (-393.846) (-389.111) [-392.763] (-391.212) -- 0:00:06
895000 -- (-392.934) (-395.714) [-389.839] (-391.005) * (-394.627) [-393.450] (-392.428) (-391.654) -- 0:00:06
Average standard deviation of split frequencies: 0.005612
895500 -- (-389.958) (-390.996) (-390.508) [-390.868] * (-396.877) [-390.791] (-396.302) (-391.843) -- 0:00:06
896000 -- [-389.876] (-390.480) (-390.709) (-389.609) * (-394.001) (-389.533) (-392.074) [-390.271] -- 0:00:06
896500 -- (-393.074) (-390.830) (-391.203) [-389.785] * [-389.859] (-399.149) (-395.674) (-391.431) -- 0:00:06
897000 -- (-395.978) [-389.857] (-390.537) (-390.467) * [-393.453] (-394.336) (-391.345) (-390.752) -- 0:00:06
897500 -- (-396.427) [-389.418] (-394.185) (-392.378) * (-391.114) (-390.556) (-391.622) [-391.234] -- 0:00:06
898000 -- (-390.236) [-389.392] (-389.968) (-389.937) * (-395.107) (-391.738) (-393.030) [-391.198] -- 0:00:06
898500 -- [-390.968] (-390.907) (-390.107) (-390.575) * [-391.428] (-395.362) (-391.294) (-391.369) -- 0:00:05
899000 -- [-393.318] (-391.652) (-390.637) (-392.632) * (-389.833) (-394.449) [-391.808] (-391.102) -- 0:00:05
899500 -- [-390.633] (-392.372) (-389.507) (-389.986) * (-390.594) (-389.782) [-389.713] (-391.188) -- 0:00:05
900000 -- (-392.596) (-391.057) [-390.259] (-391.069) * (-390.724) [-390.726] (-391.947) (-389.894) -- 0:00:05
Average standard deviation of split frequencies: 0.005583
900500 -- (-393.126) [-391.394] (-392.330) (-390.767) * (-389.969) (-390.118) [-394.459] (-389.996) -- 0:00:05
901000 -- (-391.415) [-390.767] (-391.008) (-391.097) * (-390.416) (-392.028) [-392.691] (-390.796) -- 0:00:05
901500 -- (-396.523) (-393.908) [-391.115] (-389.962) * (-392.842) (-391.751) [-390.613] (-394.095) -- 0:00:05
902000 -- [-391.231] (-389.726) (-391.928) (-393.195) * (-392.098) (-390.945) [-392.156] (-391.089) -- 0:00:05
902500 -- (-389.849) [-390.337] (-390.374) (-390.693) * (-395.107) (-393.724) [-392.592] (-393.022) -- 0:00:05
903000 -- (-393.424) [-390.320] (-392.076) (-390.608) * (-391.491) [-390.561] (-389.459) (-390.824) -- 0:00:05
903500 -- (-390.178) (-392.078) (-391.457) [-392.049] * (-390.225) (-390.128) (-393.032) [-394.701] -- 0:00:05
904000 -- [-389.696] (-392.694) (-390.084) (-392.307) * (-391.743) (-390.470) (-392.813) [-390.505] -- 0:00:05
904500 -- (-390.061) (-389.315) (-391.983) [-392.371] * (-390.320) [-390.401] (-392.416) (-392.335) -- 0:00:05
905000 -- (-390.053) [-389.358] (-392.406) (-392.834) * [-390.823] (-390.696) (-391.961) (-390.208) -- 0:00:05
Average standard deviation of split frequencies: 0.005238
905500 -- (-396.874) (-390.385) (-390.484) [-390.405] * (-391.362) [-389.638] (-392.627) (-391.444) -- 0:00:05
906000 -- (-390.632) (-393.360) [-395.890] (-393.693) * (-390.829) (-389.751) (-392.186) [-390.023] -- 0:00:05
906500 -- [-390.759] (-390.858) (-394.245) (-390.929) * (-390.337) (-394.618) (-392.574) [-389.479] -- 0:00:05
907000 -- (-389.387) (-390.827) (-393.149) [-391.057] * [-391.190] (-390.518) (-390.250) (-390.108) -- 0:00:05
907500 -- (-389.845) [-392.641] (-389.778) (-391.544) * (-391.425) [-390.627] (-392.272) (-389.668) -- 0:00:05
908000 -- (-395.206) [-390.462] (-395.276) (-391.610) * (-389.978) (-389.606) (-389.147) [-389.594] -- 0:00:05
908500 -- [-390.071] (-390.185) (-390.331) (-390.790) * [-391.290] (-391.427) (-398.308) (-389.812) -- 0:00:05
909000 -- (-393.600) (-391.551) [-391.608] (-390.077) * (-392.659) (-390.244) [-389.306] (-391.312) -- 0:00:05
909500 -- (-391.065) (-390.174) (-390.409) [-391.069] * (-395.118) (-393.818) [-392.458] (-393.287) -- 0:00:05
910000 -- [-391.375] (-390.531) (-392.798) (-391.120) * [-393.706] (-390.634) (-392.185) (-391.361) -- 0:00:05
Average standard deviation of split frequencies: 0.005522
910500 -- (-393.642) (-392.644) [-389.681] (-392.419) * [-391.464] (-391.773) (-390.761) (-392.396) -- 0:00:05
911000 -- (-390.015) (-389.759) [-396.602] (-389.824) * [-389.919] (-391.623) (-391.262) (-391.468) -- 0:00:05
911500 -- (-391.837) (-392.916) [-393.916] (-390.458) * (-394.946) (-393.335) [-392.251] (-392.602) -- 0:00:05
912000 -- [-391.269] (-391.340) (-392.747) (-393.309) * [-390.626] (-393.683) (-392.239) (-390.667) -- 0:00:05
912500 -- (-392.292) [-392.400] (-392.580) (-394.288) * [-391.408] (-393.182) (-392.548) (-389.974) -- 0:00:05
913000 -- (-392.765) [-391.634] (-394.448) (-390.330) * [-390.637] (-393.603) (-391.057) (-390.150) -- 0:00:05
913500 -- (-391.638) (-391.654) [-394.349] (-395.074) * (-393.126) (-391.301) [-392.451] (-390.392) -- 0:00:05
914000 -- (-390.543) (-395.029) [-391.557] (-392.990) * [-391.015] (-389.577) (-392.993) (-391.333) -- 0:00:05
914500 -- (-393.686) (-397.848) [-390.703] (-390.143) * (-390.769) (-389.712) (-391.096) [-391.678] -- 0:00:05
915000 -- (-391.936) (-395.699) [-391.742] (-391.036) * (-391.816) (-391.192) (-390.985) [-391.012] -- 0:00:05
Average standard deviation of split frequencies: 0.005318
915500 -- (-390.236) [-393.238] (-392.175) (-394.723) * (-392.155) (-394.534) (-392.151) [-391.385] -- 0:00:04
916000 -- (-390.594) [-391.843] (-389.227) (-393.616) * (-390.539) (-390.497) [-389.881] (-390.987) -- 0:00:04
916500 -- (-389.944) (-393.067) [-388.987] (-391.551) * (-390.472) (-390.419) [-392.380] (-389.241) -- 0:00:04
917000 -- (-390.596) [-393.142] (-392.706) (-391.591) * (-391.376) (-392.044) (-391.396) [-392.407] -- 0:00:04
917500 -- (-391.376) (-391.555) [-390.578] (-391.719) * (-390.643) (-391.747) (-391.405) [-393.325] -- 0:00:04
918000 -- (-390.096) (-389.198) [-391.212] (-391.348) * (-391.835) (-390.893) [-389.673] (-398.578) -- 0:00:04
918500 -- [-391.497] (-391.489) (-398.428) (-391.757) * [-394.134] (-392.352) (-389.746) (-389.912) -- 0:00:04
919000 -- [-392.204] (-392.246) (-392.354) (-391.490) * [-392.019] (-391.751) (-389.625) (-390.609) -- 0:00:04
919500 -- [-390.276] (-393.183) (-390.651) (-392.599) * (-389.866) (-389.395) (-391.664) [-389.739] -- 0:00:04
920000 -- (-390.308) (-390.255) [-391.022] (-392.975) * (-394.822) (-393.286) (-391.036) [-391.401] -- 0:00:04
Average standard deviation of split frequencies: 0.005359
920500 -- [-390.532] (-391.301) (-392.139) (-393.307) * (-391.521) [-389.972] (-391.980) (-395.207) -- 0:00:04
921000 -- (-391.166) (-389.747) [-392.406] (-393.069) * (-396.140) [-390.018] (-394.641) (-390.447) -- 0:00:04
921500 -- (-391.772) (-392.393) (-391.407) [-390.307] * (-398.794) [-389.356] (-390.969) (-390.578) -- 0:00:04
922000 -- (-392.401) (-392.799) [-391.114] (-389.874) * [-395.114] (-390.953) (-391.920) (-393.034) -- 0:00:04
922500 -- (-392.061) [-389.956] (-390.248) (-393.693) * (-392.340) (-393.347) [-389.398] (-390.495) -- 0:00:04
923000 -- [-392.377] (-389.681) (-389.746) (-389.521) * (-390.823) [-390.861] (-392.112) (-390.565) -- 0:00:04
923500 -- (-390.858) [-390.073] (-391.090) (-389.158) * (-390.761) (-392.123) (-391.200) [-390.766] -- 0:00:04
924000 -- [-390.736] (-390.541) (-395.656) (-390.156) * (-389.825) [-390.786] (-389.806) (-391.636) -- 0:00:04
924500 -- [-389.483] (-390.691) (-390.946) (-389.977) * (-389.541) (-395.059) [-389.968] (-393.414) -- 0:00:04
925000 -- (-390.780) (-390.942) (-389.387) [-390.378] * [-390.918] (-389.913) (-389.637) (-396.059) -- 0:00:04
Average standard deviation of split frequencies: 0.005770
925500 -- (-389.239) [-393.067] (-390.259) (-394.151) * (-394.114) (-392.020) [-390.967] (-392.530) -- 0:00:04
926000 -- (-393.069) [-390.888] (-389.898) (-394.220) * (-392.708) (-392.203) [-389.934] (-393.718) -- 0:00:04
926500 -- (-390.854) [-391.199] (-393.695) (-391.773) * (-391.748) (-391.049) (-391.554) [-394.354] -- 0:00:04
927000 -- (-390.883) (-396.331) [-391.853] (-395.862) * (-390.085) (-391.072) (-393.104) [-391.585] -- 0:00:04
927500 -- (-390.759) (-391.677) [-391.660] (-391.672) * (-391.724) (-389.558) [-389.898] (-390.964) -- 0:00:04
928000 -- (-399.614) (-392.450) [-391.264] (-392.059) * (-391.635) (-393.243) (-389.296) [-393.150] -- 0:00:04
928500 -- (-392.679) (-391.161) (-391.287) [-391.379] * (-399.495) [-391.568] (-392.225) (-389.255) -- 0:00:04
929000 -- (-395.750) (-396.791) [-389.253] (-390.471) * (-400.178) (-390.694) (-390.004) [-390.274] -- 0:00:04
929500 -- (-391.015) [-389.846] (-389.116) (-389.737) * [-390.619] (-390.623) (-390.246) (-390.829) -- 0:00:04
930000 -- [-390.902] (-391.517) (-398.373) (-390.081) * (-390.126) [-390.425] (-391.086) (-397.263) -- 0:00:04
Average standard deviation of split frequencies: 0.006450
930500 -- (-393.214) [-390.277] (-392.383) (-390.487) * (-392.475) (-390.525) [-391.830] (-393.113) -- 0:00:04
931000 -- [-394.515] (-390.373) (-392.140) (-392.973) * (-391.537) (-394.089) [-391.416] (-392.423) -- 0:00:04
931500 -- (-392.038) [-395.643] (-393.456) (-392.057) * (-392.667) [-391.713] (-391.950) (-392.249) -- 0:00:04
932000 -- (-389.554) (-390.893) (-389.692) [-391.030] * (-392.363) (-392.235) [-389.749] (-392.502) -- 0:00:04
932500 -- (-394.625) (-391.288) [-390.994] (-391.354) * (-390.195) (-390.098) (-392.497) [-390.914] -- 0:00:03
933000 -- (-390.652) (-391.949) (-391.412) [-390.627] * [-389.605] (-390.369) (-392.994) (-391.935) -- 0:00:03
933500 -- [-391.430] (-391.809) (-391.381) (-390.440) * (-391.649) (-391.864) [-390.123] (-393.446) -- 0:00:03
934000 -- [-390.990] (-391.484) (-392.968) (-391.059) * (-389.969) (-389.683) [-390.104] (-391.257) -- 0:00:03
934500 -- [-390.440] (-392.804) (-395.351) (-389.557) * (-392.863) (-391.715) [-391.865] (-396.516) -- 0:00:03
935000 -- (-392.485) (-394.477) (-390.217) [-390.439] * (-391.049) (-390.093) [-392.127] (-395.333) -- 0:00:03
Average standard deviation of split frequencies: 0.006212
935500 -- [-390.451] (-391.780) (-389.575) (-391.269) * [-389.446] (-390.548) (-390.860) (-392.133) -- 0:00:03
936000 -- (-391.639) (-392.464) [-389.578] (-392.527) * (-391.667) (-393.462) (-391.185) [-391.551] -- 0:00:03
936500 -- (-392.694) [-391.329] (-389.527) (-390.482) * (-394.152) (-394.710) [-392.311] (-394.093) -- 0:00:03
937000 -- (-390.625) [-392.156] (-391.369) (-390.638) * [-389.452] (-390.898) (-392.795) (-393.057) -- 0:00:03
937500 -- (-393.375) [-390.066] (-391.886) (-389.987) * (-389.590) (-392.569) [-390.211] (-393.953) -- 0:00:03
938000 -- [-390.379] (-392.671) (-389.766) (-390.702) * [-390.304] (-389.609) (-391.723) (-399.357) -- 0:00:03
938500 -- [-393.047] (-389.722) (-391.685) (-391.217) * (-390.510) [-389.277] (-392.023) (-394.675) -- 0:00:03
939000 -- (-395.333) (-390.568) (-390.615) [-391.346] * (-389.244) (-391.691) [-393.575] (-395.341) -- 0:00:03
939500 -- (-393.996) (-392.662) (-391.610) [-392.292] * [-390.125] (-392.248) (-395.680) (-396.892) -- 0:00:03
940000 -- (-393.207) [-391.703] (-390.688) (-391.983) * (-395.335) [-390.728] (-389.403) (-390.486) -- 0:00:03
Average standard deviation of split frequencies: 0.006548
940500 -- (-391.174) (-394.560) (-392.470) [-393.571] * (-391.419) (-390.729) [-391.970] (-390.089) -- 0:00:03
941000 -- (-397.582) [-391.748] (-393.916) (-390.800) * (-393.720) (-390.496) (-398.471) [-392.300] -- 0:00:03
941500 -- (-391.207) (-391.079) (-395.091) [-391.632] * [-391.844] (-393.627) (-400.178) (-389.805) -- 0:00:03
942000 -- (-393.878) (-390.199) [-392.051] (-390.486) * (-392.071) (-391.160) [-395.035] (-391.004) -- 0:00:03
942500 -- (-395.539) (-389.617) (-392.870) [-390.099] * (-391.497) (-390.294) (-390.390) [-390.536] -- 0:00:03
943000 -- (-392.969) [-389.230] (-389.800) (-392.705) * (-390.970) (-390.926) (-390.718) [-392.051] -- 0:00:03
943500 -- [-390.619] (-391.980) (-391.245) (-389.024) * (-393.497) (-394.153) [-390.371] (-390.887) -- 0:00:03
944000 -- (-390.172) (-392.000) (-392.546) [-389.203] * (-392.666) (-391.559) (-399.503) [-390.363] -- 0:00:03
944500 -- (-390.795) (-390.640) (-394.175) [-392.837] * (-391.562) [-391.994] (-392.005) (-389.789) -- 0:00:03
945000 -- (-391.319) [-390.405] (-394.088) (-391.980) * (-390.993) [-391.503] (-395.489) (-390.329) -- 0:00:03
Average standard deviation of split frequencies: 0.006511
945500 -- [-390.144] (-393.080) (-394.266) (-394.287) * (-392.441) (-392.912) [-392.778] (-390.368) -- 0:00:03
946000 -- (-390.775) [-391.072] (-392.969) (-392.364) * (-389.794) [-396.015] (-390.472) (-389.828) -- 0:00:03
946500 -- (-392.432) (-389.655) [-392.110] (-394.162) * (-389.300) [-390.423] (-390.380) (-391.620) -- 0:00:03
947000 -- (-390.016) (-390.168) [-389.265] (-394.179) * (-392.642) (-389.700) [-389.343] (-390.944) -- 0:00:03
947500 -- [-391.532] (-389.559) (-391.124) (-392.813) * [-391.536] (-392.029) (-389.655) (-390.743) -- 0:00:03
948000 -- (-391.770) [-392.682] (-393.319) (-393.182) * (-393.370) [-390.560] (-390.198) (-390.913) -- 0:00:03
948500 -- (-390.109) (-389.678) [-390.866] (-393.189) * [-395.330] (-390.438) (-389.817) (-396.884) -- 0:00:03
949000 -- (-391.802) [-391.562] (-394.301) (-394.047) * (-391.214) [-391.378] (-390.426) (-395.856) -- 0:00:03
949500 -- (-391.966) [-389.040] (-393.127) (-393.786) * (-390.517) (-392.899) (-391.817) [-391.416] -- 0:00:02
950000 -- [-391.318] (-389.794) (-389.681) (-391.868) * (-390.534) [-389.145] (-390.583) (-389.913) -- 0:00:02
Average standard deviation of split frequencies: 0.006975
950500 -- (-389.587) (-391.120) [-391.977] (-392.335) * (-393.186) (-390.890) (-393.444) [-391.599] -- 0:00:02
951000 -- (-394.561) (-395.027) (-391.506) [-390.029] * (-391.910) [-391.776] (-394.465) (-389.850) -- 0:00:02
951500 -- (-392.382) (-390.901) (-393.152) [-393.256] * (-392.617) (-389.780) (-389.888) [-390.639] -- 0:00:02
952000 -- [-392.998] (-393.566) (-390.745) (-393.646) * (-392.391) (-390.815) [-391.335] (-391.504) -- 0:00:02
952500 -- (-390.607) (-390.417) [-391.906] (-392.512) * (-394.677) [-393.322] (-391.642) (-389.728) -- 0:00:02
953000 -- (-392.438) [-390.176] (-395.657) (-393.337) * (-392.840) (-390.413) [-390.831] (-390.002) -- 0:00:02
953500 -- (-390.840) [-390.637] (-392.993) (-389.286) * [-389.489] (-391.022) (-391.992) (-391.562) -- 0:00:02
954000 -- (-389.754) (-389.699) (-390.806) [-390.771] * [-390.293] (-390.025) (-390.430) (-391.185) -- 0:00:02
954500 -- (-390.191) (-389.683) [-390.147] (-392.695) * (-390.548) [-391.938] (-393.080) (-391.275) -- 0:00:02
955000 -- (-391.568) (-392.732) (-390.139) [-391.869] * (-393.624) (-390.511) [-390.306] (-397.702) -- 0:00:02
Average standard deviation of split frequencies: 0.007002
955500 -- [-396.168] (-392.136) (-392.576) (-390.712) * [-390.567] (-390.319) (-391.475) (-394.747) -- 0:00:02
956000 -- (-391.418) [-390.472] (-392.170) (-391.276) * (-391.283) [-389.669] (-393.475) (-389.286) -- 0:00:02
956500 -- (-392.276) (-389.794) [-393.990] (-389.636) * (-396.764) (-392.055) (-392.531) [-389.639] -- 0:00:02
957000 -- (-394.291) (-392.003) [-390.840] (-389.995) * [-394.247] (-391.437) (-391.475) (-393.784) -- 0:00:02
957500 -- (-395.869) (-391.884) (-393.164) [-389.037] * (-391.901) (-391.424) (-392.938) [-390.788] -- 0:00:02
958000 -- [-390.835] (-397.721) (-389.081) (-391.193) * (-391.190) [-391.071] (-390.874) (-390.397) -- 0:00:02
958500 -- [-389.395] (-391.809) (-391.533) (-390.117) * (-390.955) [-390.563] (-391.705) (-389.151) -- 0:00:02
959000 -- (-390.815) (-391.408) (-392.071) [-390.626] * (-391.141) [-391.385] (-390.076) (-390.074) -- 0:00:02
959500 -- [-392.683] (-397.233) (-390.946) (-390.968) * (-392.708) (-391.631) (-391.898) [-391.119] -- 0:00:02
960000 -- [-390.774] (-392.667) (-391.736) (-389.473) * (-398.620) (-390.019) [-392.132] (-391.816) -- 0:00:02
Average standard deviation of split frequencies: 0.006674
960500 -- (-397.054) (-393.798) [-390.208] (-389.116) * (-393.453) [-389.752] (-390.837) (-390.994) -- 0:00:02
961000 -- [-393.362] (-391.782) (-389.752) (-390.162) * (-392.532) (-391.093) [-390.369] (-395.280) -- 0:00:02
961500 -- (-394.394) [-392.438] (-389.610) (-389.844) * (-390.199) [-390.647] (-390.269) (-391.841) -- 0:00:02
962000 -- (-393.606) [-389.326] (-389.563) (-391.576) * (-395.502) [-389.555] (-392.767) (-390.850) -- 0:00:02
962500 -- (-389.865) [-390.790] (-391.123) (-392.415) * [-392.614] (-391.820) (-392.154) (-389.430) -- 0:00:02
963000 -- (-390.777) [-393.124] (-390.814) (-391.163) * [-391.462] (-390.560) (-390.514) (-389.563) -- 0:00:02
963500 -- (-391.668) (-391.348) [-390.843] (-390.374) * (-390.916) [-392.488] (-389.257) (-391.596) -- 0:00:02
964000 -- [-390.308] (-392.341) (-393.510) (-393.706) * (-391.803) (-393.052) [-390.102] (-389.719) -- 0:00:02
964500 -- (-393.304) (-392.466) [-390.132] (-392.342) * [-389.775] (-396.710) (-389.462) (-391.965) -- 0:00:02
965000 -- (-390.503) (-389.791) [-389.855] (-392.726) * (-390.854) [-394.212] (-390.670) (-392.263) -- 0:00:02
Average standard deviation of split frequencies: 0.006376
965500 -- [-393.921] (-390.099) (-391.712) (-394.468) * (-391.112) (-392.929) (-390.531) [-391.365] -- 0:00:02
966000 -- (-392.877) [-391.780] (-393.779) (-391.469) * (-391.180) (-389.937) [-390.498] (-399.789) -- 0:00:02
966500 -- (-393.958) (-390.698) (-392.950) [-391.804] * [-392.044] (-391.038) (-391.755) (-392.989) -- 0:00:01
967000 -- [-393.024] (-393.084) (-390.084) (-390.513) * (-393.702) (-394.983) [-389.216] (-391.975) -- 0:00:01
967500 -- (-390.604) [-390.729] (-390.590) (-389.772) * (-396.018) [-391.830] (-389.769) (-390.810) -- 0:00:01
968000 -- (-390.896) (-389.915) (-389.435) [-389.847] * (-390.768) (-389.838) (-393.402) [-390.139] -- 0:00:01
968500 -- (-390.765) (-394.685) [-392.517] (-392.343) * (-391.164) (-389.908) [-392.536] (-390.117) -- 0:00:01
969000 -- [-393.979] (-392.769) (-390.772) (-393.262) * (-392.955) (-390.317) (-391.147) [-390.613] -- 0:00:01
969500 -- (-396.335) (-392.972) (-390.105) [-389.888] * (-390.591) [-392.335] (-390.132) (-391.357) -- 0:00:01
970000 -- (-392.325) [-391.621] (-391.551) (-390.656) * (-391.284) (-391.595) (-390.671) [-390.809] -- 0:00:01
Average standard deviation of split frequencies: 0.006054
970500 -- (-391.178) (-389.477) (-393.917) [-390.351] * (-394.115) (-391.161) (-391.306) [-391.071] -- 0:00:01
971000 -- (-391.661) (-390.272) (-391.428) [-391.009] * (-392.878) [-389.510] (-390.374) (-392.763) -- 0:00:01
971500 -- (-392.071) [-394.275] (-389.764) (-391.582) * (-392.523) [-389.761] (-393.459) (-392.055) -- 0:00:01
972000 -- (-391.353) (-390.370) (-389.946) [-390.458] * (-390.616) [-396.321] (-401.606) (-393.170) -- 0:00:01
972500 -- (-393.122) (-389.688) (-390.339) [-393.807] * (-390.467) [-392.104] (-398.117) (-390.762) -- 0:00:01
973000 -- (-391.529) (-390.971) [-392.398] (-392.949) * (-392.088) (-392.841) [-394.207] (-390.683) -- 0:00:01
973500 -- [-390.111] (-391.630) (-390.042) (-390.909) * [-390.228] (-397.293) (-392.804) (-391.743) -- 0:00:01
974000 -- (-390.439) (-390.291) (-390.005) [-394.198] * (-398.154) (-394.640) [-391.650] (-390.914) -- 0:00:01
974500 -- (-391.366) [-391.025] (-394.974) (-390.949) * (-391.068) (-393.763) [-390.717] (-392.230) -- 0:00:01
975000 -- (-390.139) [-391.966] (-391.424) (-390.418) * (-390.275) [-391.196] (-392.777) (-391.667) -- 0:00:01
Average standard deviation of split frequencies: 0.005957
975500 -- (-392.476) [-391.016] (-391.372) (-393.218) * (-390.477) [-393.424] (-390.668) (-390.498) -- 0:00:01
976000 -- (-393.566) (-389.780) (-390.426) [-390.270] * [-393.353] (-393.789) (-389.309) (-391.344) -- 0:00:01
976500 -- (-391.393) [-391.982] (-390.782) (-389.916) * [-391.079] (-393.658) (-389.238) (-390.558) -- 0:00:01
977000 -- [-393.552] (-389.616) (-392.676) (-392.009) * (-392.209) (-390.720) (-391.555) [-392.824] -- 0:00:01
977500 -- [-391.106] (-389.329) (-392.441) (-391.480) * [-390.338] (-390.674) (-389.421) (-394.408) -- 0:00:01
978000 -- [-390.166] (-393.069) (-390.724) (-390.975) * [-390.887] (-395.931) (-389.922) (-390.358) -- 0:00:01
978500 -- (-397.533) (-389.850) [-392.216] (-390.337) * (-390.331) (-390.439) [-391.681] (-390.882) -- 0:00:01
979000 -- (-391.946) [-389.590] (-397.343) (-391.445) * (-390.100) (-390.632) (-390.624) [-392.898] -- 0:00:01
979500 -- (-393.183) (-390.893) (-392.787) [-391.195] * (-390.298) (-392.000) (-389.675) [-392.531] -- 0:00:01
980000 -- (-391.980) (-394.202) (-393.103) [-391.390] * (-390.864) [-390.919] (-390.896) (-390.178) -- 0:00:01
Average standard deviation of split frequencies: 0.005512
980500 -- [-390.497] (-392.308) (-390.577) (-391.954) * (-391.361) (-389.633) [-392.266] (-390.866) -- 0:00:01
981000 -- (-391.258) (-390.840) (-391.708) [-392.252] * (-389.790) [-390.205] (-392.487) (-390.321) -- 0:00:01
981500 -- (-392.535) [-390.280] (-394.211) (-391.805) * (-389.604) [-391.735] (-391.931) (-390.080) -- 0:00:01
982000 -- (-389.871) [-390.218] (-392.810) (-390.198) * (-390.042) (-392.154) [-390.039] (-390.597) -- 0:00:01
982500 -- (-394.448) (-393.296) [-393.004] (-390.954) * (-393.009) (-392.510) [-394.301] (-389.552) -- 0:00:01
983000 -- [-390.461] (-393.128) (-394.629) (-390.145) * [-390.723] (-391.411) (-390.230) (-393.956) -- 0:00:01
983500 -- (-389.692) (-391.553) [-389.607] (-398.136) * (-391.236) [-392.876] (-391.547) (-389.993) -- 0:00:00
984000 -- (-391.516) (-394.945) (-395.939) [-391.595] * (-390.599) [-393.295] (-393.063) (-393.119) -- 0:00:00
984500 -- (-390.469) (-389.394) [-392.905] (-391.508) * (-393.388) (-393.197) (-392.399) [-390.247] -- 0:00:00
985000 -- (-391.493) [-389.378] (-392.030) (-391.337) * (-399.058) [-393.822] (-393.034) (-393.013) -- 0:00:00
Average standard deviation of split frequencies: 0.005418
985500 -- (-391.456) (-392.193) (-394.884) [-389.108] * (-390.740) (-391.900) (-391.133) [-394.055] -- 0:00:00
986000 -- (-389.961) [-391.919] (-392.035) (-398.854) * (-391.157) (-395.381) (-391.725) [-392.036] -- 0:00:00
986500 -- (-390.738) (-391.701) (-391.838) [-389.873] * (-394.090) (-394.718) (-390.946) [-390.751] -- 0:00:00
987000 -- (-392.923) (-397.551) (-393.528) [-389.606] * [-393.293] (-392.179) (-394.122) (-391.013) -- 0:00:00
987500 -- [-393.356] (-393.556) (-390.583) (-390.441) * (-390.642) (-393.702) [-390.923] (-392.654) -- 0:00:00
988000 -- (-394.795) (-392.545) [-390.819] (-390.444) * (-390.548) (-391.081) (-390.126) [-389.239] -- 0:00:00
988500 -- (-391.962) [-391.751] (-391.886) (-392.165) * [-390.262] (-391.404) (-390.738) (-389.271) -- 0:00:00
989000 -- (-389.516) (-390.465) [-392.587] (-393.032) * [-389.364] (-389.846) (-390.990) (-394.695) -- 0:00:00
989500 -- (-393.786) (-390.379) [-390.722] (-392.233) * (-390.172) (-390.591) (-392.095) [-392.936] -- 0:00:00
990000 -- (-392.683) [-391.112] (-390.108) (-400.187) * (-390.627) [-389.671] (-389.347) (-391.950) -- 0:00:00
Average standard deviation of split frequencies: 0.005361
990500 -- (-392.030) (-390.841) [-390.932] (-396.199) * (-395.586) (-391.412) [-390.146] (-393.050) -- 0:00:00
991000 -- (-394.400) (-393.060) [-392.704] (-395.946) * [-390.523] (-390.795) (-390.739) (-389.634) -- 0:00:00
991500 -- [-390.919] (-390.515) (-394.301) (-392.712) * (-391.240) [-391.446] (-391.351) (-390.199) -- 0:00:00
992000 -- [-392.296] (-389.849) (-393.478) (-394.648) * (-390.074) [-389.831] (-391.425) (-390.080) -- 0:00:00
992500 -- (-392.165) (-391.147) (-392.214) [-390.125] * (-393.335) (-395.017) (-392.317) [-392.045] -- 0:00:00
993000 -- (-392.462) (-390.875) (-390.525) [-389.327] * (-389.933) (-392.996) (-390.929) [-392.580] -- 0:00:00
993500 -- (-394.017) (-391.303) (-389.508) [-392.804] * (-394.511) [-391.170] (-390.845) (-391.588) -- 0:00:00
994000 -- (-390.174) (-392.447) [-390.215] (-393.933) * (-395.043) (-391.312) [-391.106] (-393.101) -- 0:00:00
994500 -- (-390.381) (-392.238) (-393.051) [-390.806] * (-390.506) (-393.053) (-391.151) [-391.109] -- 0:00:00
995000 -- (-389.550) [-389.968] (-390.456) (-391.286) * (-394.512) (-391.215) [-390.190] (-393.637) -- 0:00:00
Average standard deviation of split frequencies: 0.005585
995500 -- (-392.449) [-390.224] (-389.349) (-389.677) * [-390.323] (-390.693) (-389.515) (-392.589) -- 0:00:00
996000 -- (-389.315) (-390.726) (-390.838) [-389.740] * [-389.325] (-389.582) (-390.293) (-391.567) -- 0:00:00
996500 -- [-390.289] (-394.636) (-393.221) (-391.314) * [-390.526] (-391.189) (-393.177) (-390.216) -- 0:00:00
997000 -- (-391.879) [-389.615] (-393.190) (-393.617) * (-394.300) [-390.264] (-391.648) (-392.320) -- 0:00:00
997500 -- [-391.787] (-390.926) (-391.121) (-389.753) * (-393.986) (-390.273) [-391.053] (-390.857) -- 0:00:00
998000 -- (-392.333) (-393.670) (-394.911) [-391.446] * (-393.683) (-391.540) (-392.761) [-389.267] -- 0:00:00
998500 -- [-392.291] (-390.215) (-389.882) (-392.383) * (-392.338) (-389.670) (-390.436) [-391.387] -- 0:00:00
999000 -- (-391.534) (-393.764) [-390.619] (-391.339) * [-390.861] (-391.444) (-390.096) (-391.151) -- 0:00:00
999500 -- (-390.743) (-396.840) [-392.263] (-389.371) * (-392.562) (-389.982) (-391.039) [-392.362] -- 0:00:00
1000000 -- (-389.419) (-394.308) (-390.357) [-391.976] * (-393.738) (-389.378) [-390.397] (-391.529) -- 0:00:00
Average standard deviation of split frequencies: 0.005496
Analysis completed in 59 seconds
Analysis used 57.52 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -388.86
Likelihood of best state for "cold" chain of run 2 was -388.86
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
40.3 % ( 33 %) Dirichlet(Pi{all})
39.7 % ( 28 %) Slider(Pi{all})
79.1 % ( 44 %) Multiplier(Alpha{1,2})
78.4 % ( 64 %) Multiplier(Alpha{3})
26.8 % ( 26 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.7 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 72 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
41.2 % ( 25 %) Dirichlet(Pi{all})
39.3 % ( 24 %) Slider(Pi{all})
79.2 % ( 48 %) Multiplier(Alpha{1,2})
77.8 % ( 53 %) Multiplier(Alpha{3})
26.0 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.6 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166311 0.83 0.67
3 | 167137 166444 0.84
4 | 167063 166607 166438
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166558 0.82 0.67
3 | 166398 167134 0.84
4 | 166819 166148 166943
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -390.61
| 1 2|
| 2 2 2 |
| 1 1 2 1 * 21 2 1 |
| 1 2 1 2 1 2 2 21 |
| 2 * 1 2 222* 211 221 122 2 221 1|
| 2 2121 1 22 2 *2 2 1 1 1 11 1 |
| 1 1 112 2 11 1 2 1 12 1 1 2 1 2 |
|* 2 2 1 1 1 2 * 2 1 |
| 2 1 * 121 2 |
| 1 12 2 21 2 |
| 1 2 2 2 |
| |
| 1 1 |
| 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -392.65
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -390.66 -399.17
2 -390.60 -393.54
--------------------------------------
TOTAL -390.63 -398.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896065 0.088902 0.378410 1.502819 0.868862 1415.48 1458.24 1.000
r(A<->C){all} 0.165019 0.019367 0.000122 0.449940 0.131654 142.65 186.04 1.003
r(A<->G){all} 0.159674 0.018150 0.000044 0.424713 0.122250 220.86 269.34 1.004
r(A<->T){all} 0.161734 0.018749 0.000033 0.434258 0.120526 190.06 257.26 1.000
r(C<->G){all} 0.169458 0.021540 0.000003 0.461421 0.128683 166.17 202.90 1.000
r(C<->T){all} 0.174571 0.021843 0.000093 0.465460 0.135446 211.14 250.35 1.000
r(G<->T){all} 0.169543 0.019047 0.000001 0.441900 0.133601 77.06 181.53 1.000
pi(A){all} 0.261786 0.000679 0.212504 0.314393 0.260734 1103.31 1136.90 1.001
pi(C){all} 0.283467 0.000729 0.230692 0.336275 0.282847 1236.95 1323.64 1.000
pi(G){all} 0.251990 0.000664 0.200828 0.299555 0.251770 1088.57 1250.66 1.000
pi(T){all} 0.202756 0.000576 0.158407 0.250571 0.202047 1346.26 1382.47 1.000
alpha{1,2} 0.433836 0.237591 0.000195 1.440011 0.258625 1247.64 1320.03 1.000
alpha{3} 0.463890 0.237626 0.000415 1.479485 0.293922 1130.15 1161.26 1.000
pinvar{all} 0.994280 0.000045 0.981676 0.999995 0.996463 1354.51 1357.29 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- .*...*
9 -- .*.***
10 -- .***.*
11 -- .*..*.
12 -- .****.
13 -- .*.*..
14 -- ...*.*
15 -- ..****
16 -- ....**
17 -- .**...
18 -- ..*.*.
19 -- ..*..*
20 -- ...**.
21 -- .**.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 481 0.160227 0.008009 0.154564 0.165889 2
8 447 0.148901 0.000471 0.148568 0.149234 2
9 440 0.146569 0.001884 0.145237 0.147901 2
10 439 0.146236 0.000471 0.145903 0.146569 2
11 436 0.145237 0.003769 0.142572 0.147901 2
12 431 0.143571 0.002355 0.141905 0.145237 2
13 429 0.142905 0.002355 0.141239 0.144570 2
14 429 0.142905 0.008009 0.137242 0.148568 2
15 426 0.141905 0.015075 0.131246 0.152565 2
16 421 0.140240 0.009893 0.133245 0.147235 2
17 420 0.139907 0.004711 0.136576 0.143238 2
18 417 0.138907 0.009893 0.131912 0.145903 2
19 408 0.135909 0.002827 0.133911 0.137908 2
20 407 0.135576 0.005182 0.131912 0.139241 2
21 398 0.132578 0.007537 0.127249 0.137908 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097094 0.009360 0.000034 0.291231 0.067535 1.000 2
length{all}[2] 0.104093 0.010963 0.000182 0.310555 0.071619 1.000 2
length{all}[3] 0.098455 0.009350 0.000010 0.292664 0.070318 1.000 2
length{all}[4] 0.098417 0.009950 0.000076 0.299323 0.066009 1.002 2
length{all}[5] 0.100282 0.010815 0.000016 0.300450 0.068424 1.000 2
length{all}[6] 0.097441 0.009913 0.000026 0.292262 0.066617 1.000 2
length{all}[7] 0.106185 0.010640 0.000326 0.337015 0.075311 1.002 2
length{all}[8] 0.097940 0.008711 0.000001 0.273772 0.072523 0.999 2
length{all}[9] 0.108519 0.014904 0.000075 0.353058 0.070674 1.008 2
length{all}[10] 0.092885 0.007209 0.000017 0.256400 0.070295 0.998 2
length{all}[11] 0.102537 0.011144 0.000288 0.315840 0.070556 0.998 2
length{all}[12] 0.096775 0.009193 0.000108 0.282556 0.064197 0.998 2
length{all}[13] 0.101131 0.010636 0.000034 0.300870 0.067114 0.998 2
length{all}[14] 0.105825 0.011047 0.000345 0.310405 0.071490 1.001 2
length{all}[15] 0.099356 0.009408 0.000069 0.309701 0.069071 0.998 2
length{all}[16] 0.096903 0.011157 0.000039 0.284011 0.069601 0.999 2
length{all}[17] 0.103156 0.008666 0.000072 0.294251 0.077855 0.998 2
length{all}[18] 0.094279 0.009038 0.000018 0.276029 0.066424 0.999 2
length{all}[19] 0.097289 0.008700 0.000117 0.278058 0.066756 0.998 2
length{all}[20] 0.092972 0.007977 0.000004 0.279915 0.067164 1.004 2
length{all}[21] 0.097845 0.011092 0.000004 0.289379 0.066666 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005496
Maximum standard deviation of split frequencies = 0.015075
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------ C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 282
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 42 patterns at 94 / 94 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 42 patterns at 94 / 94 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
40992 bytes for conP
3696 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.011748 0.057992 0.048337 0.098105 0.049385 0.019682 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -397.088076
Iterating by ming2
Initial: fx= 397.088076
x= 0.01175 0.05799 0.04834 0.09811 0.04939 0.01968 0.30000 1.30000
1 h-m-p 0.0000 0.0001 227.0592 ++ 390.593037 m 0.0001 13 | 1/8
2 h-m-p 0.0012 0.0168 21.0614 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 207.4529 ++ 386.926129 m 0.0001 44 | 2/8
4 h-m-p 0.0009 0.0211 17.4709 -----------.. | 2/8
5 h-m-p 0.0000 0.0003 185.5203 +++ 376.256339 m 0.0003 76 | 3/8
6 h-m-p 0.0038 0.0320 13.1865 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 161.3839 ++ 375.961595 m 0.0000 108 | 4/8
8 h-m-p 0.0002 0.0552 9.5043 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 131.5561 ++ 374.350204 m 0.0001 138 | 5/8
10 h-m-p 0.0013 0.0726 6.7792 -----------.. | 5/8
11 h-m-p 0.0000 0.0004 92.8198 +++ 370.571128 m 0.0004 170 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 370.571128 m 8.0000 181 | 6/8
13 h-m-p 0.0210 8.0000 0.0012 ----Y 370.571128 0 0.0000 198 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 -----------C 370.571128 0 0.0000 222 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 --------Y 370.571128 0 0.0000 243
Out..
lnL = -370.571128
244 lfun, 244 eigenQcodon, 1464 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.048420 0.068741 0.098188 0.060876 0.033683 0.051233 0.299956 0.640475 0.182023
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.103426
np = 9
lnL0 = -401.982891
Iterating by ming2
Initial: fx= 401.982891
x= 0.04842 0.06874 0.09819 0.06088 0.03368 0.05123 0.29996 0.64047 0.18202
1 h-m-p 0.0000 0.0004 199.7656 +++ 385.014628 m 0.0004 15 | 1/9
2 h-m-p 0.0001 0.0007 116.5257 ++ 378.326753 m 0.0007 27 | 2/9
3 h-m-p 0.0000 0.0000 2718.7988 ++ 377.261448 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 8756.9318 ++ 374.518411 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 10913.8580 ++ 373.258523 m 0.0000 63 | 5/9
6 h-m-p 0.0012 0.0069 9.7304 -----------.. | 5/9
7 h-m-p 0.0000 0.0000 127.7153 ++ 373.106957 m 0.0000 96 | 6/9
8 h-m-p 0.0001 0.0510 6.7305 ----------.. | 6/9
9 h-m-p 0.0000 0.0003 89.9926 +++ 370.571114 m 0.0003 129 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 370.571114 m 8.0000 141 | 7/9
11 h-m-p 0.1846 8.0000 0.0003 +++ 370.571114 m 8.0000 156 | 7/9
12 h-m-p 0.0007 0.3135 3.0851 --------Y 370.571114 0 0.0000 178 | 7/9
13 h-m-p 0.1708 8.0000 0.0000 --------------Y 370.571114 0 0.0000 204 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571114 m 8.0000 221 | 7/9
15 h-m-p 0.0052 2.6180 0.2881 ---------C 370.571114 0 0.0000 244 | 7/9
16 h-m-p 0.0160 8.0000 0.0001 ----C 370.571114 0 0.0000 262 | 7/9
17 h-m-p 0.0160 8.0000 0.0001 +++++ 370.571114 m 8.0000 279 | 7/9
18 h-m-p 0.0043 2.1586 0.3268 ------------.. | 7/9
19 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571114 m 8.0000 320 | 7/9
20 h-m-p 0.0051 2.5399 0.2973 ------------.. | 7/9
21 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571114 m 8.0000 361 | 7/9
22 h-m-p 0.0051 2.5728 0.2936 ----------N 370.571114 0 0.0000 385 | 7/9
23 h-m-p 0.0160 8.0000 0.0001 +++++ 370.571114 m 8.0000 402 | 7/9
24 h-m-p 0.0047 2.3367 0.2891 ----------C 370.571114 0 0.0000 426 | 7/9
25 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571114 m 8.0000 443 | 7/9
26 h-m-p 0.0051 2.5416 0.3317 ------------.. | 7/9
27 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571114 m 8.0000 484 | 7/9
28 h-m-p 0.0053 2.6638 0.2841 ----------C 370.571114 0 0.0000 508 | 7/9
29 h-m-p 0.0160 8.0000 0.0000 ----Y 370.571114 0 0.0000 526 | 7/9
30 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571114 m 8.0000 543 | 7/9
31 h-m-p 0.0050 2.4973 0.2861 ----------Y 370.571114 0 0.0000 567 | 7/9
32 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
33 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571114 m 8.0000 609 | 7/9
34 h-m-p 0.0057 2.8313 0.2675 ---------C 370.571114 0 0.0000 632 | 7/9
35 h-m-p 0.0160 8.0000 0.0011 +++++ 370.571113 m 8.0000 649 | 7/9
36 h-m-p 0.0301 2.8174 0.3029 -------------C 370.571113 0 0.0000 676 | 7/9
37 h-m-p 0.0160 8.0000 0.0044 +++++ 370.571112 m 8.0000 693 | 7/9
38 h-m-p 0.1119 2.9331 0.3143 ------------Y 370.571112 0 0.0000 719 | 7/9
39 h-m-p 0.0160 8.0000 0.0000 ---C 370.571112 0 0.0001 736 | 7/9
40 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571112 m 8.0000 753 | 7/9
41 h-m-p 0.0063 3.1356 0.2928 ------------.. | 7/9
42 h-m-p 0.0160 8.0000 0.0001 +++++ 370.571112 m 8.0000 794 | 7/9
43 h-m-p 0.0060 2.9900 0.2642 ---------Y 370.571112 0 0.0000 817 | 7/9
44 h-m-p 0.0160 8.0000 0.0002 +++++ 370.571112 m 8.0000 834 | 7/9
45 h-m-p 0.0063 2.6295 0.2713 ------------.. | 7/9
46 h-m-p 0.0160 8.0000 0.0001 +++++ 370.571112 m 8.0000 875 | 7/9
47 h-m-p 0.0058 2.9230 0.2709 ------------.. | 7/9
48 h-m-p 0.0160 8.0000 0.0001 +++++ 370.571112 m 8.0000 916 | 7/9
49 h-m-p 0.0061 3.0374 0.2608 ------------.. | 7/9
50 h-m-p 0.0160 8.0000 0.0001 +++++ 370.571112 m 8.0000 957 | 7/9
51 h-m-p 0.0059 2.9388 0.2697 ------------.. | 7/9
52 h-m-p 0.0160 8.0000 0.0001 +++++ 370.571112 m 8.0000 998 | 7/9
53 h-m-p 0.0061 3.0299 0.2617 --------Y 370.571112 0 0.0000 1020 | 7/9
54 h-m-p 0.0160 8.0000 0.0004 +++++ 370.571111 m 8.0000 1037 | 7/9
55 h-m-p 0.0110 2.7772 0.2604 ---------C 370.571111 0 0.0000 1060 | 7/9
56 h-m-p 0.0160 8.0000 0.0064 +++++ 370.571109 m 8.0000 1077 | 7/9
57 h-m-p 0.1872 2.8712 0.2715 ------------Y 370.571109 0 0.0000 1103 | 7/9
58 h-m-p 0.0160 8.0000 0.0032 +++++ 370.571107 m 8.0000 1120 | 7/9
59 h-m-p 0.1069 3.3763 0.2404 -----------Y 370.571107 0 0.0000 1145 | 7/9
60 h-m-p 0.0160 8.0000 0.0001 ------C 370.571107 0 0.0000 1165 | 7/9
61 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571107 m 8.0000 1182 | 7/9
62 h-m-p 0.0072 3.6058 0.2335 ---------Y 370.571107 0 0.0000 1205 | 7/9
63 h-m-p 0.0160 8.0000 0.0001 +++++ 370.571107 m 8.0000 1222 | 7/9
64 h-m-p 0.0076 3.7819 0.2237 ----------C 370.571107 0 0.0000 1246 | 7/9
65 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
66 h-m-p 0.0160 8.0000 0.0001 +++++ 370.571107 m 8.0000 1288 | 7/9
67 h-m-p 0.0077 3.8341 0.2259 ------------C 370.571107 0 0.0000 1314 | 7/9
68 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571107 m 8.0000 1331 | 7/9
69 h-m-p 0.0016 0.8070 3.2007 ---------C 370.571107 0 0.0000 1354 | 7/9
70 h-m-p 0.0160 8.0000 0.0000 --N 370.571107 0 0.0001 1368 | 7/9
71 h-m-p 0.0160 8.0000 0.0001 ------Y 370.571107 0 0.0000 1388
Out..
lnL = -370.571107
1389 lfun, 4167 eigenQcodon, 16668 P(t)
Time used: 0:05
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.059266 0.054783 0.095840 0.100604 0.014365 0.071631 0.233641 0.848685 0.425136 0.346831 1.518727
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.400910
np = 11
lnL0 = -405.594598
Iterating by ming2
Initial: fx= 405.594598
x= 0.05927 0.05478 0.09584 0.10060 0.01436 0.07163 0.23364 0.84869 0.42514 0.34683 1.51873
1 h-m-p 0.0000 0.0002 205.5600 +++ 398.364119 m 0.0002 17 | 1/11
2 h-m-p 0.0003 0.0021 106.7491 ++ 380.146010 m 0.0021 31 | 2/11
3 h-m-p 0.0000 0.0000 12425.5602 ++ 378.574639 m 0.0000 45 | 3/11
4 h-m-p 0.0001 0.0007 179.7860 ++ 374.927007 m 0.0007 59 | 4/11
5 h-m-p 0.0000 0.0000 2723.5863 ++ 374.522884 m 0.0000 73 | 5/11
6 h-m-p 0.0015 0.0928 3.6629 -----------.. | 5/11
7 h-m-p 0.0000 0.0002 127.0310 +++ 370.966925 m 0.0002 111 | 6/11
8 h-m-p 0.0078 0.1352 2.5056 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 92.8098 ++ 370.571121 m 0.0000 150 | 7/11
10 h-m-p 0.0468 8.0000 0.0000 ++++ 370.571121 m 8.0000 166 | 7/11
11 h-m-p 0.1060 8.0000 0.0002 ++++ 370.571121 m 8.0000 186 | 7/11
12 h-m-p 0.0160 8.0000 7.3661 ----------C 370.571121 0 0.0000 214 | 7/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 370.571121 m 8.0000 231 | 7/11
14 h-m-p 0.0160 8.0000 0.7338 --------C 370.571121 0 0.0000 257 | 7/11
15 h-m-p 0.0160 8.0000 0.0002 ---Y 370.571121 0 0.0001 278 | 7/11
16 h-m-p 0.0160 8.0000 0.0001 --C 370.571121 0 0.0003 298
Out..
lnL = -370.571121
299 lfun, 1196 eigenQcodon, 5382 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -370.575984 S = -370.569611 -0.002436
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 42 patterns 0:06
did 20 / 42 patterns 0:06
did 30 / 42 patterns 0:06
did 40 / 42 patterns 0:06
did 42 / 42 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.082429 0.014508 0.071706 0.013835 0.022696 0.032493 0.190405 0.934605 1.407393
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.586038
np = 9
lnL0 = -391.978663
Iterating by ming2
Initial: fx= 391.978663
x= 0.08243 0.01451 0.07171 0.01384 0.02270 0.03249 0.19040 0.93460 1.40739
1 h-m-p 0.0000 0.0002 214.7990 ++ 384.673430 m 0.0002 14 | 1/9
2 h-m-p 0.0016 0.0172 18.9415 ++ 383.760825 m 0.0172 26 | 2/9
3 h-m-p 0.0027 0.0133 8.0033 ------------.. | 2/9
4 h-m-p 0.0000 0.0000 196.8005 ++ 382.267097 m 0.0000 60 | 3/9
5 h-m-p 0.0005 0.0516 12.9610 -----------.. | 3/9
6 h-m-p 0.0000 0.0001 176.6657 ++ 379.781829 m 0.0001 93 | 4/9
7 h-m-p 0.0011 0.0605 11.0770 -----------.. | 4/9
8 h-m-p 0.0000 0.0001 154.1139 ++ 377.536007 m 0.0001 126 | 5/9
9 h-m-p 0.0013 0.0763 8.8178 -----------.. | 5/9
10 h-m-p 0.0000 0.0004 126.5270 +++ 371.426039 m 0.0004 160 | 6/9
11 h-m-p 0.0066 0.1358 5.0707 ------------.. | 6/9
12 h-m-p 0.0000 0.0001 92.0888 ++ 370.571107 m 0.0001 194 | 7/9
13 h-m-p 0.8267 8.0000 0.0000 ++ 370.571107 m 8.0000 206 | 7/9
14 h-m-p 0.1214 8.0000 0.0001 ----Y 370.571107 0 0.0001 224
Out..
lnL = -370.571107
225 lfun, 2475 eigenQcodon, 13500 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.033110 0.061594 0.059804 0.036624 0.019450 0.080290 0.000100 0.900000 0.885856 1.404278 1.299956
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.443468
np = 11
lnL0 = -396.107264
Iterating by ming2
Initial: fx= 396.107264
x= 0.03311 0.06159 0.05980 0.03662 0.01945 0.08029 0.00011 0.90000 0.88586 1.40428 1.29996
1 h-m-p 0.0000 0.0000 204.0130 ++ 395.893274 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0052 50.8260 ++++ 384.703892 m 0.0052 32 | 2/11
3 h-m-p 0.0000 0.0002 363.8963 ++ 378.929349 m 0.0002 46 | 3/11
4 h-m-p 0.0007 0.0036 22.1108 ++ 378.275396 m 0.0036 60 | 4/11
5 h-m-p 0.0002 0.0012 190.8610 ++ 373.877435 m 0.0012 74 | 5/11
6 h-m-p 0.0002 0.0008 99.7875 ++ 373.463198 m 0.0008 88 | 6/11
7 h-m-p 0.0001 0.0004 650.3197 ++ 370.571119 m 0.0004 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 370.571119 m 8.0000 116 | 7/11
9 h-m-p 0.0144 7.2106 0.1190 --------C 370.571119 0 0.0000 142 | 7/11
10 h-m-p 0.0160 8.0000 0.0012 +++++ 370.571119 m 8.0000 163 | 7/11
11 h-m-p 0.0137 1.2227 0.7050 -----------C 370.571119 0 0.0000 192 | 7/11
12 h-m-p 0.0160 8.0000 0.0014 +++++ 370.571119 m 8.0000 213 | 7/11
13 h-m-p 0.0224 1.5921 0.4872 ----------Y 370.571119 0 0.0000 241 | 7/11
14 h-m-p 0.0160 8.0000 0.0020 +++++ 370.571118 m 8.0000 262 | 7/11
15 h-m-p 0.0395 1.8135 0.4136 ----------C 370.571118 0 0.0000 290 | 7/11
16 h-m-p 0.0056 2.8101 0.1104 +++++ 370.571104 m 2.8101 311 | 8/11
17 h-m-p 1.6000 8.0000 0.0277 ++ 370.571104 m 8.0000 329 | 8/11
18 h-m-p 0.1225 8.0000 1.8071 ++++ 370.571099 m 8.0000 348 | 8/11
19 h-m-p 1.6000 8.0000 0.3903 ++ 370.571099 m 8.0000 362 | 8/11
20 h-m-p 0.1027 0.6017 30.3948 -----------Y 370.571099 0 0.0000 390 | 8/11
21 h-m-p 0.2365 8.0000 0.0000 +++ 370.571099 m 8.0000 405 | 8/11
22 h-m-p 0.0160 8.0000 0.0015 +++++ 370.571099 m 8.0000 425 | 8/11
23 h-m-p 0.0014 0.7230 23.1224 ----------Y 370.571099 0 0.0000 452 | 8/11
24 h-m-p 0.0160 8.0000 0.0000 -----C 370.571099 0 0.0000 471 | 8/11
25 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/11
26 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571099 m 8.0000 519 | 8/11
27 h-m-p 0.0160 8.0000 2.2145 -------------.. | 8/11
28 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571099 m 8.0000 564 | 8/11
29 h-m-p 0.0171 8.0000 0.0026 ---------Y 370.571099 0 0.0000 590 | 8/11
30 h-m-p 0.0160 8.0000 0.0000 ------------N 370.571099 0 0.0000 619 | 8/11
31 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571099 m 8.0000 639 | 8/11
32 h-m-p 0.0160 8.0000 0.4764 ----------Y 370.571099 0 0.0000 666 | 8/11
33 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571099 m 8.0000 686 | 8/11
34 h-m-p 0.0160 8.0000 1.9894 -------------.. | 8/11
35 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571099 m 8.0000 731 | 8/11
36 h-m-p 0.0160 8.0000 0.0046 +++++ 370.571099 m 8.0000 751 | 8/11
37 h-m-p 0.0160 8.0000 2.5599 ----------Y 370.571099 0 0.0000 778 | 8/11
38 h-m-p 0.0160 8.0000 0.0000 +++++ 370.571099 m 8.0000 795 | 8/11
39 h-m-p 0.0160 8.0000 0.0074 +++++ 370.571098 m 8.0000 815 | 8/11
40 h-m-p 0.0009 0.1750 63.9137 ---------C 370.571098 0 0.0000 841 | 8/11
41 h-m-p 0.0160 8.0000 0.0000 ---N 370.571098 0 0.0001 858 | 8/11
42 h-m-p 0.0160 8.0000 0.0001 ----N 370.571098 0 0.0000 879
Out..
lnL = -370.571098
880 lfun, 10560 eigenQcodon, 58080 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -370.587301 S = -370.570263 -0.007488
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 42 patterns 0:26
did 20 / 42 patterns 0:26
did 30 / 42 patterns 0:26
did 40 / 42 patterns 0:26
did 42 / 42 patterns 0:26
Time used: 0:26
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=94
NC_011896_1_WP_010908374_1_1589_MLBR_RS07555 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
NC_002677_1_NP_302053_1_925_phhB MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
NZ_LVXE01000037_1_WP_010908374_1_1638_A3216_RS10000 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
NZ_LYPH01000042_1_WP_010908374_1_1636_A8144_RS07815 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
NZ_CP029543_1_WP_010908374_1_1618_DIJ64_RS08240 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
NZ_AP014567_1_WP_010908374_1_1658_JK2ML_RS08440 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE
**************************************************
NC_011896_1_WP_010908374_1_1589_MLBR_RS07555 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
NC_002677_1_NP_302053_1_925_phhB TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
NZ_LVXE01000037_1_WP_010908374_1_1638_A3216_RS10000 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
NZ_LYPH01000042_1_WP_010908374_1_1636_A8144_RS07815 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
NZ_CP029543_1_WP_010908374_1_1618_DIJ64_RS08240 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
NZ_AP014567_1_WP_010908374_1_1658_JK2ML_RS08440 TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
********************************************
>NC_011896_1_WP_010908374_1_1589_MLBR_RS07555 ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA TGGCACGCGATATCGACAGGCTCATCGGGGAC >NC_002677_1_NP_302053_1_925_phhB ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA TGGCACGCGATATCGACAGGCTCATCGGGGAC >NZ_LVXE01000037_1_WP_010908374_1_1638_A3216_RS10000 ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA TGGCACGCGATATCGACAGGCTCATCGGGGAC >NZ_LYPH01000042_1_WP_010908374_1_1636_A8144_RS07815 ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA TGGCACGCGATATCGACAGGCTCATCGGGGAC >NZ_CP029543_1_WP_010908374_1_1618_DIJ64_RS08240 ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA TGGCACGCGATATCGACAGGCTCATCGGGGAC >NZ_AP014567_1_WP_010908374_1_1658_JK2ML_RS08440 ATGACTGTGCTAACTGATGAGCAAGTAGACGCGGCACTGCTCGACCTCAA CGACTGGAAGCATACCGACGGCGCACTGTGCCGCTCGATCAAATTTCCGA CGTTTCTCGCCGGCATCGACGCTGTATGTCGGGTAGCCGAGCACGCCGAA ACCAAAGATCATCACCCAGATATCGATATCCGTTATCGGACAGTTACGTT CATTCTAGTGACACATTATGCCGATGGCATCACCAAGAAGGACATCACGA TGGCACGCGATATCGACAGGCTCATCGGGGAC
>NC_011896_1_WP_010908374_1_1589_MLBR_RS07555 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD >NC_002677_1_NP_302053_1_925_phhB MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD >NZ_LVXE01000037_1_WP_010908374_1_1638_A3216_RS10000 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD >NZ_LYPH01000042_1_WP_010908374_1_1636_A8144_RS07815 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD >NZ_CP029543_1_WP_010908374_1_1618_DIJ64_RS08240 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD >NZ_AP014567_1_WP_010908374_1_1658_JK2ML_RS08440 MTVLTDEQVDAALLDLNDWKHTDGALCRSIKFPTFLAGIDAVCRVAEHAE TKDHHPDIDIRYRTVTFILVTHYADGITKKDITMARDIDRLIGD
#NEXUS
[ID: 9635301982]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908374_1_1589_MLBR_RS07555
NC_002677_1_NP_302053_1_925_phhB
NZ_LVXE01000037_1_WP_010908374_1_1638_A3216_RS10000
NZ_LYPH01000042_1_WP_010908374_1_1636_A8144_RS07815
NZ_CP029543_1_WP_010908374_1_1618_DIJ64_RS08240
NZ_AP014567_1_WP_010908374_1_1658_JK2ML_RS08440
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908374_1_1589_MLBR_RS07555,
2 NC_002677_1_NP_302053_1_925_phhB,
3 NZ_LVXE01000037_1_WP_010908374_1_1638_A3216_RS10000,
4 NZ_LYPH01000042_1_WP_010908374_1_1636_A8144_RS07815,
5 NZ_CP029543_1_WP_010908374_1_1618_DIJ64_RS08240,
6 NZ_AP014567_1_WP_010908374_1_1658_JK2ML_RS08440
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06753509,2:0.07161852,3:0.07031841,4:0.06600862,5:0.06842359,6:0.06661711);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06753509,2:0.07161852,3:0.07031841,4:0.06600862,5:0.06842359,6:0.06661711);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -390.66 -399.17
2 -390.60 -393.54
--------------------------------------
TOTAL -390.63 -398.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/phhB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896065 0.088902 0.378410 1.502819 0.868862 1415.48 1458.24 1.000
r(A<->C){all} 0.165019 0.019367 0.000122 0.449940 0.131654 142.65 186.04 1.003
r(A<->G){all} 0.159674 0.018150 0.000044 0.424713 0.122250 220.86 269.34 1.004
r(A<->T){all} 0.161734 0.018749 0.000033 0.434258 0.120526 190.06 257.26 1.000
r(C<->G){all} 0.169458 0.021540 0.000003 0.461421 0.128683 166.17 202.90 1.000
r(C<->T){all} 0.174571 0.021843 0.000093 0.465460 0.135446 211.14 250.35 1.000
r(G<->T){all} 0.169543 0.019047 0.000001 0.441900 0.133601 77.06 181.53 1.000
pi(A){all} 0.261786 0.000679 0.212504 0.314393 0.260734 1103.31 1136.90 1.001
pi(C){all} 0.283467 0.000729 0.230692 0.336275 0.282847 1236.95 1323.64 1.000
pi(G){all} 0.251990 0.000664 0.200828 0.299555 0.251770 1088.57 1250.66 1.000
pi(T){all} 0.202756 0.000576 0.158407 0.250571 0.202047 1346.26 1382.47 1.000
alpha{1,2} 0.433836 0.237591 0.000195 1.440011 0.258625 1247.64 1320.03 1.000
alpha{3} 0.463890 0.237626 0.000415 1.479485 0.293922 1130.15 1161.26 1.000
pinvar{all} 0.994280 0.000045 0.981676 0.999995 0.996463 1354.51 1357.29 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/phhB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 94
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 1 1
TTC 1 1 1 1 1 1 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 3 3 3 3 3 3 | Arg CGT 1 1 1 1 1 1
CTC 4 4 4 4 4 4 | CCC 0 0 0 0 0 0 | CAC 2 2 2 2 2 2 | CGC 2 2 2 2 2 2
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 0 0 0 0 0 0 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 8 8 8 8 8 8 | ACC 3 3 3 3 3 3 | AAC 1 1 1 1 1 1 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 3 3 3 3 3 3 | AAG 3 3 3 3 3 3 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 1 1 1 1 1 1 | Asp GAT 6 6 6 6 6 6 | Gly GGT 0 0 0 0 0 0
GTC 0 0 0 0 0 0 | GCC 4 4 4 4 4 4 | GAC 8 8 8 8 8 8 | GGC 3 3 3 3 3 3
GTA 3 3 3 3 3 3 | GCA 3 3 3 3 3 3 | Glu GAA 1 1 1 1 1 1 | GGA 0 0 0 0 0 0
GTG 2 2 2 2 2 2 | GCG 1 1 1 1 1 1 | GAG 2 2 2 2 2 2 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908374_1_1589_MLBR_RS07555
position 1: T:0.09574 C:0.22340 A:0.29787 G:0.38298
position 2: T:0.29787 C:0.23404 A:0.32979 G:0.13830
position 3: T:0.21277 C:0.39362 A:0.15957 G:0.23404
Average T:0.20213 C:0.28369 A:0.26241 G:0.25177
#2: NC_002677_1_NP_302053_1_925_phhB
position 1: T:0.09574 C:0.22340 A:0.29787 G:0.38298
position 2: T:0.29787 C:0.23404 A:0.32979 G:0.13830
position 3: T:0.21277 C:0.39362 A:0.15957 G:0.23404
Average T:0.20213 C:0.28369 A:0.26241 G:0.25177
#3: NZ_LVXE01000037_1_WP_010908374_1_1638_A3216_RS10000
position 1: T:0.09574 C:0.22340 A:0.29787 G:0.38298
position 2: T:0.29787 C:0.23404 A:0.32979 G:0.13830
position 3: T:0.21277 C:0.39362 A:0.15957 G:0.23404
Average T:0.20213 C:0.28369 A:0.26241 G:0.25177
#4: NZ_LYPH01000042_1_WP_010908374_1_1636_A8144_RS07815
position 1: T:0.09574 C:0.22340 A:0.29787 G:0.38298
position 2: T:0.29787 C:0.23404 A:0.32979 G:0.13830
position 3: T:0.21277 C:0.39362 A:0.15957 G:0.23404
Average T:0.20213 C:0.28369 A:0.26241 G:0.25177
#5: NZ_CP029543_1_WP_010908374_1_1618_DIJ64_RS08240
position 1: T:0.09574 C:0.22340 A:0.29787 G:0.38298
position 2: T:0.29787 C:0.23404 A:0.32979 G:0.13830
position 3: T:0.21277 C:0.39362 A:0.15957 G:0.23404
Average T:0.20213 C:0.28369 A:0.26241 G:0.25177
#6: NZ_AP014567_1_WP_010908374_1_1658_JK2ML_RS08440
position 1: T:0.09574 C:0.22340 A:0.29787 G:0.38298
position 2: T:0.29787 C:0.23404 A:0.32979 G:0.13830
position 3: T:0.21277 C:0.39362 A:0.15957 G:0.23404
Average T:0.20213 C:0.28369 A:0.26241 G:0.25177
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 6
TTC 6 | TCC 0 | TAC 0 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 6 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 18 | Arg R CGT 6
CTC 24 | CCC 0 | CAC 12 | CGC 12
CTA 12 | CCA 6 | Gln Q CAA 6 | CGA 0
CTG 12 | CCG 6 | CAG 0 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 0
ATC 48 | ACC 18 | AAC 6 | AGC 0
ATA 0 | ACA 12 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 12 | ACG 18 | AAG 18 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 6 | Asp D GAT 36 | Gly G GGT 0
GTC 0 | GCC 24 | GAC 48 | GGC 18
GTA 18 | GCA 18 | Glu E GAA 6 | GGA 0
GTG 12 | GCG 6 | GAG 12 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09574 C:0.22340 A:0.29787 G:0.38298
position 2: T:0.29787 C:0.23404 A:0.32979 G:0.13830
position 3: T:0.21277 C:0.39362 A:0.15957 G:0.23404
Average T:0.20213 C:0.28369 A:0.26241 G:0.25177
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -370.571128 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299956 1.299956
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908374_1_1589_MLBR_RS07555: 0.000004, NC_002677_1_NP_302053_1_925_phhB: 0.000004, NZ_LVXE01000037_1_WP_010908374_1_1638_A3216_RS10000: 0.000004, NZ_LYPH01000042_1_WP_010908374_1_1636_A8144_RS07815: 0.000004, NZ_CP029543_1_WP_010908374_1_1618_DIJ64_RS08240: 0.000004, NZ_AP014567_1_WP_010908374_1_1658_JK2ML_RS08440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29996
omega (dN/dS) = 1.29996
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 226.3 55.7 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 226.3 55.7 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 226.3 55.7 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 226.3 55.7 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 226.3 55.7 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 226.3 55.7 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -370.571107 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.233641 0.792335 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908374_1_1589_MLBR_RS07555: 0.000004, NC_002677_1_NP_302053_1_925_phhB: 0.000004, NZ_LVXE01000037_1_WP_010908374_1_1638_A3216_RS10000: 0.000004, NZ_LYPH01000042_1_WP_010908374_1_1636_A8144_RS07815: 0.000004, NZ_CP029543_1_WP_010908374_1_1618_DIJ64_RS08240: 0.000004, NZ_AP014567_1_WP_010908374_1_1658_JK2ML_RS08440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.23364
MLEs of dN/dS (w) for site classes (K=2)
p: 0.79233 0.20767
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 227.5 54.5 0.2077 0.0000 0.0000 0.0 0.0
7..2 0.000 227.5 54.5 0.2077 0.0000 0.0000 0.0 0.0
7..3 0.000 227.5 54.5 0.2077 0.0000 0.0000 0.0 0.0
7..4 0.000 227.5 54.5 0.2077 0.0000 0.0000 0.0 0.0
7..5 0.000 227.5 54.5 0.2077 0.0000 0.0000 0.0 0.0
7..6 0.000 227.5 54.5 0.2077 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -370.571121 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.190405 0.495232 0.300476 0.000001 1.609931
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908374_1_1589_MLBR_RS07555: 0.000004, NC_002677_1_NP_302053_1_925_phhB: 0.000004, NZ_LVXE01000037_1_WP_010908374_1_1638_A3216_RS10000: 0.000004, NZ_LYPH01000042_1_WP_010908374_1_1636_A8144_RS07815: 0.000004, NZ_CP029543_1_WP_010908374_1_1618_DIJ64_RS08240: 0.000004, NZ_AP014567_1_WP_010908374_1_1658_JK2ML_RS08440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.19040
MLEs of dN/dS (w) for site classes (K=3)
p: 0.49523 0.30048 0.20429
w: 0.00000 1.00000 1.60993
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 228.2 53.8 0.6294 0.0000 0.0000 0.0 0.0
7..2 0.000 228.2 53.8 0.6294 0.0000 0.0000 0.0 0.0
7..3 0.000 228.2 53.8 0.6294 0.0000 0.0000 0.0 0.0
7..4 0.000 228.2 53.8 0.6294 0.0000 0.0000 0.0 0.0
7..5 0.000 228.2 53.8 0.6294 0.0000 0.0000 0.0 0.0
7..6 0.000 228.2 53.8 0.6294 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908374_1_1589_MLBR_RS07555)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908374_1_1589_MLBR_RS07555)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -370.571107 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.672284 1.441798
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908374_1_1589_MLBR_RS07555: 0.000004, NC_002677_1_NP_302053_1_925_phhB: 0.000004, NZ_LVXE01000037_1_WP_010908374_1_1638_A3216_RS10000: 0.000004, NZ_LYPH01000042_1_WP_010908374_1_1636_A8144_RS07815: 0.000004, NZ_CP029543_1_WP_010908374_1_1618_DIJ64_RS08240: 0.000004, NZ_AP014567_1_WP_010908374_1_1658_JK2ML_RS08440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.67228 q = 1.44180
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00773 0.03995 0.08650 0.14506 0.21518 0.29744 0.39345 0.50658 0.64408 0.82862
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 232.0 50.0 0.3165 0.0000 0.0000 0.0 0.0
7..2 0.000 232.0 50.0 0.3165 0.0000 0.0000 0.0 0.0
7..3 0.000 232.0 50.0 0.3165 0.0000 0.0000 0.0 0.0
7..4 0.000 232.0 50.0 0.3165 0.0000 0.0000 0.0 0.0
7..5 0.000 232.0 50.0 0.3165 0.0000 0.0000 0.0 0.0
7..6 0.000 232.0 50.0 0.3165 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -370.571098 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 2.821412 10.773080 16.468976
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908374_1_1589_MLBR_RS07555: 0.000004, NC_002677_1_NP_302053_1_925_phhB: 0.000004, NZ_LVXE01000037_1_WP_010908374_1_1638_A3216_RS10000: 0.000004, NZ_LYPH01000042_1_WP_010908374_1_1636_A8144_RS07815: 0.000004, NZ_CP029543_1_WP_010908374_1_1618_DIJ64_RS08240: 0.000004, NZ_AP014567_1_WP_010908374_1_1658_JK2ML_RS08440: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 2.82141 q = 10.77308
(p1 = 0.00001) w = 16.46898
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.06052 0.09861 0.12734 0.15359 0.17959 0.20683 0.23697 0.27269 0.32012 0.40470 16.46898
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 232.0 50.0 0.2063 0.0000 0.0000 0.0 0.0
7..2 0.000 232.0 50.0 0.2063 0.0000 0.0000 0.0 0.0
7..3 0.000 232.0 50.0 0.2063 0.0000 0.0000 0.0 0.0
7..4 0.000 232.0 50.0 0.2063 0.0000 0.0000 0.0 0.0
7..5 0.000 232.0 50.0 0.2063 0.0000 0.0000 0.0 0.0
7..6 0.000 232.0 50.0 0.2063 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908374_1_1589_MLBR_RS07555)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:26
Model 1: NearlyNeutral -370.571107 Model 2: PositiveSelection -370.571121 Model 0: one-ratio -370.571128 Model 7: beta -370.571107 Model 8: beta&w>1 -370.571098 Model 0 vs 1 4.200000000764703E-5 Model 2 vs 1 2.8000000042993634E-5 Model 8 vs 7 1.799999995455437E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
