--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:18:50 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/phoH2/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/phoH2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/phoH2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/phoH2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1763.62         -1767.64
2      -1763.61         -1769.23
--------------------------------------
TOTAL    -1763.61         -1768.73
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/phoH2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/phoH2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/phoH2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.888408    0.086532    0.349755    1.474431    0.853626   1501.00   1501.00    1.001
r(A<->C){all}   0.156460    0.016414    0.000031    0.417816    0.123814    177.04    282.56    1.000
r(A<->G){all}   0.158233    0.017732    0.000064    0.424418    0.124087    262.76    297.87    1.005
r(A<->T){all}   0.166702    0.019893    0.000023    0.447736    0.130517    177.01    206.09    1.004
r(C<->G){all}   0.179721    0.022012    0.000148    0.467805    0.143541    195.91    206.59    1.000
r(C<->T){all}   0.165604    0.020352    0.000146    0.455232    0.126375    207.82    246.24    1.000
r(G<->T){all}   0.173280    0.021516    0.000047    0.484488    0.133272    172.44    231.21    1.010
pi(A){all}      0.173296    0.000112    0.153560    0.194216    0.173014   1145.28   1221.25    1.000
pi(C){all}      0.283948    0.000152    0.257761    0.305990    0.284008   1143.56   1303.57    1.000
pi(G){all}      0.329812    0.000169    0.305355    0.355374    0.329755   1146.35   1200.54    1.000
pi(T){all}      0.212943    0.000133    0.189885    0.236093    0.212719    931.80   1103.93    1.000
alpha{1,2}      0.418625    0.226583    0.000215    1.351468    0.248448   1299.56   1340.56    1.000
alpha{3}        0.464477    0.233208    0.000291    1.435118    0.305603   1112.48   1253.44    1.000
pinvar{all}     0.998805    0.000002    0.996178    1.000000    0.999238    954.39   1053.81    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1702.50138
Model 2: PositiveSelection	-1702.500977
Model 0: one-ratio	-1702.501594
Model 7: beta	-1702.500977
Model 8: beta&w>1	-1702.500977


Model 0 vs 1	4.2800000028364593E-4

Model 2 vs 1	8.060000000114087E-4

Model 8 vs 7	0.0
>C1
VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
>C2
VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
>C3
VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
>C4
VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
>C5
VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
>C6
VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=433 

C1              VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
C2              VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
C3              VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
C4              VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
C5              VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
C6              VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
                **************************************************

C1              FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
C2              FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
C3              FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
C4              FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
C5              FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
C6              FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
                **************************************************

C1              DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
C2              DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
C3              DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
C4              DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
C5              DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
C6              DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
                **************************************************

C1              ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
C2              ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
C3              ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
C4              ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
C5              ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
C6              ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
                **************************************************

C1              GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
C2              GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
C3              GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
C4              GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
C5              GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
C6              GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
                **************************************************

C1              TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
C2              TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
C3              TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
C4              TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
C5              TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
C6              TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
                **************************************************

C1              PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
C2              PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
C3              PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
C4              PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
C5              PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
C6              PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
                **************************************************

C1              AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
C2              AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
C3              AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
C4              AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
C5              AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
C6              AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
                **************************************************

C1              GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
C2              GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
C3              GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
C4              GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
C5              GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
C6              GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
                *********************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  433 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  433 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12990]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [12990]--->[12990]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.542 Mb, Max= 31.020 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
C2              VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
C3              VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
C4              VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
C5              VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
C6              VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
                **************************************************

C1              FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
C2              FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
C3              FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
C4              FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
C5              FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
C6              FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
                **************************************************

C1              DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
C2              DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
C3              DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
C4              DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
C5              DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
C6              DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
                **************************************************

C1              ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
C2              ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
C3              ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
C4              ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
C5              ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
C6              ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
                **************************************************

C1              GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
C2              GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
C3              GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
C4              GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
C5              GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
C6              GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
                **************************************************

C1              TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
C2              TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
C3              TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
C4              TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
C5              TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
C6              TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
                **************************************************

C1              PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
C2              PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
C3              PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
C4              PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
C5              PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
C6              PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
                **************************************************

C1              AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
C2              AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
C3              AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
C4              AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
C5              AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
C6              AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
                **************************************************

C1              GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
C2              GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
C3              GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
C4              GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
C5              GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
C6              GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
                *********************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGACCGATATCCGGACGTACGTGATCGACACCTCTGTGTTGTTGTCTGA
C2              GTGACCGATATCCGGACGTACGTGATCGACACCTCTGTGTTGTTGTCTGA
C3              GTGACCGATATCCGGACGTACGTGATCGACACCTCTGTGTTGTTGTCTGA
C4              GTGACCGATATCCGGACGTACGTGATCGACACCTCTGTGTTGTTGTCTGA
C5              GTGACCGATATCCGGACGTACGTGATCGACACCTCTGTGTTGTTGTCTGA
C6              GTGACCGATATCCGGACGTACGTGATCGACACCTCTGTGTTGTTGTCTGA
                **************************************************

C1              TCCCTGGGCGTGCAGTCGGTTCGCCGAACACGAAGTGGTGGTGCCGCTGG
C2              TCCCTGGGCGTGCAGTCGGTTCGCCGAACACGAAGTGGTGGTGCCGCTGG
C3              TCCCTGGGCGTGCAGTCGGTTCGCCGAACACGAAGTGGTGGTGCCGCTGG
C4              TCCCTGGGCGTGCAGTCGGTTCGCCGAACACGAAGTGGTGGTGCCGCTGG
C5              TCCCTGGGCGTGCAGTCGGTTCGCCGAACACGAAGTGGTGGTGCCGCTGG
C6              TCCCTGGGCGTGCAGTCGGTTCGCCGAACACGAAGTGGTGGTGCCGCTGG
                **************************************************

C1              TGGTAATCAGTGAACTGGAGGCCAAACGCCACCACCATGAACTGGGGTGG
C2              TGGTAATCAGTGAACTGGAGGCCAAACGCCACCACCATGAACTGGGGTGG
C3              TGGTAATCAGTGAACTGGAGGCCAAACGCCACCACCATGAACTGGGGTGG
C4              TGGTAATCAGTGAACTGGAGGCCAAACGCCACCACCATGAACTGGGGTGG
C5              TGGTAATCAGTGAACTGGAGGCCAAACGCCACCACCATGAACTGGGGTGG
C6              TGGTAATCAGTGAACTGGAGGCCAAACGCCACCACCATGAACTGGGGTGG
                **************************************************

C1              TTTGCTCGTCAGGCGTTGCGTCTGTTCGATGATCTTCGACTCGATCACGG
C2              TTTGCTCGTCAGGCGTTGCGTCTGTTCGATGATCTTCGACTCGATCACGG
C3              TTTGCTCGTCAGGCGTTGCGTCTGTTCGATGATCTTCGACTCGATCACGG
C4              TTTGCTCGTCAGGCGTTGCGTCTGTTCGATGATCTTCGACTCGATCACGG
C5              TTTGCTCGTCAGGCGTTGCGTCTGTTCGATGATCTTCGACTCGATCACGG
C6              TTTGCTCGTCAGGCGTTGCGTCTGTTCGATGATCTTCGACTCGATCACGG
                **************************************************

C1              ACGGCTGGATCAGCCCATACCGGTAGGAATGCAAGGCGGGACGCTGCATG
C2              ACGGCTGGATCAGCCCATACCGGTAGGAATGCAAGGCGGGACGCTGCATG
C3              ACGGCTGGATCAGCCCATACCGGTAGGAATGCAAGGCGGGACGCTGCATG
C4              ACGGCTGGATCAGCCCATACCGGTAGGAATGCAAGGCGGGACGCTGCATG
C5              ACGGCTGGATCAGCCCATACCGGTAGGAATGCAAGGCGGGACGCTGCATG
C6              ACGGCTGGATCAGCCCATACCGGTAGGAATGCAAGGCGGGACGCTGCATG
                **************************************************

C1              TTGAACTCAACCACTCGGACCCCACGGTGCTGCCTGCCGGCTTTCGCACC
C2              TTGAACTCAACCACTCGGACCCCACGGTGCTGCCTGCCGGCTTTCGCACC
C3              TTGAACTCAACCACTCGGACCCCACGGTGCTGCCTGCCGGCTTTCGCACC
C4              TTGAACTCAACCACTCGGACCCCACGGTGCTGCCTGCCGGCTTTCGCACC
C5              TTGAACTCAACCACTCGGACCCCACGGTGCTGCCTGCCGGCTTTCGCACC
C6              TTGAACTCAACCACTCGGACCCCACGGTGCTGCCTGCCGGCTTTCGCACC
                **************************************************

C1              GACAGTAACGATTCCCGGATCTTGAGCTGTGCTGCCAACCTGGCCGCCGA
C2              GACAGTAACGATTCCCGGATCTTGAGCTGTGCTGCCAACCTGGCCGCCGA
C3              GACAGTAACGATTCCCGGATCTTGAGCTGTGCTGCCAACCTGGCCGCCGA
C4              GACAGTAACGATTCCCGGATCTTGAGCTGTGCTGCCAACCTGGCCGCCGA
C5              GACAGTAACGATTCCCGGATCTTGAGCTGTGCTGCCAACCTGGCCGCCGA
C6              GACAGTAACGATTCCCGGATCTTGAGCTGTGCTGCCAACCTGGCCGCCGA
                **************************************************

C1              AGGTAGGCGCGTCACGCTGGTCAGCAAGGACCTTCCACTTCGGGTCAAGG
C2              AGGTAGGCGCGTCACGCTGGTCAGCAAGGACCTTCCACTTCGGGTCAAGG
C3              AGGTAGGCGCGTCACGCTGGTCAGCAAGGACCTTCCACTTCGGGTCAAGG
C4              AGGTAGGCGCGTCACGCTGGTCAGCAAGGACCTTCCACTTCGGGTCAAGG
C5              AGGTAGGCGCGTCACGCTGGTCAGCAAGGACCTTCCACTTCGGGTCAAGG
C6              AGGTAGGCGCGTCACGCTGGTCAGCAAGGACCTTCCACTTCGGGTCAAGG
                **************************************************

C1              CCGCTGCGGTCGGACTTGCCGCCGACGAGTACCACGCGCAGGATGTTGTC
C2              CCGCTGCGGTCGGACTTGCCGCCGACGAGTACCACGCGCAGGATGTTGTC
C3              CCGCTGCGGTCGGACTTGCCGCCGACGAGTACCACGCGCAGGATGTTGTC
C4              CCGCTGCGGTCGGACTTGCCGCCGACGAGTACCACGCGCAGGATGTTGTC
C5              CCGCTGCGGTCGGACTTGCCGCCGACGAGTACCACGCGCAGGATGTTGTC
C6              CCGCTGCGGTCGGACTTGCCGCCGACGAGTACCACGCGCAGGATGTTGTC
                **************************************************

C1              GCTTCCGGCTGGTCCGGGATGCACGAGATTGAGACTTGCGCTGAAGACAT
C2              GCTTCCGGCTGGTCCGGGATGCACGAGATTGAGACTTGCGCTGAAGACAT
C3              GCTTCCGGCTGGTCCGGGATGCACGAGATTGAGACTTGCGCTGAAGACAT
C4              GCTTCCGGCTGGTCCGGGATGCACGAGATTGAGACTTGCGCTGAAGACAT
C5              GCTTCCGGCTGGTCCGGGATGCACGAGATTGAGACTTGCGCTGAAGACAT
C6              GCTTCCGGCTGGTCCGGGATGCACGAGATTGAGACTTGCGCTGAAGACAT
                **************************************************

C1              CGACGCACTGTTCGCCGAAGGCAAGATCGACCTGGGCGAAGCCAGAGACC
C2              CGACGCACTGTTCGCCGAAGGCAAGATCGACCTGGGCGAAGCCAGAGACC
C3              CGACGCACTGTTCGCCGAAGGCAAGATCGACCTGGGCGAAGCCAGAGACC
C4              CGACGCACTGTTCGCCGAAGGCAAGATCGACCTGGGCGAAGCCAGAGACC
C5              CGACGCACTGTTCGCCGAAGGCAAGATCGACCTGGGCGAAGCCAGAGACC
C6              CGACGCACTGTTCGCCGAAGGCAAGATCGACCTGGGCGAAGCCAGAGACC
                **************************************************

C1              TGCCTTGTCATACTGGGATTCGACTGCTGGGCAGTAACTCCCATGCACTG
C2              TGCCTTGTCATACTGGGATTCGACTGCTGGGCAGTAACTCCCATGCACTG
C3              TGCCTTGTCATACTGGGATTCGACTGCTGGGCAGTAACTCCCATGCACTG
C4              TGCCTTGTCATACTGGGATTCGACTGCTGGGCAGTAACTCCCATGCACTG
C5              TGCCTTGTCATACTGGGATTCGACTGCTGGGCAGTAACTCCCATGCACTG
C6              TGCCTTGTCATACTGGGATTCGACTGCTGGGCAGTAACTCCCATGCACTG
                **************************************************

C1              GGCCGCGTCACTGCTGCCAAACGAGTCCAGCTGGTTCGCGGTGACCGCGA
C2              GGCCGCGTCACTGCTGCCAAACGAGTCCAGCTGGTTCGCGGTGACCGCGA
C3              GGCCGCGTCACTGCTGCCAAACGAGTCCAGCTGGTTCGCGGTGACCGCGA
C4              GGCCGCGTCACTGCTGCCAAACGAGTCCAGCTGGTTCGCGGTGACCGCGA
C5              GGCCGCGTCACTGCTGCCAAACGAGTCCAGCTGGTTCGCGGTGACCGCGA
C6              GGCCGCGTCACTGCTGCCAAACGAGTCCAGCTGGTTCGCGGTGACCGCGA
                **************************************************

C1              AGTGTTCGGGCTGCGTGGTCGTTCCGCTGAACAACGCGTAGCGCTCGATC
C2              AGTGTTCGGGCTGCGTGGTCGTTCCGCTGAACAACGCGTAGCGCTCGATC
C3              AGTGTTCGGGCTGCGTGGTCGTTCCGCTGAACAACGCGTAGCGCTCGATC
C4              AGTGTTCGGGCTGCGTGGTCGTTCCGCTGAACAACGCGTAGCGCTCGATC
C5              AGTGTTCGGGCTGCGTGGTCGTTCCGCTGAACAACGCGTAGCGCTCGATC
C6              AGTGTTCGGGCTGCGTGGTCGTTCCGCTGAACAACGCGTAGCGCTCGATC
                **************************************************

C1              TCCTCCTTGATGAATCGGTGGGCATCGTGTCGCTGGGCGGCAAAGCCGGT
C2              TCCTCCTTGATGAATCGGTGGGCATCGTGTCGCTGGGCGGCAAAGCCGGT
C3              TCCTCCTTGATGAATCGGTGGGCATCGTGTCGCTGGGCGGCAAAGCCGGT
C4              TCCTCCTTGATGAATCGGTGGGCATCGTGTCGCTGGGCGGCAAAGCCGGT
C5              TCCTCCTTGATGAATCGGTGGGCATCGTGTCGCTGGGCGGCAAAGCCGGT
C6              TCCTCCTTGATGAATCGGTGGGCATCGTGTCGCTGGGCGGCAAAGCCGGT
                **************************************************

C1              ACCGGCAAGTCGGCGCTGGCACTATGCGCCGGTCTAGAGGCGGTGCTGGA
C2              ACCGGCAAGTCGGCGCTGGCACTATGCGCCGGTCTAGAGGCGGTGCTGGA
C3              ACCGGCAAGTCGGCGCTGGCACTATGCGCCGGTCTAGAGGCGGTGCTGGA
C4              ACCGGCAAGTCGGCGCTGGCACTATGCGCCGGTCTAGAGGCGGTGCTGGA
C5              ACCGGCAAGTCGGCGCTGGCACTATGCGCCGGTCTAGAGGCGGTGCTGGA
C6              ACCGGCAAGTCGGCGCTGGCACTATGCGCCGGTCTAGAGGCGGTGCTGGA
                **************************************************

C1              GCGGCGGAGTCACCGCAAGGTAGTGGTCTTCCGCCCGTTATACGCCGTCG
C2              GCGGCGGAGTCACCGCAAGGTAGTGGTCTTCCGCCCGTTATACGCCGTCG
C3              GCGGCGGAGTCACCGCAAGGTAGTGGTCTTCCGCCCGTTATACGCCGTCG
C4              GCGGCGGAGTCACCGCAAGGTAGTGGTCTTCCGCCCGTTATACGCCGTCG
C5              GCGGCGGAGTCACCGCAAGGTAGTGGTCTTCCGCCCGTTATACGCCGTCG
C6              GCGGCGGAGTCACCGCAAGGTAGTGGTCTTCCGCCCGTTATACGCCGTCG
                **************************************************

C1              GTGGCCAAGAGCTGGGTTATTTGCCCGGCAGTGAGAGCGAGAAGATGGGC
C2              GTGGCCAAGAGCTGGGTTATTTGCCCGGCAGTGAGAGCGAGAAGATGGGC
C3              GTGGCCAAGAGCTGGGTTATTTGCCCGGCAGTGAGAGCGAGAAGATGGGC
C4              GTGGCCAAGAGCTGGGTTATTTGCCCGGCAGTGAGAGCGAGAAGATGGGC
C5              GTGGCCAAGAGCTGGGTTATTTGCCCGGCAGTGAGAGCGAGAAGATGGGC
C6              GTGGCCAAGAGCTGGGTTATTTGCCCGGCAGTGAGAGCGAGAAGATGGGC
                **************************************************

C1              CCGTGGGCCCAGGCTGTCTTCGATACTCTCGAGGGTCTGGCTAGTCCCGC
C2              CCGTGGGCCCAGGCTGTCTTCGATACTCTCGAGGGTCTGGCTAGTCCCGC
C3              CCGTGGGCCCAGGCTGTCTTCGATACTCTCGAGGGTCTGGCTAGTCCCGC
C4              CCGTGGGCCCAGGCTGTCTTCGATACTCTCGAGGGTCTGGCTAGTCCCGC
C5              CCGTGGGCCCAGGCTGTCTTCGATACTCTCGAGGGTCTGGCTAGTCCCGC
C6              CCGTGGGCCCAGGCTGTCTTCGATACTCTCGAGGGTCTGGCTAGTCCCGC
                **************************************************

C1              GGTGCTTGAGGAGGTTCTCTCCCGGAGCATGCTTGAGGTGTTGCCATTGA
C2              GGTGCTTGAGGAGGTTCTCTCCCGGAGCATGCTTGAGGTGTTGCCATTGA
C3              GGTGCTTGAGGAGGTTCTCTCCCGGAGCATGCTTGAGGTGTTGCCATTGA
C4              GGTGCTTGAGGAGGTTCTCTCCCGGAGCATGCTTGAGGTGTTGCCATTGA
C5              GGTGCTTGAGGAGGTTCTCTCCCGGAGCATGCTTGAGGTGTTGCCATTGA
C6              GGTGCTTGAGGAGGTTCTCTCCCGGAGCATGCTTGAGGTGTTGCCATTGA
                **************************************************

C1              CCCACATTCGGGGACGTTCATTGCATGATTCGTTCGTCATTGTCGACGAG
C2              CCCACATTCGGGGACGTTCATTGCATGATTCGTTCGTCATTGTCGACGAG
C3              CCCACATTCGGGGACGTTCATTGCATGATTCGTTCGTCATTGTCGACGAG
C4              CCCACATTCGGGGACGTTCATTGCATGATTCGTTCGTCATTGTCGACGAG
C5              CCCACATTCGGGGACGTTCATTGCATGATTCGTTCGTCATTGTCGACGAG
C6              CCCACATTCGGGGACGTTCATTGCATGATTCGTTCGTCATTGTCGACGAG
                **************************************************

C1              GCACAGTCACTCGAGCGCAATGTCCTGCTGACGGTGTTGTCTAGGCTGGG
C2              GCACAGTCACTCGAGCGCAATGTCCTGCTGACGGTGTTGTCTAGGCTGGG
C3              GCACAGTCACTCGAGCGCAATGTCCTGCTGACGGTGTTGTCTAGGCTGGG
C4              GCACAGTCACTCGAGCGCAATGTCCTGCTGACGGTGTTGTCTAGGCTGGG
C5              GCACAGTCACTCGAGCGCAATGTCCTGCTGACGGTGTTGTCTAGGCTGGG
C6              GCACAGTCACTCGAGCGCAATGTCCTGCTGACGGTGTTGTCTAGGCTGGG
                **************************************************

C1              CACGGGATCGCGGGTGGTGCTGACCCATGATATCGCTCAGCGCGACAACT
C2              CACGGGATCGCGGGTGGTGCTGACCCATGATATCGCTCAGCGCGACAACT
C3              CACGGGATCGCGGGTGGTGCTGACCCATGATATCGCTCAGCGCGACAACT
C4              CACGGGATCGCGGGTGGTGCTGACCCATGATATCGCTCAGCGCGACAACT
C5              CACGGGATCGCGGGTGGTGCTGACCCATGATATCGCTCAGCGCGACAACT
C6              CACGGGATCGCGGGTGGTGCTGACCCATGATATCGCTCAGCGCGACAACT
                **************************************************

C1              TGCGCGTCGGCCGCCACGACGGCGTGGCGGGAGTGATCGAGAAGCTTAAA
C2              TGCGCGTCGGCCGCCACGACGGCGTGGCGGGAGTGATCGAGAAGCTTAAA
C3              TGCGCGTCGGCCGCCACGACGGCGTGGCGGGAGTGATCGAGAAGCTTAAA
C4              TGCGCGTCGGCCGCCACGACGGCGTGGCGGGAGTGATCGAGAAGCTTAAA
C5              TGCGCGTCGGCCGCCACGACGGCGTGGCGGGAGTGATCGAGAAGCTTAAA
C6              TGCGCGTCGGCCGCCACGACGGCGTGGCGGGAGTGATCGAGAAGCTTAAA
                **************************************************

C1              GGCCATCCTCTGTTTGCTCACGTCACCTTGCAGCGTAGCGAGCGGTCACC
C2              GGCCATCCTCTGTTTGCTCACGTCACCTTGCAGCGTAGCGAGCGGTCACC
C3              GGCCATCCTCTGTTTGCTCACGTCACCTTGCAGCGTAGCGAGCGGTCACC
C4              GGCCATCCTCTGTTTGCTCACGTCACCTTGCAGCGTAGCGAGCGGTCACC
C5              GGCCATCCTCTGTTTGCTCACGTCACCTTGCAGCGTAGCGAGCGGTCACC
C6              GGCCATCCTCTGTTTGCTCACGTCACCTTGCAGCGTAGCGAGCGGTCACC
                **************************************************

C1              CGTTGCGGCGTTGGTCACCGAGATGTTCGAGGAGATCGCCGGTCCGCAC
C2              CGTTGCGGCGTTGGTCACCGAGATGTTCGAGGAGATCGCCGGTCCGCAC
C3              CGTTGCGGCGTTGGTCACCGAGATGTTCGAGGAGATCGCCGGTCCGCAC
C4              CGTTGCGGCGTTGGTCACCGAGATGTTCGAGGAGATCGCCGGTCCGCAC
C5              CGTTGCGGCGTTGGTCACCGAGATGTTCGAGGAGATCGCCGGTCCGCAC
C6              CGTTGCGGCGTTGGTCACCGAGATGTTCGAGGAGATCGCCGGTCCGCAC
                *************************************************



>C1
GTGACCGATATCCGGACGTACGTGATCGACACCTCTGTGTTGTTGTCTGA
TCCCTGGGCGTGCAGTCGGTTCGCCGAACACGAAGTGGTGGTGCCGCTGG
TGGTAATCAGTGAACTGGAGGCCAAACGCCACCACCATGAACTGGGGTGG
TTTGCTCGTCAGGCGTTGCGTCTGTTCGATGATCTTCGACTCGATCACGG
ACGGCTGGATCAGCCCATACCGGTAGGAATGCAAGGCGGGACGCTGCATG
TTGAACTCAACCACTCGGACCCCACGGTGCTGCCTGCCGGCTTTCGCACC
GACAGTAACGATTCCCGGATCTTGAGCTGTGCTGCCAACCTGGCCGCCGA
AGGTAGGCGCGTCACGCTGGTCAGCAAGGACCTTCCACTTCGGGTCAAGG
CCGCTGCGGTCGGACTTGCCGCCGACGAGTACCACGCGCAGGATGTTGTC
GCTTCCGGCTGGTCCGGGATGCACGAGATTGAGACTTGCGCTGAAGACAT
CGACGCACTGTTCGCCGAAGGCAAGATCGACCTGGGCGAAGCCAGAGACC
TGCCTTGTCATACTGGGATTCGACTGCTGGGCAGTAACTCCCATGCACTG
GGCCGCGTCACTGCTGCCAAACGAGTCCAGCTGGTTCGCGGTGACCGCGA
AGTGTTCGGGCTGCGTGGTCGTTCCGCTGAACAACGCGTAGCGCTCGATC
TCCTCCTTGATGAATCGGTGGGCATCGTGTCGCTGGGCGGCAAAGCCGGT
ACCGGCAAGTCGGCGCTGGCACTATGCGCCGGTCTAGAGGCGGTGCTGGA
GCGGCGGAGTCACCGCAAGGTAGTGGTCTTCCGCCCGTTATACGCCGTCG
GTGGCCAAGAGCTGGGTTATTTGCCCGGCAGTGAGAGCGAGAAGATGGGC
CCGTGGGCCCAGGCTGTCTTCGATACTCTCGAGGGTCTGGCTAGTCCCGC
GGTGCTTGAGGAGGTTCTCTCCCGGAGCATGCTTGAGGTGTTGCCATTGA
CCCACATTCGGGGACGTTCATTGCATGATTCGTTCGTCATTGTCGACGAG
GCACAGTCACTCGAGCGCAATGTCCTGCTGACGGTGTTGTCTAGGCTGGG
CACGGGATCGCGGGTGGTGCTGACCCATGATATCGCTCAGCGCGACAACT
TGCGCGTCGGCCGCCACGACGGCGTGGCGGGAGTGATCGAGAAGCTTAAA
GGCCATCCTCTGTTTGCTCACGTCACCTTGCAGCGTAGCGAGCGGTCACC
CGTTGCGGCGTTGGTCACCGAGATGTTCGAGGAGATCGCCGGTCCGCAC
>C2
GTGACCGATATCCGGACGTACGTGATCGACACCTCTGTGTTGTTGTCTGA
TCCCTGGGCGTGCAGTCGGTTCGCCGAACACGAAGTGGTGGTGCCGCTGG
TGGTAATCAGTGAACTGGAGGCCAAACGCCACCACCATGAACTGGGGTGG
TTTGCTCGTCAGGCGTTGCGTCTGTTCGATGATCTTCGACTCGATCACGG
ACGGCTGGATCAGCCCATACCGGTAGGAATGCAAGGCGGGACGCTGCATG
TTGAACTCAACCACTCGGACCCCACGGTGCTGCCTGCCGGCTTTCGCACC
GACAGTAACGATTCCCGGATCTTGAGCTGTGCTGCCAACCTGGCCGCCGA
AGGTAGGCGCGTCACGCTGGTCAGCAAGGACCTTCCACTTCGGGTCAAGG
CCGCTGCGGTCGGACTTGCCGCCGACGAGTACCACGCGCAGGATGTTGTC
GCTTCCGGCTGGTCCGGGATGCACGAGATTGAGACTTGCGCTGAAGACAT
CGACGCACTGTTCGCCGAAGGCAAGATCGACCTGGGCGAAGCCAGAGACC
TGCCTTGTCATACTGGGATTCGACTGCTGGGCAGTAACTCCCATGCACTG
GGCCGCGTCACTGCTGCCAAACGAGTCCAGCTGGTTCGCGGTGACCGCGA
AGTGTTCGGGCTGCGTGGTCGTTCCGCTGAACAACGCGTAGCGCTCGATC
TCCTCCTTGATGAATCGGTGGGCATCGTGTCGCTGGGCGGCAAAGCCGGT
ACCGGCAAGTCGGCGCTGGCACTATGCGCCGGTCTAGAGGCGGTGCTGGA
GCGGCGGAGTCACCGCAAGGTAGTGGTCTTCCGCCCGTTATACGCCGTCG
GTGGCCAAGAGCTGGGTTATTTGCCCGGCAGTGAGAGCGAGAAGATGGGC
CCGTGGGCCCAGGCTGTCTTCGATACTCTCGAGGGTCTGGCTAGTCCCGC
GGTGCTTGAGGAGGTTCTCTCCCGGAGCATGCTTGAGGTGTTGCCATTGA
CCCACATTCGGGGACGTTCATTGCATGATTCGTTCGTCATTGTCGACGAG
GCACAGTCACTCGAGCGCAATGTCCTGCTGACGGTGTTGTCTAGGCTGGG
CACGGGATCGCGGGTGGTGCTGACCCATGATATCGCTCAGCGCGACAACT
TGCGCGTCGGCCGCCACGACGGCGTGGCGGGAGTGATCGAGAAGCTTAAA
GGCCATCCTCTGTTTGCTCACGTCACCTTGCAGCGTAGCGAGCGGTCACC
CGTTGCGGCGTTGGTCACCGAGATGTTCGAGGAGATCGCCGGTCCGCAC
>C3
GTGACCGATATCCGGACGTACGTGATCGACACCTCTGTGTTGTTGTCTGA
TCCCTGGGCGTGCAGTCGGTTCGCCGAACACGAAGTGGTGGTGCCGCTGG
TGGTAATCAGTGAACTGGAGGCCAAACGCCACCACCATGAACTGGGGTGG
TTTGCTCGTCAGGCGTTGCGTCTGTTCGATGATCTTCGACTCGATCACGG
ACGGCTGGATCAGCCCATACCGGTAGGAATGCAAGGCGGGACGCTGCATG
TTGAACTCAACCACTCGGACCCCACGGTGCTGCCTGCCGGCTTTCGCACC
GACAGTAACGATTCCCGGATCTTGAGCTGTGCTGCCAACCTGGCCGCCGA
AGGTAGGCGCGTCACGCTGGTCAGCAAGGACCTTCCACTTCGGGTCAAGG
CCGCTGCGGTCGGACTTGCCGCCGACGAGTACCACGCGCAGGATGTTGTC
GCTTCCGGCTGGTCCGGGATGCACGAGATTGAGACTTGCGCTGAAGACAT
CGACGCACTGTTCGCCGAAGGCAAGATCGACCTGGGCGAAGCCAGAGACC
TGCCTTGTCATACTGGGATTCGACTGCTGGGCAGTAACTCCCATGCACTG
GGCCGCGTCACTGCTGCCAAACGAGTCCAGCTGGTTCGCGGTGACCGCGA
AGTGTTCGGGCTGCGTGGTCGTTCCGCTGAACAACGCGTAGCGCTCGATC
TCCTCCTTGATGAATCGGTGGGCATCGTGTCGCTGGGCGGCAAAGCCGGT
ACCGGCAAGTCGGCGCTGGCACTATGCGCCGGTCTAGAGGCGGTGCTGGA
GCGGCGGAGTCACCGCAAGGTAGTGGTCTTCCGCCCGTTATACGCCGTCG
GTGGCCAAGAGCTGGGTTATTTGCCCGGCAGTGAGAGCGAGAAGATGGGC
CCGTGGGCCCAGGCTGTCTTCGATACTCTCGAGGGTCTGGCTAGTCCCGC
GGTGCTTGAGGAGGTTCTCTCCCGGAGCATGCTTGAGGTGTTGCCATTGA
CCCACATTCGGGGACGTTCATTGCATGATTCGTTCGTCATTGTCGACGAG
GCACAGTCACTCGAGCGCAATGTCCTGCTGACGGTGTTGTCTAGGCTGGG
CACGGGATCGCGGGTGGTGCTGACCCATGATATCGCTCAGCGCGACAACT
TGCGCGTCGGCCGCCACGACGGCGTGGCGGGAGTGATCGAGAAGCTTAAA
GGCCATCCTCTGTTTGCTCACGTCACCTTGCAGCGTAGCGAGCGGTCACC
CGTTGCGGCGTTGGTCACCGAGATGTTCGAGGAGATCGCCGGTCCGCAC
>C4
GTGACCGATATCCGGACGTACGTGATCGACACCTCTGTGTTGTTGTCTGA
TCCCTGGGCGTGCAGTCGGTTCGCCGAACACGAAGTGGTGGTGCCGCTGG
TGGTAATCAGTGAACTGGAGGCCAAACGCCACCACCATGAACTGGGGTGG
TTTGCTCGTCAGGCGTTGCGTCTGTTCGATGATCTTCGACTCGATCACGG
ACGGCTGGATCAGCCCATACCGGTAGGAATGCAAGGCGGGACGCTGCATG
TTGAACTCAACCACTCGGACCCCACGGTGCTGCCTGCCGGCTTTCGCACC
GACAGTAACGATTCCCGGATCTTGAGCTGTGCTGCCAACCTGGCCGCCGA
AGGTAGGCGCGTCACGCTGGTCAGCAAGGACCTTCCACTTCGGGTCAAGG
CCGCTGCGGTCGGACTTGCCGCCGACGAGTACCACGCGCAGGATGTTGTC
GCTTCCGGCTGGTCCGGGATGCACGAGATTGAGACTTGCGCTGAAGACAT
CGACGCACTGTTCGCCGAAGGCAAGATCGACCTGGGCGAAGCCAGAGACC
TGCCTTGTCATACTGGGATTCGACTGCTGGGCAGTAACTCCCATGCACTG
GGCCGCGTCACTGCTGCCAAACGAGTCCAGCTGGTTCGCGGTGACCGCGA
AGTGTTCGGGCTGCGTGGTCGTTCCGCTGAACAACGCGTAGCGCTCGATC
TCCTCCTTGATGAATCGGTGGGCATCGTGTCGCTGGGCGGCAAAGCCGGT
ACCGGCAAGTCGGCGCTGGCACTATGCGCCGGTCTAGAGGCGGTGCTGGA
GCGGCGGAGTCACCGCAAGGTAGTGGTCTTCCGCCCGTTATACGCCGTCG
GTGGCCAAGAGCTGGGTTATTTGCCCGGCAGTGAGAGCGAGAAGATGGGC
CCGTGGGCCCAGGCTGTCTTCGATACTCTCGAGGGTCTGGCTAGTCCCGC
GGTGCTTGAGGAGGTTCTCTCCCGGAGCATGCTTGAGGTGTTGCCATTGA
CCCACATTCGGGGACGTTCATTGCATGATTCGTTCGTCATTGTCGACGAG
GCACAGTCACTCGAGCGCAATGTCCTGCTGACGGTGTTGTCTAGGCTGGG
CACGGGATCGCGGGTGGTGCTGACCCATGATATCGCTCAGCGCGACAACT
TGCGCGTCGGCCGCCACGACGGCGTGGCGGGAGTGATCGAGAAGCTTAAA
GGCCATCCTCTGTTTGCTCACGTCACCTTGCAGCGTAGCGAGCGGTCACC
CGTTGCGGCGTTGGTCACCGAGATGTTCGAGGAGATCGCCGGTCCGCAC
>C5
GTGACCGATATCCGGACGTACGTGATCGACACCTCTGTGTTGTTGTCTGA
TCCCTGGGCGTGCAGTCGGTTCGCCGAACACGAAGTGGTGGTGCCGCTGG
TGGTAATCAGTGAACTGGAGGCCAAACGCCACCACCATGAACTGGGGTGG
TTTGCTCGTCAGGCGTTGCGTCTGTTCGATGATCTTCGACTCGATCACGG
ACGGCTGGATCAGCCCATACCGGTAGGAATGCAAGGCGGGACGCTGCATG
TTGAACTCAACCACTCGGACCCCACGGTGCTGCCTGCCGGCTTTCGCACC
GACAGTAACGATTCCCGGATCTTGAGCTGTGCTGCCAACCTGGCCGCCGA
AGGTAGGCGCGTCACGCTGGTCAGCAAGGACCTTCCACTTCGGGTCAAGG
CCGCTGCGGTCGGACTTGCCGCCGACGAGTACCACGCGCAGGATGTTGTC
GCTTCCGGCTGGTCCGGGATGCACGAGATTGAGACTTGCGCTGAAGACAT
CGACGCACTGTTCGCCGAAGGCAAGATCGACCTGGGCGAAGCCAGAGACC
TGCCTTGTCATACTGGGATTCGACTGCTGGGCAGTAACTCCCATGCACTG
GGCCGCGTCACTGCTGCCAAACGAGTCCAGCTGGTTCGCGGTGACCGCGA
AGTGTTCGGGCTGCGTGGTCGTTCCGCTGAACAACGCGTAGCGCTCGATC
TCCTCCTTGATGAATCGGTGGGCATCGTGTCGCTGGGCGGCAAAGCCGGT
ACCGGCAAGTCGGCGCTGGCACTATGCGCCGGTCTAGAGGCGGTGCTGGA
GCGGCGGAGTCACCGCAAGGTAGTGGTCTTCCGCCCGTTATACGCCGTCG
GTGGCCAAGAGCTGGGTTATTTGCCCGGCAGTGAGAGCGAGAAGATGGGC
CCGTGGGCCCAGGCTGTCTTCGATACTCTCGAGGGTCTGGCTAGTCCCGC
GGTGCTTGAGGAGGTTCTCTCCCGGAGCATGCTTGAGGTGTTGCCATTGA
CCCACATTCGGGGACGTTCATTGCATGATTCGTTCGTCATTGTCGACGAG
GCACAGTCACTCGAGCGCAATGTCCTGCTGACGGTGTTGTCTAGGCTGGG
CACGGGATCGCGGGTGGTGCTGACCCATGATATCGCTCAGCGCGACAACT
TGCGCGTCGGCCGCCACGACGGCGTGGCGGGAGTGATCGAGAAGCTTAAA
GGCCATCCTCTGTTTGCTCACGTCACCTTGCAGCGTAGCGAGCGGTCACC
CGTTGCGGCGTTGGTCACCGAGATGTTCGAGGAGATCGCCGGTCCGCAC
>C6
GTGACCGATATCCGGACGTACGTGATCGACACCTCTGTGTTGTTGTCTGA
TCCCTGGGCGTGCAGTCGGTTCGCCGAACACGAAGTGGTGGTGCCGCTGG
TGGTAATCAGTGAACTGGAGGCCAAACGCCACCACCATGAACTGGGGTGG
TTTGCTCGTCAGGCGTTGCGTCTGTTCGATGATCTTCGACTCGATCACGG
ACGGCTGGATCAGCCCATACCGGTAGGAATGCAAGGCGGGACGCTGCATG
TTGAACTCAACCACTCGGACCCCACGGTGCTGCCTGCCGGCTTTCGCACC
GACAGTAACGATTCCCGGATCTTGAGCTGTGCTGCCAACCTGGCCGCCGA
AGGTAGGCGCGTCACGCTGGTCAGCAAGGACCTTCCACTTCGGGTCAAGG
CCGCTGCGGTCGGACTTGCCGCCGACGAGTACCACGCGCAGGATGTTGTC
GCTTCCGGCTGGTCCGGGATGCACGAGATTGAGACTTGCGCTGAAGACAT
CGACGCACTGTTCGCCGAAGGCAAGATCGACCTGGGCGAAGCCAGAGACC
TGCCTTGTCATACTGGGATTCGACTGCTGGGCAGTAACTCCCATGCACTG
GGCCGCGTCACTGCTGCCAAACGAGTCCAGCTGGTTCGCGGTGACCGCGA
AGTGTTCGGGCTGCGTGGTCGTTCCGCTGAACAACGCGTAGCGCTCGATC
TCCTCCTTGATGAATCGGTGGGCATCGTGTCGCTGGGCGGCAAAGCCGGT
ACCGGCAAGTCGGCGCTGGCACTATGCGCCGGTCTAGAGGCGGTGCTGGA
GCGGCGGAGTCACCGCAAGGTAGTGGTCTTCCGCCCGTTATACGCCGTCG
GTGGCCAAGAGCTGGGTTATTTGCCCGGCAGTGAGAGCGAGAAGATGGGC
CCGTGGGCCCAGGCTGTCTTCGATACTCTCGAGGGTCTGGCTAGTCCCGC
GGTGCTTGAGGAGGTTCTCTCCCGGAGCATGCTTGAGGTGTTGCCATTGA
CCCACATTCGGGGACGTTCATTGCATGATTCGTTCGTCATTGTCGACGAG
GCACAGTCACTCGAGCGCAATGTCCTGCTGACGGTGTTGTCTAGGCTGGG
CACGGGATCGCGGGTGGTGCTGACCCATGATATCGCTCAGCGCGACAACT
TGCGCGTCGGCCGCCACGACGGCGTGGCGGGAGTGATCGAGAAGCTTAAA
GGCCATCCTCTGTTTGCTCACGTCACCTTGCAGCGTAGCGAGCGGTCACC
CGTTGCGGCGTTGGTCACCGAGATGTTCGAGGAGATCGCCGGTCCGCAC
>C1
VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
>C2
VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
>C3
VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
>C4
VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
>C5
VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH
>C6
VTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
FARQALRLFDDLRLDHGRLDQPIPVGMQGGTLHVELNHSDPTVLPAGFRT
DSNDSRILSCAANLAAEGRRVTLVSKDLPLRVKAAAVGLAADEYHAQDVV
ASGWSGMHEIETCAEDIDALFAEGKIDLGEARDLPCHTGIRLLGSNSHAL
GRVTAAKRVQLVRGDREVFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
TGKSALALCAGLEAVLERRSHRKVVVFRPLYAVGGQELGYLPGSESEKMG
PWAQAVFDTLEGLASPAVLEEVLSRSMLEVLPLTHIRGRSLHDSFVIVDE
AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAGVIEKLK
GHPLFAHVTLQRSERSPVAALVTEMFEEIAGPH


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/phoH2/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1299 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579785451
      Setting output file names to "/data/10res/phoH2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 967337868
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9975492981
      Seed = 1022690346
      Swapseed = 1579785451
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2907.224269 -- -24.965149
         Chain 2 -- -2907.224269 -- -24.965149
         Chain 3 -- -2907.224101 -- -24.965149
         Chain 4 -- -2907.224101 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2907.223827 -- -24.965149
         Chain 2 -- -2907.223827 -- -24.965149
         Chain 3 -- -2907.224269 -- -24.965149
         Chain 4 -- -2907.224269 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2907.224] (-2907.224) (-2907.224) (-2907.224) * [-2907.224] (-2907.224) (-2907.224) (-2907.224) 
        500 -- (-1782.180) (-1798.307) (-1777.281) [-1779.258] * [-1792.015] (-1792.996) (-1795.652) (-1784.971) -- 0:00:00
       1000 -- (-1778.895) (-1775.864) (-1782.091) [-1771.336] * (-1778.348) (-1787.440) [-1771.520] (-1778.858) -- 0:00:00
       1500 -- (-1776.742) [-1769.017] (-1773.393) (-1769.326) * (-1774.771) (-1768.745) [-1771.612] (-1773.199) -- 0:00:00
       2000 -- (-1768.291) [-1773.508] (-1771.016) (-1771.364) * [-1775.378] (-1775.259) (-1769.929) (-1770.981) -- 0:00:00
       2500 -- (-1770.422) [-1776.868] (-1772.495) (-1770.293) * (-1778.502) [-1773.673] (-1773.722) (-1772.250) -- 0:06:39
       3000 -- (-1768.492) [-1775.398] (-1773.809) (-1765.758) * (-1778.708) (-1774.785) (-1771.197) [-1776.069] -- 0:05:32
       3500 -- (-1769.871) (-1773.142) (-1773.512) [-1768.489] * (-1771.573) [-1777.153] (-1775.864) (-1774.382) -- 0:04:44
       4000 -- [-1774.963] (-1775.868) (-1783.937) (-1769.063) * (-1770.859) [-1769.495] (-1780.334) (-1767.099) -- 0:04:09
       4500 -- (-1768.777) (-1780.878) [-1769.493] (-1772.291) * (-1780.911) [-1774.672] (-1769.569) (-1774.953) -- 0:03:41
       5000 -- (-1772.015) [-1775.906] (-1769.700) (-1771.110) * (-1775.494) (-1771.985) (-1775.361) [-1768.738] -- 0:03:19

      Average standard deviation of split frequencies: 0.095647

       5500 -- [-1774.458] (-1770.056) (-1772.520) (-1768.005) * (-1777.993) (-1772.789) [-1768.746] (-1772.020) -- 0:03:00
       6000 -- (-1770.436) (-1770.718) (-1774.143) [-1770.976] * (-1774.427) [-1779.325] (-1773.365) (-1775.720) -- 0:02:45
       6500 -- (-1775.245) [-1769.414] (-1775.085) (-1775.755) * (-1773.393) (-1782.501) (-1783.810) [-1771.934] -- 0:02:32
       7000 -- (-1772.052) [-1766.669] (-1770.028) (-1780.467) * (-1772.225) (-1778.455) (-1775.851) [-1769.300] -- 0:02:21
       7500 -- (-1771.184) (-1767.408) [-1771.470] (-1768.737) * (-1769.694) [-1767.165] (-1772.034) (-1774.205) -- 0:02:12
       8000 -- (-1776.838) [-1770.920] (-1773.796) (-1772.857) * (-1770.323) (-1774.024) (-1766.267) [-1771.391] -- 0:02:04
       8500 -- (-1772.251) [-1770.621] (-1780.366) (-1772.677) * [-1774.542] (-1773.448) (-1765.356) (-1772.441) -- 0:01:56
       9000 -- (-1774.107) (-1769.040) (-1781.623) [-1766.795] * [-1777.054] (-1774.185) (-1766.522) (-1773.324) -- 0:01:50
       9500 -- (-1765.083) (-1784.134) (-1775.228) [-1773.134] * (-1775.063) (-1771.408) [-1767.712] (-1769.322) -- 0:01:44
      10000 -- (-1763.754) [-1767.465] (-1771.308) (-1771.851) * (-1768.812) (-1773.150) (-1766.297) [-1769.074] -- 0:01:39

      Average standard deviation of split frequencies: 0.093299

      10500 -- (-1764.393) (-1777.294) (-1778.308) [-1778.128] * (-1770.772) [-1771.798] (-1765.841) (-1776.736) -- 0:01:34
      11000 -- (-1764.528) (-1778.102) [-1769.622] (-1778.015) * (-1776.186) [-1778.487] (-1766.967) (-1779.022) -- 0:01:29
      11500 -- (-1765.590) [-1773.496] (-1772.180) (-1773.274) * (-1774.945) [-1763.450] (-1766.648) (-1780.474) -- 0:01:25
      12000 -- [-1767.582] (-1772.674) (-1775.047) (-1768.915) * (-1770.980) (-1764.225) (-1765.159) [-1775.102] -- 0:01:22
      12500 -- (-1766.151) (-1777.615) [-1771.268] (-1779.536) * [-1770.409] (-1764.754) (-1765.297) (-1778.410) -- 0:01:19
      13000 -- [-1762.938] (-1772.055) (-1777.751) (-1772.952) * (-1775.457) (-1766.782) [-1764.893] (-1774.352) -- 0:01:15
      13500 -- (-1763.295) (-1779.023) [-1770.279] (-1780.103) * (-1774.965) [-1766.473] (-1767.927) (-1770.356) -- 0:01:13
      14000 -- (-1763.971) [-1772.673] (-1775.346) (-1773.463) * (-1776.361) (-1769.008) (-1769.618) [-1774.063] -- 0:01:10
      14500 -- (-1764.450) (-1769.789) (-1779.446) [-1768.782] * [-1771.303] (-1765.705) (-1766.131) (-1776.309) -- 0:01:07
      15000 -- (-1762.653) (-1768.610) [-1773.860] (-1773.445) * (-1776.198) [-1765.603] (-1764.374) (-1775.527) -- 0:01:05

      Average standard deviation of split frequencies: 0.062199

      15500 -- (-1768.097) (-1773.796) (-1769.716) [-1770.493] * (-1769.577) (-1764.646) (-1765.380) [-1784.269] -- 0:01:03
      16000 -- (-1765.845) (-1778.992) [-1773.980] (-1776.270) * (-1772.503) (-1764.267) [-1765.892] (-1776.570) -- 0:01:01
      16500 -- (-1771.952) (-1775.186) (-1771.482) [-1776.849] * [-1767.442] (-1764.112) (-1765.218) (-1782.811) -- 0:01:59
      17000 -- (-1764.446) [-1773.196] (-1770.300) (-1778.427) * [-1769.477] (-1765.292) (-1764.790) (-1776.747) -- 0:01:55
      17500 -- [-1763.451] (-1770.199) (-1785.599) (-1770.413) * (-1768.009) (-1767.385) [-1764.643] (-1770.842) -- 0:01:52
      18000 -- [-1765.121] (-1772.534) (-1778.818) (-1777.100) * [-1768.123] (-1767.206) (-1764.013) (-1773.750) -- 0:01:49
      18500 -- [-1765.177] (-1772.944) (-1776.705) (-1780.934) * (-1787.681) (-1766.855) [-1768.411] (-1767.165) -- 0:01:46
      19000 -- (-1763.966) (-1769.293) (-1778.497) [-1771.130] * (-1779.779) (-1764.548) [-1765.276] (-1770.912) -- 0:01:43
      19500 -- (-1762.659) (-1780.762) [-1772.680] (-1775.465) * [-1776.384] (-1763.700) (-1765.157) (-1782.849) -- 0:01:40
      20000 -- (-1762.812) (-1775.680) (-1774.353) [-1772.943] * (-1775.592) (-1762.740) [-1763.350] (-1776.422) -- 0:01:38

      Average standard deviation of split frequencies: 0.052823

      20500 -- [-1763.320] (-1772.086) (-1779.211) (-1776.556) * (-1766.995) [-1762.574] (-1762.689) (-1773.194) -- 0:01:35
      21000 -- (-1762.458) [-1772.511] (-1778.636) (-1777.491) * (-1780.150) [-1763.490] (-1763.791) (-1770.713) -- 0:01:33
      21500 -- [-1762.236] (-1770.188) (-1774.082) (-1771.511) * [-1771.652] (-1762.590) (-1762.964) (-1775.569) -- 0:01:31
      22000 -- (-1762.133) [-1776.665] (-1775.423) (-1770.152) * [-1775.414] (-1763.436) (-1763.258) (-1771.968) -- 0:01:28
      22500 -- (-1763.546) (-1776.519) (-1777.546) [-1772.328] * [-1776.335] (-1764.435) (-1764.515) (-1775.823) -- 0:01:26
      23000 -- [-1764.203] (-1774.882) (-1777.185) (-1773.222) * (-1771.560) (-1762.861) (-1765.965) [-1771.125] -- 0:01:24
      23500 -- (-1762.194) (-1776.145) [-1774.311] (-1770.290) * (-1774.142) (-1763.324) [-1763.174] (-1769.472) -- 0:01:23
      24000 -- (-1767.099) [-1773.672] (-1772.261) (-1769.856) * [-1776.078] (-1767.261) (-1763.195) (-1771.306) -- 0:01:21
      24500 -- (-1762.876) [-1768.395] (-1771.229) (-1773.329) * [-1775.379] (-1768.254) (-1771.349) (-1779.212) -- 0:01:19
      25000 -- (-1763.641) (-1770.922) (-1772.727) [-1770.249] * (-1775.157) (-1765.405) [-1763.957] (-1767.641) -- 0:01:18

      Average standard deviation of split frequencies: 0.039415

      25500 -- (-1765.144) (-1769.224) (-1776.181) [-1770.794] * (-1769.133) (-1764.707) [-1762.780] (-1766.725) -- 0:01:16
      26000 -- (-1763.898) (-1764.874) [-1769.880] (-1784.022) * [-1769.217] (-1764.782) (-1763.211) (-1766.154) -- 0:01:14
      26500 -- (-1765.065) (-1765.378) [-1773.321] (-1771.424) * (-1773.155) (-1765.575) (-1762.540) [-1764.778] -- 0:01:13
      27000 -- [-1762.642] (-1766.236) (-1783.795) (-1771.128) * (-1776.623) (-1765.262) (-1762.946) [-1764.150] -- 0:01:12
      27500 -- (-1762.452) (-1766.528) [-1770.533] (-1775.412) * (-1772.008) (-1763.691) (-1764.011) [-1768.064] -- 0:01:10
      28000 -- (-1765.316) (-1763.043) (-1771.144) [-1773.162] * [-1770.477] (-1763.287) (-1764.192) (-1765.617) -- 0:01:09
      28500 -- [-1764.294] (-1763.353) (-1778.942) (-1766.255) * (-1762.060) (-1764.078) [-1768.816] (-1763.152) -- 0:01:08
      29000 -- [-1763.277] (-1763.359) (-1774.936) (-1775.411) * (-1762.084) (-1764.181) (-1763.580) [-1763.883] -- 0:01:06
      29500 -- (-1762.367) (-1763.729) (-1768.454) [-1776.178] * [-1763.925] (-1764.593) (-1764.156) (-1763.804) -- 0:01:05
      30000 -- (-1762.538) (-1763.826) [-1771.764] (-1779.711) * [-1764.746] (-1763.575) (-1769.766) (-1766.356) -- 0:01:04

      Average standard deviation of split frequencies: 0.030012

      30500 -- [-1767.280] (-1763.635) (-1778.987) (-1777.412) * (-1763.654) (-1765.493) (-1772.335) [-1766.119] -- 0:01:03
      31000 -- (-1764.506) [-1762.818] (-1775.428) (-1774.870) * (-1768.147) (-1763.732) (-1765.755) [-1765.047] -- 0:01:02
      31500 -- (-1764.720) (-1765.672) [-1774.613] (-1777.989) * (-1762.817) (-1767.436) (-1766.558) [-1764.515] -- 0:01:32
      32000 -- [-1765.814] (-1763.881) (-1770.844) (-1769.203) * [-1762.480] (-1763.135) (-1764.362) (-1763.211) -- 0:01:30
      32500 -- (-1765.137) (-1763.527) [-1772.818] (-1770.085) * (-1763.968) [-1763.121] (-1765.343) (-1762.934) -- 0:01:29
      33000 -- (-1765.492) (-1763.931) (-1773.269) [-1772.543] * [-1762.735] (-1763.431) (-1763.925) (-1762.608) -- 0:01:27
      33500 -- (-1763.344) (-1767.337) [-1775.591] (-1777.527) * (-1767.044) [-1762.790] (-1763.992) (-1762.786) -- 0:01:26
      34000 -- [-1762.762] (-1765.329) (-1776.199) (-1772.008) * (-1763.393) (-1765.431) (-1767.975) [-1762.926] -- 0:01:25
      34500 -- [-1763.135] (-1764.787) (-1774.444) (-1779.767) * [-1762.936] (-1764.045) (-1768.340) (-1762.782) -- 0:01:23
      35000 -- (-1762.135) [-1763.418] (-1778.296) (-1771.897) * [-1763.005] (-1769.878) (-1766.048) (-1763.321) -- 0:01:22

      Average standard deviation of split frequencies: 0.027499

      35500 -- (-1765.592) (-1765.282) (-1789.055) [-1771.060] * [-1763.909] (-1764.992) (-1762.229) (-1762.932) -- 0:01:21
      36000 -- (-1764.134) (-1765.566) [-1762.705] (-1774.217) * (-1764.271) (-1766.418) (-1764.937) [-1766.312] -- 0:01:20
      36500 -- (-1763.847) (-1762.674) [-1763.184] (-1769.926) * (-1768.203) (-1764.350) (-1770.037) [-1762.010] -- 0:01:19
      37000 -- (-1762.615) (-1763.363) (-1762.248) [-1772.450] * (-1764.217) (-1763.770) [-1763.218] (-1762.031) -- 0:01:18
      37500 -- [-1763.263] (-1763.134) (-1766.022) (-1773.228) * (-1765.398) [-1763.089] (-1762.853) (-1763.112) -- 0:01:17
      38000 -- (-1764.578) [-1763.990] (-1766.846) (-1772.823) * (-1765.199) (-1762.752) [-1763.859] (-1764.908) -- 0:01:15
      38500 -- [-1763.530] (-1762.715) (-1763.557) (-1768.254) * (-1765.636) (-1765.651) (-1764.259) [-1765.555] -- 0:01:14
      39000 -- (-1763.990) (-1765.334) (-1764.404) [-1773.454] * (-1767.870) [-1765.042] (-1767.293) (-1768.653) -- 0:01:13
      39500 -- (-1767.066) (-1770.759) [-1763.715] (-1771.284) * (-1771.147) (-1765.357) (-1763.903) [-1765.670] -- 0:01:12
      40000 -- (-1763.388) (-1764.397) (-1764.190) [-1772.793] * (-1764.137) [-1765.014] (-1764.294) (-1765.320) -- 0:01:12

      Average standard deviation of split frequencies: 0.019774

      40500 -- [-1764.956] (-1764.323) (-1763.466) (-1770.231) * (-1765.045) (-1765.968) [-1764.429] (-1763.016) -- 0:01:11
      41000 -- [-1763.546] (-1763.367) (-1764.431) (-1782.299) * [-1763.139] (-1763.491) (-1762.149) (-1764.229) -- 0:01:10
      41500 -- (-1766.375) [-1766.750] (-1763.732) (-1773.718) * [-1763.139] (-1764.960) (-1762.619) (-1764.381) -- 0:01:09
      42000 -- [-1774.085] (-1764.524) (-1764.447) (-1776.148) * (-1762.458) (-1765.495) (-1762.611) [-1764.510] -- 0:01:08
      42500 -- (-1765.634) (-1762.277) [-1762.822] (-1781.700) * (-1762.988) [-1763.187] (-1764.545) (-1765.561) -- 0:01:07
      43000 -- [-1765.265] (-1763.594) (-1763.202) (-1781.268) * (-1763.557) (-1762.456) [-1768.645] (-1764.024) -- 0:01:06
      43500 -- (-1765.635) (-1770.894) [-1763.690] (-1774.296) * (-1763.345) [-1763.638] (-1765.596) (-1763.939) -- 0:01:05
      44000 -- (-1769.614) (-1766.006) (-1763.829) [-1771.903] * (-1764.805) [-1763.136] (-1765.751) (-1763.507) -- 0:01:05
      44500 -- (-1768.010) [-1763.403] (-1764.110) (-1776.749) * (-1766.009) [-1765.637] (-1766.796) (-1763.382) -- 0:01:04
      45000 -- (-1765.935) [-1762.356] (-1765.230) (-1779.841) * (-1765.969) (-1765.637) (-1766.948) [-1765.477] -- 0:01:03

      Average standard deviation of split frequencies: 0.018544

      45500 -- [-1762.819] (-1763.362) (-1766.483) (-1771.777) * (-1767.765) (-1765.383) (-1766.176) [-1763.938] -- 0:01:02
      46000 -- [-1762.390] (-1762.027) (-1765.290) (-1771.753) * (-1765.689) (-1765.404) (-1765.999) [-1762.245] -- 0:01:02
      46500 -- (-1766.242) (-1762.903) (-1763.193) [-1769.528] * [-1763.784] (-1767.607) (-1768.198) (-1764.773) -- 0:01:22
      47000 -- (-1763.450) [-1763.075] (-1763.209) (-1780.763) * (-1764.494) (-1768.782) [-1765.869] (-1764.158) -- 0:01:21
      47500 -- (-1762.804) (-1762.980) (-1765.632) [-1770.234] * (-1773.849) (-1762.931) (-1764.876) [-1763.216] -- 0:01:20
      48000 -- (-1764.200) (-1764.610) [-1765.614] (-1777.156) * (-1767.356) (-1764.317) (-1764.661) [-1764.763] -- 0:01:19
      48500 -- (-1763.308) (-1763.553) (-1765.417) [-1771.748] * [-1766.421] (-1763.577) (-1768.474) (-1762.853) -- 0:01:18
      49000 -- (-1763.443) (-1764.217) (-1768.183) [-1768.127] * [-1763.711] (-1764.579) (-1765.680) (-1764.153) -- 0:01:17
      49500 -- (-1763.026) (-1765.404) [-1769.104] (-1767.921) * (-1767.037) (-1770.694) [-1763.357] (-1762.990) -- 0:01:16
      50000 -- (-1764.077) (-1764.010) (-1770.203) [-1766.695] * (-1764.894) (-1769.343) [-1762.748] (-1762.990) -- 0:01:16

      Average standard deviation of split frequencies: 0.023534

      50500 -- [-1763.686] (-1763.120) (-1768.287) (-1772.250) * (-1766.128) (-1764.547) [-1763.538] (-1763.359) -- 0:01:15
      51000 -- (-1767.256) (-1764.902) [-1766.199] (-1769.804) * (-1763.376) (-1763.949) (-1763.568) [-1763.444] -- 0:01:14
      51500 -- (-1763.428) (-1764.897) [-1767.664] (-1766.803) * (-1763.017) (-1764.101) (-1763.946) [-1763.129] -- 0:01:13
      52000 -- [-1764.231] (-1766.719) (-1766.994) (-1768.505) * [-1762.741] (-1762.710) (-1762.826) (-1763.587) -- 0:01:12
      52500 -- (-1763.709) (-1764.118) [-1764.636] (-1772.119) * (-1763.113) (-1766.710) [-1763.132] (-1764.652) -- 0:01:12
      53000 -- (-1768.003) (-1764.522) (-1764.349) [-1766.357] * [-1762.985] (-1764.573) (-1763.121) (-1763.558) -- 0:01:11
      53500 -- (-1768.222) [-1764.237] (-1763.179) (-1776.898) * [-1762.924] (-1765.804) (-1763.967) (-1762.529) -- 0:01:10
      54000 -- (-1764.532) [-1762.785] (-1763.716) (-1771.639) * (-1762.934) (-1765.798) (-1764.081) [-1764.350] -- 0:01:10
      54500 -- (-1763.440) [-1763.557] (-1764.561) (-1773.116) * [-1763.111] (-1762.835) (-1764.017) (-1766.986) -- 0:01:09
      55000 -- (-1765.692) (-1763.784) [-1762.833] (-1771.645) * (-1763.192) (-1767.982) [-1766.448] (-1767.302) -- 0:01:08

      Average standard deviation of split frequencies: 0.024786

      55500 -- [-1763.169] (-1765.757) (-1762.326) (-1778.299) * (-1763.483) (-1765.190) (-1763.246) [-1766.307] -- 0:01:08
      56000 -- [-1763.805] (-1764.170) (-1762.326) (-1781.309) * (-1763.800) (-1765.453) (-1763.570) [-1764.489] -- 0:01:07
      56500 -- [-1764.335] (-1762.869) (-1763.621) (-1771.480) * (-1765.688) [-1766.410] (-1763.807) (-1762.700) -- 0:01:06
      57000 -- (-1763.195) (-1763.985) (-1762.905) [-1769.254] * (-1765.924) (-1766.712) [-1763.988] (-1765.600) -- 0:01:06
      57500 -- (-1764.760) (-1763.665) (-1762.730) [-1771.565] * [-1767.008] (-1765.360) (-1763.941) (-1764.711) -- 0:01:05
      58000 -- [-1764.750] (-1762.951) (-1762.772) (-1773.951) * (-1764.692) [-1766.852] (-1763.940) (-1762.877) -- 0:01:04
      58500 -- (-1763.675) (-1762.941) [-1765.099] (-1765.908) * (-1764.688) (-1765.170) (-1763.941) [-1762.855] -- 0:01:04
      59000 -- (-1763.250) (-1762.546) (-1764.610) [-1765.588] * (-1766.904) [-1763.968] (-1772.951) (-1765.023) -- 0:01:03
      59500 -- (-1764.727) [-1763.916] (-1768.803) (-1763.209) * [-1763.838] (-1764.985) (-1763.938) (-1763.369) -- 0:01:03
      60000 -- [-1763.715] (-1764.234) (-1768.708) (-1763.199) * (-1768.532) (-1766.120) [-1763.215] (-1763.624) -- 0:01:02

      Average standard deviation of split frequencies: 0.028168

      60500 -- (-1767.531) (-1763.882) [-1762.914] (-1763.355) * [-1768.174] (-1763.949) (-1762.810) (-1763.626) -- 0:01:02
      61000 -- (-1765.034) [-1765.208] (-1765.005) (-1762.574) * (-1767.657) [-1763.839] (-1765.796) (-1764.800) -- 0:01:16
      61500 -- [-1764.765] (-1764.711) (-1763.928) (-1762.687) * (-1765.092) (-1764.151) [-1766.400] (-1766.409) -- 0:01:16
      62000 -- [-1766.417] (-1764.547) (-1763.025) (-1765.532) * (-1768.726) (-1764.307) (-1766.329) [-1762.827] -- 0:01:15
      62500 -- (-1766.906) [-1764.328] (-1763.434) (-1763.100) * [-1765.498] (-1766.943) (-1766.594) (-1762.649) -- 0:01:15
      63000 -- (-1765.344) (-1763.477) [-1762.614] (-1765.716) * [-1764.442] (-1766.943) (-1768.117) (-1763.839) -- 0:01:14
      63500 -- [-1765.393] (-1766.539) (-1763.672) (-1764.355) * (-1765.578) [-1765.008] (-1769.358) (-1765.800) -- 0:01:13
      64000 -- (-1763.765) (-1766.751) (-1762.539) [-1766.706] * (-1763.844) (-1764.680) [-1764.035] (-1764.120) -- 0:01:13
      64500 -- (-1766.844) [-1768.527] (-1763.169) (-1765.046) * (-1764.961) [-1765.698] (-1764.408) (-1762.860) -- 0:01:12
      65000 -- [-1768.311] (-1765.682) (-1764.252) (-1763.572) * (-1764.944) (-1764.444) [-1763.408] (-1762.969) -- 0:01:11

      Average standard deviation of split frequencies: 0.024811

      65500 -- (-1763.308) (-1764.644) [-1769.656] (-1766.946) * (-1765.602) (-1765.223) [-1765.008] (-1764.579) -- 0:01:11
      66000 -- (-1763.484) (-1764.443) [-1769.178] (-1763.640) * (-1763.732) (-1765.211) (-1765.332) [-1762.485] -- 0:01:10
      66500 -- (-1763.844) (-1763.725) [-1765.308] (-1763.097) * (-1764.574) [-1763.851] (-1762.980) (-1763.387) -- 0:01:10
      67000 -- (-1763.327) [-1763.475] (-1768.948) (-1763.091) * (-1767.690) [-1763.613] (-1762.542) (-1766.057) -- 0:01:09
      67500 -- (-1763.646) (-1767.759) [-1772.038] (-1763.434) * (-1766.018) (-1767.449) [-1762.749] (-1764.766) -- 0:01:09
      68000 -- (-1763.530) (-1763.726) (-1764.633) [-1766.964] * (-1764.010) (-1765.522) [-1763.132] (-1762.078) -- 0:01:08
      68500 -- (-1762.973) (-1767.309) [-1762.302] (-1765.150) * (-1763.469) (-1766.100) (-1763.748) [-1763.793] -- 0:01:07
      69000 -- (-1762.973) [-1766.293] (-1762.653) (-1764.634) * (-1763.615) [-1765.328] (-1765.582) (-1764.136) -- 0:01:07
      69500 -- (-1765.321) (-1765.992) (-1764.813) [-1763.436] * (-1762.767) (-1766.430) [-1767.255] (-1763.323) -- 0:01:06
      70000 -- (-1764.471) (-1766.085) (-1763.000) [-1766.279] * (-1764.511) (-1766.898) [-1766.874] (-1768.183) -- 0:01:06

      Average standard deviation of split frequencies: 0.026350

      70500 -- (-1768.302) (-1765.068) (-1762.507) [-1765.573] * [-1764.886] (-1769.937) (-1763.777) (-1770.243) -- 0:01:05
      71000 -- (-1763.143) (-1767.781) (-1763.028) [-1765.661] * (-1762.471) (-1767.579) (-1765.806) [-1766.201] -- 0:01:05
      71500 -- [-1762.574] (-1767.166) (-1764.669) (-1763.841) * (-1764.070) (-1767.744) [-1764.755] (-1764.921) -- 0:01:04
      72000 -- (-1762.563) (-1765.506) [-1765.030] (-1767.257) * [-1764.986] (-1764.122) (-1763.181) (-1763.078) -- 0:01:04
      72500 -- (-1763.797) (-1765.962) (-1763.229) [-1767.470] * (-1764.666) (-1763.092) [-1762.275] (-1763.061) -- 0:01:03
      73000 -- [-1764.013] (-1766.762) (-1763.203) (-1763.756) * [-1763.869] (-1764.194) (-1762.803) (-1765.634) -- 0:01:03
      73500 -- [-1765.860] (-1763.635) (-1764.791) (-1765.142) * [-1763.975] (-1762.909) (-1764.399) (-1762.571) -- 0:01:03
      74000 -- [-1765.712] (-1762.154) (-1765.238) (-1767.405) * (-1762.204) (-1762.861) (-1763.567) [-1762.808] -- 0:01:02
      74500 -- (-1764.207) (-1762.085) [-1763.998] (-1768.084) * (-1765.624) [-1763.765] (-1766.925) (-1763.591) -- 0:01:02
      75000 -- [-1764.127] (-1762.392) (-1763.102) (-1770.078) * (-1763.002) (-1764.953) (-1767.007) [-1763.740] -- 0:01:01

      Average standard deviation of split frequencies: 0.023648

      75500 -- [-1763.656] (-1763.284) (-1763.951) (-1766.381) * (-1764.167) [-1764.089] (-1768.357) (-1763.204) -- 0:01:01
      76000 -- (-1763.813) (-1763.702) [-1767.692] (-1765.507) * [-1763.742] (-1764.270) (-1767.641) (-1763.659) -- 0:01:00
      76500 -- (-1762.489) [-1761.996] (-1768.368) (-1765.379) * (-1765.053) (-1766.773) [-1766.249] (-1764.824) -- 0:01:12
      77000 -- (-1762.777) (-1761.996) [-1765.558] (-1765.958) * [-1766.244] (-1764.777) (-1763.554) (-1766.189) -- 0:01:11
      77500 -- [-1763.437] (-1764.191) (-1764.181) (-1766.099) * (-1765.367) (-1765.390) [-1762.665] (-1763.993) -- 0:01:11
      78000 -- (-1762.855) (-1763.597) [-1765.089] (-1765.157) * (-1763.458) (-1766.963) [-1762.469] (-1765.235) -- 0:01:10
      78500 -- [-1763.080] (-1761.968) (-1764.399) (-1764.462) * (-1764.280) (-1765.868) (-1763.995) [-1765.997] -- 0:01:10
      79000 -- (-1762.727) (-1762.220) (-1764.164) [-1765.072] * (-1766.390) [-1765.352] (-1763.774) (-1762.587) -- 0:01:09
      79500 -- (-1762.844) (-1762.403) [-1767.491] (-1764.634) * (-1765.108) [-1764.792] (-1764.201) (-1762.613) -- 0:01:09
      80000 -- (-1763.279) [-1763.282] (-1763.683) (-1764.639) * [-1764.839] (-1764.972) (-1765.055) (-1767.314) -- 0:01:09

      Average standard deviation of split frequencies: 0.020969

      80500 -- (-1765.758) (-1766.817) (-1762.479) [-1763.657] * (-1764.655) (-1763.172) (-1763.957) [-1764.746] -- 0:01:08
      81000 -- [-1766.463] (-1762.681) (-1762.280) (-1763.847) * (-1764.114) [-1763.043] (-1765.404) (-1765.174) -- 0:01:08
      81500 -- (-1764.269) [-1764.767] (-1767.075) (-1766.563) * (-1762.920) (-1765.767) [-1763.921] (-1765.043) -- 0:01:07
      82000 -- (-1769.364) (-1762.666) (-1762.272) [-1764.859] * (-1764.007) (-1763.492) (-1765.477) [-1765.475] -- 0:01:07
      82500 -- (-1765.706) (-1762.143) (-1762.650) [-1763.707] * (-1767.067) (-1763.857) (-1764.743) [-1767.243] -- 0:01:06
      83000 -- (-1765.508) [-1763.319] (-1763.127) (-1765.495) * (-1765.071) (-1765.226) [-1763.200] (-1765.661) -- 0:01:06
      83500 -- (-1764.995) (-1763.134) [-1763.233] (-1765.485) * [-1762.519] (-1764.675) (-1762.378) (-1764.581) -- 0:01:05
      84000 -- [-1765.128] (-1763.207) (-1764.066) (-1764.040) * (-1766.362) (-1764.688) (-1763.497) [-1763.305] -- 0:01:05
      84500 -- (-1764.794) [-1764.068] (-1762.921) (-1763.218) * (-1765.197) (-1768.377) [-1763.567] (-1767.850) -- 0:01:05
      85000 -- (-1764.944) (-1764.828) [-1763.125] (-1765.535) * (-1764.738) (-1764.038) [-1764.078] (-1767.657) -- 0:01:04

      Average standard deviation of split frequencies: 0.021060

      85500 -- [-1764.797] (-1765.327) (-1763.134) (-1764.903) * (-1763.260) (-1764.271) (-1763.390) [-1769.974] -- 0:01:04
      86000 -- (-1764.926) [-1763.904] (-1764.252) (-1763.994) * (-1764.184) (-1762.206) [-1766.133] (-1766.138) -- 0:01:03
      86500 -- [-1764.565] (-1763.634) (-1762.901) (-1763.227) * (-1763.628) [-1763.224] (-1762.518) (-1763.478) -- 0:01:03
      87000 -- (-1764.240) (-1764.574) (-1762.673) [-1763.213] * (-1766.035) [-1766.386] (-1763.297) (-1764.321) -- 0:01:02
      87500 -- (-1763.224) (-1764.162) [-1763.269] (-1762.502) * (-1763.706) [-1767.665] (-1765.745) (-1763.851) -- 0:01:02
      88000 -- [-1763.226] (-1764.387) (-1766.257) (-1762.513) * (-1763.423) (-1767.199) (-1766.528) [-1767.718] -- 0:01:02
      88500 -- (-1762.440) [-1763.822] (-1765.466) (-1762.854) * (-1764.088) (-1765.862) (-1766.490) [-1768.745] -- 0:01:01
      89000 -- [-1762.451] (-1763.288) (-1766.667) (-1762.860) * [-1764.245] (-1764.693) (-1766.380) (-1763.425) -- 0:01:01
      89500 -- (-1763.569) [-1766.294] (-1766.380) (-1765.124) * [-1763.517] (-1763.774) (-1765.501) (-1763.112) -- 0:01:01
      90000 -- (-1762.580) (-1765.181) [-1764.557] (-1763.294) * (-1763.283) [-1762.818] (-1763.818) (-1762.811) -- 0:01:00

      Average standard deviation of split frequencies: 0.022778

      90500 -- (-1764.567) (-1766.425) [-1764.362] (-1763.285) * (-1763.071) (-1762.861) (-1767.685) [-1762.770] -- 0:01:00
      91000 -- (-1765.407) [-1762.481] (-1764.206) (-1763.566) * (-1765.351) (-1763.794) (-1767.810) [-1763.151] -- 0:00:59
      91500 -- (-1768.959) (-1762.481) (-1767.267) [-1763.134] * [-1762.566] (-1763.718) (-1764.829) (-1762.407) -- 0:00:59
      92000 -- (-1767.426) (-1762.481) (-1763.784) [-1763.092] * (-1763.032) (-1763.221) (-1764.157) [-1762.443] -- 0:01:09
      92500 -- (-1766.850) (-1764.863) [-1764.021] (-1763.092) * (-1764.525) (-1763.289) (-1766.418) [-1763.069] -- 0:01:08
      93000 -- (-1765.124) (-1765.489) [-1763.296] (-1763.145) * [-1763.521] (-1764.640) (-1766.815) (-1764.204) -- 0:01:08
      93500 -- (-1764.673) [-1764.049] (-1762.190) (-1762.819) * (-1765.372) (-1765.513) [-1770.704] (-1763.162) -- 0:01:07
      94000 -- [-1763.299] (-1763.380) (-1764.797) (-1764.539) * (-1767.921) (-1763.594) [-1766.505] (-1763.854) -- 0:01:07
      94500 -- [-1764.051] (-1763.095) (-1764.318) (-1763.483) * (-1766.755) [-1764.610] (-1765.650) (-1765.102) -- 0:01:07
      95000 -- [-1762.755] (-1762.238) (-1762.046) (-1762.667) * (-1766.584) (-1762.990) [-1763.063] (-1764.039) -- 0:01:06

      Average standard deviation of split frequencies: 0.021115

      95500 -- [-1763.733] (-1762.821) (-1762.837) (-1764.312) * (-1765.411) [-1762.787] (-1763.537) (-1763.334) -- 0:01:06
      96000 -- [-1763.747] (-1766.207) (-1763.805) (-1764.759) * (-1765.145) [-1762.549] (-1765.037) (-1764.848) -- 0:01:05
      96500 -- [-1764.899] (-1766.444) (-1764.188) (-1766.394) * (-1766.508) [-1763.173] (-1764.795) (-1766.095) -- 0:01:05
      97000 -- [-1763.292] (-1766.304) (-1765.341) (-1766.330) * [-1766.880] (-1762.425) (-1764.177) (-1763.896) -- 0:01:05
      97500 -- [-1763.952] (-1764.939) (-1764.746) (-1763.965) * (-1769.187) [-1764.638] (-1762.442) (-1763.177) -- 0:01:04
      98000 -- [-1764.168] (-1763.312) (-1766.816) (-1764.096) * (-1762.898) (-1765.503) [-1762.363] (-1765.340) -- 0:01:04
      98500 -- (-1766.230) [-1764.689] (-1765.970) (-1763.333) * (-1763.365) (-1763.704) (-1764.369) [-1766.250] -- 0:01:04
      99000 -- [-1765.659] (-1763.434) (-1765.391) (-1764.724) * (-1763.276) (-1764.113) (-1767.149) [-1766.591] -- 0:01:03
      99500 -- [-1763.936] (-1763.578) (-1764.798) (-1766.222) * [-1763.113] (-1764.129) (-1767.787) (-1766.897) -- 0:01:03
      100000 -- (-1763.006) [-1764.599] (-1764.234) (-1765.826) * (-1762.888) [-1762.844] (-1764.023) (-1767.495) -- 0:01:02

      Average standard deviation of split frequencies: 0.020210

      100500 -- (-1763.183) (-1765.585) (-1764.795) [-1762.524] * [-1762.833] (-1763.125) (-1767.878) (-1768.716) -- 0:01:02
      101000 -- (-1767.391) [-1763.765] (-1764.024) (-1764.084) * (-1766.871) (-1763.478) (-1768.290) [-1766.577] -- 0:01:02
      101500 -- [-1762.850] (-1763.434) (-1767.542) (-1763.626) * [-1766.165] (-1762.738) (-1767.146) (-1765.183) -- 0:01:01
      102000 -- (-1763.992) [-1762.524] (-1764.857) (-1763.497) * (-1764.676) (-1763.342) (-1765.720) [-1762.885] -- 0:01:01
      102500 -- (-1763.315) [-1765.393] (-1762.821) (-1762.402) * (-1764.908) [-1763.113] (-1765.047) (-1766.413) -- 0:01:01
      103000 -- (-1764.272) (-1766.883) (-1767.471) [-1763.605] * (-1762.457) (-1764.360) (-1764.549) [-1764.604] -- 0:01:00
      103500 -- (-1763.221) (-1771.330) [-1769.061] (-1766.566) * (-1764.070) [-1762.851] (-1764.840) (-1763.357) -- 0:01:00
      104000 -- (-1765.321) (-1769.007) (-1769.756) [-1764.225] * (-1762.317) (-1765.215) [-1763.993] (-1764.134) -- 0:01:00
      104500 -- [-1762.977] (-1763.515) (-1764.677) (-1764.247) * (-1763.879) (-1762.618) [-1763.659] (-1765.184) -- 0:00:59
      105000 -- (-1769.670) (-1763.530) [-1764.398] (-1765.180) * [-1763.478] (-1762.809) (-1764.334) (-1764.106) -- 0:00:59

      Average standard deviation of split frequencies: 0.021813

      105500 -- (-1765.539) (-1763.587) (-1766.501) [-1764.917] * [-1764.543] (-1765.416) (-1765.147) (-1762.747) -- 0:00:59
      106000 -- (-1772.058) [-1763.735] (-1763.651) (-1764.683) * (-1764.335) [-1766.025] (-1763.721) (-1763.842) -- 0:00:59
      106500 -- [-1770.374] (-1763.322) (-1763.797) (-1764.902) * (-1764.137) (-1763.689) [-1763.251] (-1764.022) -- 0:00:58
      107000 -- (-1764.452) (-1762.104) [-1763.160] (-1765.475) * (-1768.117) (-1763.509) (-1763.517) [-1764.236] -- 0:00:58
      107500 -- (-1764.894) [-1763.430] (-1765.067) (-1767.801) * (-1766.968) [-1764.168] (-1767.576) (-1763.624) -- 0:01:06
      108000 -- (-1762.958) (-1763.409) [-1764.511] (-1770.751) * (-1762.291) (-1767.830) (-1766.881) [-1767.581] -- 0:01:06
      108500 -- (-1762.957) (-1764.381) [-1764.443] (-1768.409) * [-1762.946] (-1765.536) (-1768.459) (-1766.343) -- 0:01:05
      109000 -- (-1764.673) (-1762.504) (-1764.079) [-1762.903] * [-1764.225] (-1766.154) (-1764.247) (-1766.275) -- 0:01:05
      109500 -- (-1764.847) (-1762.448) [-1765.757] (-1762.593) * (-1762.906) (-1766.333) [-1764.896] (-1765.691) -- 0:01:05
      110000 -- (-1766.286) [-1762.491] (-1764.054) (-1763.468) * (-1763.143) (-1766.546) [-1770.064] (-1770.545) -- 0:01:04

      Average standard deviation of split frequencies: 0.020893

      110500 -- [-1765.259] (-1763.798) (-1763.089) (-1764.531) * [-1764.728] (-1763.492) (-1768.662) (-1764.696) -- 0:01:04
      111000 -- (-1764.301) [-1763.167] (-1762.541) (-1762.836) * [-1765.295] (-1764.615) (-1767.087) (-1767.140) -- 0:01:04
      111500 -- (-1764.245) (-1766.626) [-1762.707] (-1765.012) * [-1762.777] (-1764.543) (-1765.245) (-1773.093) -- 0:01:03
      112000 -- (-1763.777) (-1762.881) [-1762.663] (-1768.275) * (-1763.152) (-1765.154) (-1763.725) [-1769.261] -- 0:01:03
      112500 -- (-1764.531) [-1763.430] (-1763.190) (-1768.811) * [-1764.600] (-1764.595) (-1764.481) (-1769.067) -- 0:01:03
      113000 -- (-1763.883) (-1764.560) (-1765.551) [-1762.238] * [-1762.636] (-1765.960) (-1763.077) (-1769.433) -- 0:01:02
      113500 -- [-1763.244] (-1769.224) (-1764.482) (-1761.887) * (-1765.963) [-1768.700] (-1762.231) (-1766.649) -- 0:01:02
      114000 -- [-1763.864] (-1762.444) (-1764.146) (-1762.133) * (-1765.317) (-1767.983) [-1762.437] (-1766.576) -- 0:01:02
      114500 -- (-1762.978) (-1763.709) [-1764.712] (-1765.232) * [-1763.659] (-1771.572) (-1763.978) (-1764.822) -- 0:01:01
      115000 -- [-1762.878] (-1769.463) (-1763.474) (-1766.215) * (-1762.924) (-1764.925) (-1764.572) [-1763.167] -- 0:01:01

      Average standard deviation of split frequencies: 0.018771

      115500 -- [-1762.930] (-1763.294) (-1763.433) (-1765.061) * [-1764.066] (-1765.931) (-1762.856) (-1765.447) -- 0:01:01
      116000 -- [-1764.558] (-1765.578) (-1764.658) (-1769.050) * [-1766.920] (-1765.875) (-1762.919) (-1763.951) -- 0:01:00
      116500 -- [-1762.399] (-1765.655) (-1766.050) (-1768.904) * [-1764.968] (-1765.004) (-1764.709) (-1763.846) -- 0:01:00
      117000 -- (-1765.699) [-1765.233] (-1763.715) (-1765.638) * [-1762.326] (-1763.900) (-1763.903) (-1765.338) -- 0:01:00
      117500 -- (-1764.627) [-1765.633] (-1763.102) (-1765.749) * (-1763.125) (-1765.250) [-1764.371] (-1769.286) -- 0:01:00
      118000 -- [-1762.785] (-1764.536) (-1763.994) (-1763.418) * (-1762.913) [-1763.714] (-1765.104) (-1768.291) -- 0:00:59
      118500 -- (-1762.911) (-1767.475) [-1763.871] (-1763.494) * (-1763.711) [-1763.732] (-1763.254) (-1764.964) -- 0:00:59
      119000 -- (-1763.268) (-1765.569) [-1763.889] (-1763.777) * (-1764.827) [-1762.865] (-1765.254) (-1766.730) -- 0:00:59
      119500 -- (-1762.393) (-1764.295) (-1771.218) [-1764.150] * (-1764.555) [-1762.558] (-1766.564) (-1765.036) -- 0:00:58
      120000 -- (-1764.632) (-1764.192) [-1763.962] (-1767.149) * (-1767.679) [-1762.352] (-1767.979) (-1762.997) -- 0:00:58

      Average standard deviation of split frequencies: 0.018231

      120500 -- (-1764.658) [-1763.024] (-1764.965) (-1763.296) * (-1767.075) (-1762.977) [-1767.588] (-1764.083) -- 0:00:58
      121000 -- (-1769.693) (-1762.694) (-1764.528) [-1766.063] * [-1763.514] (-1763.185) (-1764.679) (-1763.354) -- 0:00:58
      121500 -- [-1765.005] (-1762.711) (-1764.557) (-1765.890) * [-1763.332] (-1763.200) (-1764.748) (-1763.123) -- 0:00:57
      122000 -- [-1765.250] (-1763.301) (-1769.732) (-1768.548) * (-1770.784) (-1763.102) (-1763.473) [-1762.191] -- 0:00:57
      122500 -- [-1763.517] (-1763.740) (-1764.912) (-1770.053) * (-1769.493) (-1764.087) [-1763.517] (-1765.407) -- 0:00:57
      123000 -- [-1764.979] (-1763.459) (-1765.929) (-1768.974) * (-1766.953) (-1762.766) (-1766.432) [-1762.690] -- 0:01:04
      123500 -- [-1764.139] (-1763.408) (-1766.035) (-1767.633) * (-1762.257) [-1764.327] (-1766.569) (-1765.847) -- 0:01:03
      124000 -- (-1764.140) [-1765.328] (-1765.567) (-1767.623) * (-1762.264) (-1766.668) (-1767.738) [-1763.303] -- 0:01:03
      124500 -- [-1764.087] (-1766.279) (-1764.343) (-1764.787) * (-1762.446) (-1766.195) [-1764.412] (-1765.284) -- 0:01:03
      125000 -- [-1764.590] (-1768.730) (-1764.320) (-1764.018) * (-1766.267) (-1766.666) [-1765.418] (-1764.546) -- 0:01:03

      Average standard deviation of split frequencies: 0.018536

      125500 -- (-1764.365) [-1767.854] (-1764.913) (-1763.115) * (-1764.939) (-1766.220) [-1762.974] (-1764.199) -- 0:01:02
      126000 -- (-1766.564) (-1771.580) [-1764.345] (-1764.276) * (-1763.622) [-1765.470] (-1763.177) (-1765.581) -- 0:01:02
      126500 -- (-1766.771) (-1767.293) [-1764.062] (-1762.905) * (-1763.247) (-1764.206) [-1762.725] (-1765.780) -- 0:01:02
      127000 -- [-1764.548] (-1765.091) (-1769.733) (-1763.441) * (-1763.362) (-1764.614) (-1762.950) [-1763.682] -- 0:01:01
      127500 -- (-1766.731) [-1765.324] (-1766.889) (-1763.274) * (-1763.016) [-1769.039] (-1764.099) (-1764.684) -- 0:01:01
      128000 -- (-1767.131) [-1765.131] (-1772.012) (-1765.203) * (-1765.922) (-1765.353) [-1763.318] (-1768.743) -- 0:01:01
      128500 -- (-1767.540) (-1765.271) (-1770.831) [-1763.312] * (-1763.478) [-1766.547] (-1762.197) (-1763.879) -- 0:01:01
      129000 -- (-1765.337) [-1764.775] (-1766.063) (-1769.027) * (-1764.110) [-1765.169] (-1762.608) (-1763.876) -- 0:01:00
      129500 -- (-1764.675) (-1764.348) (-1768.353) [-1764.366] * [-1763.539] (-1768.560) (-1765.257) (-1764.632) -- 0:01:00
      130000 -- [-1766.846] (-1764.262) (-1763.840) (-1767.134) * (-1763.122) (-1765.167) (-1764.277) [-1764.726] -- 0:01:00

      Average standard deviation of split frequencies: 0.019678

      130500 -- (-1765.044) (-1763.084) [-1762.719] (-1766.328) * (-1764.282) (-1765.433) [-1763.555] (-1763.338) -- 0:00:59
      131000 -- [-1763.927] (-1762.989) (-1762.610) (-1762.843) * (-1764.299) (-1765.844) [-1763.683] (-1762.942) -- 0:00:59
      131500 -- [-1763.980] (-1763.991) (-1762.805) (-1762.651) * (-1763.260) (-1765.191) (-1763.735) [-1763.236] -- 0:00:59
      132000 -- (-1762.699) (-1764.325) [-1762.746] (-1762.745) * (-1764.545) (-1763.420) [-1765.647] (-1764.379) -- 0:00:59
      132500 -- (-1763.255) (-1763.196) [-1762.815] (-1763.526) * (-1768.785) (-1763.364) (-1764.357) [-1763.962] -- 0:00:58
      133000 -- (-1763.296) (-1764.888) (-1767.876) [-1763.234] * (-1765.284) (-1762.583) [-1764.296] (-1763.549) -- 0:00:58
      133500 -- (-1764.039) (-1767.524) [-1767.004] (-1763.667) * (-1764.082) (-1762.617) [-1764.880] (-1763.549) -- 0:00:58
      134000 -- (-1762.942) (-1764.331) (-1762.531) [-1767.565] * (-1766.504) (-1763.262) (-1764.872) [-1762.469] -- 0:00:58
      134500 -- [-1766.028] (-1764.759) (-1763.179) (-1767.247) * (-1765.902) [-1763.331] (-1765.414) (-1767.950) -- 0:00:57
      135000 -- (-1765.609) [-1762.916] (-1762.737) (-1764.520) * (-1767.448) (-1764.608) (-1767.710) [-1764.019] -- 0:00:57

      Average standard deviation of split frequencies: 0.020962

      135500 -- (-1766.366) [-1763.725] (-1764.261) (-1763.399) * (-1766.657) (-1763.794) (-1765.625) [-1765.259] -- 0:00:57
      136000 -- [-1764.650] (-1763.753) (-1764.044) (-1763.587) * (-1764.920) (-1764.776) [-1764.786] (-1765.763) -- 0:00:57
      136500 -- (-1764.848) (-1765.539) (-1762.712) [-1763.616] * (-1765.147) (-1762.981) (-1766.358) [-1763.146] -- 0:00:56
      137000 -- (-1764.207) [-1763.586] (-1763.456) (-1765.288) * (-1764.308) (-1762.850) (-1766.153) [-1762.955] -- 0:00:56
      137500 -- (-1763.406) (-1763.573) [-1764.796] (-1765.496) * (-1763.051) (-1763.697) (-1767.924) [-1764.524] -- 0:01:02
      138000 -- (-1763.351) [-1764.244] (-1764.035) (-1763.862) * (-1762.963) (-1762.350) [-1771.419] (-1767.105) -- 0:01:02
      138500 -- [-1762.797] (-1764.207) (-1763.301) (-1763.866) * [-1761.915] (-1764.630) (-1770.062) (-1764.609) -- 0:01:02
      139000 -- [-1763.004] (-1764.855) (-1766.794) (-1768.286) * (-1761.927) [-1762.332] (-1766.439) (-1764.351) -- 0:01:01
      139500 -- (-1765.164) [-1763.449] (-1764.618) (-1762.024) * (-1762.289) (-1764.236) (-1763.851) [-1765.397] -- 0:01:01
      140000 -- (-1765.068) (-1763.428) [-1765.300] (-1763.332) * (-1767.185) (-1765.459) [-1767.888] (-1763.325) -- 0:01:01

      Average standard deviation of split frequencies: 0.019650

      140500 -- (-1764.685) [-1762.907] (-1763.367) (-1763.332) * (-1763.981) [-1762.157] (-1764.610) (-1764.207) -- 0:01:01
      141000 -- (-1765.785) (-1763.063) [-1763.637] (-1767.024) * [-1767.801] (-1762.833) (-1763.711) (-1762.306) -- 0:01:00
      141500 -- (-1763.312) [-1765.529] (-1763.094) (-1765.503) * (-1763.991) [-1762.044] (-1763.594) (-1764.055) -- 0:01:00
      142000 -- (-1763.332) (-1771.673) (-1763.684) [-1763.775] * (-1764.331) [-1762.115] (-1763.999) (-1764.432) -- 0:01:00
      142500 -- (-1768.204) (-1763.024) [-1764.563] (-1766.347) * [-1764.706] (-1762.115) (-1762.962) (-1763.916) -- 0:01:00
      143000 -- (-1765.227) (-1764.508) (-1767.112) [-1762.956] * (-1764.048) (-1762.843) [-1763.950] (-1765.466) -- 0:00:59
      143500 -- [-1762.967] (-1766.990) (-1765.605) (-1765.455) * (-1765.747) [-1762.886] (-1763.102) (-1762.701) -- 0:00:59
      144000 -- (-1765.679) (-1764.521) [-1763.721] (-1765.994) * (-1764.685) (-1762.681) [-1763.436] (-1762.612) -- 0:00:59
      144500 -- [-1764.637] (-1763.782) (-1764.621) (-1764.072) * (-1766.240) [-1763.624] (-1762.860) (-1764.313) -- 0:00:59
      145000 -- (-1763.747) [-1765.409] (-1765.575) (-1763.592) * [-1765.455] (-1763.170) (-1764.094) (-1762.725) -- 0:00:58

      Average standard deviation of split frequencies: 0.017465

      145500 -- [-1763.350] (-1763.448) (-1767.736) (-1764.847) * [-1765.682] (-1768.238) (-1764.626) (-1764.097) -- 0:00:58
      146000 -- (-1767.968) (-1768.160) [-1766.749] (-1764.402) * (-1763.888) [-1765.740] (-1763.347) (-1762.905) -- 0:00:58
      146500 -- (-1761.931) (-1765.981) [-1766.868] (-1762.200) * (-1763.741) (-1765.146) [-1763.119] (-1764.294) -- 0:00:58
      147000 -- [-1764.145] (-1764.312) (-1763.487) (-1762.312) * (-1768.610) (-1765.062) (-1765.346) [-1764.337] -- 0:00:58
      147500 -- (-1765.641) (-1762.661) (-1767.250) [-1762.962] * (-1765.636) (-1762.590) (-1763.747) [-1763.516] -- 0:00:57
      148000 -- (-1763.976) (-1764.535) [-1767.577] (-1763.195) * (-1764.926) (-1767.880) [-1767.224] (-1763.865) -- 0:00:57
      148500 -- (-1764.508) (-1762.793) [-1764.400] (-1763.344) * (-1763.318) (-1765.695) [-1763.958] (-1764.467) -- 0:00:57
      149000 -- (-1767.195) [-1765.134] (-1765.584) (-1763.093) * (-1763.410) [-1762.860] (-1764.464) (-1765.368) -- 0:00:57
      149500 -- (-1769.212) (-1765.245) (-1765.476) [-1763.750] * (-1763.205) [-1762.885] (-1765.624) (-1763.633) -- 0:00:56
      150000 -- (-1768.212) (-1764.622) [-1762.734] (-1766.023) * (-1764.607) [-1762.725] (-1766.011) (-1766.059) -- 0:00:56

      Average standard deviation of split frequencies: 0.015644

      150500 -- [-1762.125] (-1764.876) (-1762.631) (-1764.859) * [-1762.926] (-1764.550) (-1763.281) (-1766.794) -- 0:00:56
      151000 -- (-1762.994) (-1767.524) (-1763.759) [-1766.476] * (-1762.787) [-1764.566] (-1763.010) (-1768.362) -- 0:00:56
      151500 -- (-1762.193) (-1765.517) [-1764.012] (-1762.968) * (-1763.487) (-1763.111) [-1763.002] (-1763.999) -- 0:00:56
      152000 -- [-1763.607] (-1764.891) (-1766.396) (-1764.957) * [-1764.326] (-1765.532) (-1763.850) (-1762.789) -- 0:00:55
      152500 -- (-1762.763) (-1766.938) (-1764.842) [-1762.800] * [-1764.189] (-1763.426) (-1762.585) (-1762.357) -- 0:00:55
      153000 -- [-1762.755] (-1764.911) (-1767.081) (-1763.248) * (-1766.924) [-1763.211] (-1764.187) (-1763.833) -- 0:01:00
      153500 -- (-1762.822) (-1765.616) (-1763.337) [-1765.564] * (-1767.156) [-1762.791] (-1766.118) (-1762.113) -- 0:01:00
      154000 -- (-1763.052) [-1768.229] (-1763.181) (-1765.422) * (-1766.225) (-1762.454) (-1767.924) [-1766.324] -- 0:01:00
      154500 -- (-1763.799) (-1766.264) (-1762.525) [-1766.390] * (-1767.445) (-1767.869) (-1768.286) [-1762.359] -- 0:01:00
      155000 -- (-1764.435) (-1766.555) [-1767.222] (-1764.311) * [-1765.082] (-1765.984) (-1766.421) (-1762.640) -- 0:00:59

      Average standard deviation of split frequencies: 0.015109

      155500 -- (-1763.771) [-1766.100] (-1766.898) (-1763.897) * (-1765.323) [-1764.290] (-1764.897) (-1762.640) -- 0:00:59
      156000 -- (-1764.719) [-1768.178] (-1764.776) (-1765.163) * (-1766.927) (-1763.045) [-1763.734] (-1762.447) -- 0:00:59
      156500 -- (-1762.788) (-1762.426) (-1763.266) [-1766.301] * (-1767.705) (-1766.053) (-1764.538) [-1766.401] -- 0:00:59
      157000 -- (-1762.325) (-1763.338) [-1763.624] (-1765.750) * (-1763.944) (-1763.943) [-1763.636] (-1762.560) -- 0:00:59
      157500 -- (-1763.919) [-1763.412] (-1765.183) (-1767.424) * (-1767.088) (-1763.256) [-1763.636] (-1762.544) -- 0:00:58
      158000 -- (-1767.113) (-1763.667) [-1767.238] (-1765.110) * (-1765.926) [-1764.085] (-1763.621) (-1764.665) -- 0:00:58
      158500 -- [-1767.371] (-1765.314) (-1766.730) (-1764.531) * (-1766.431) (-1763.604) [-1764.186] (-1766.118) -- 0:00:58
      159000 -- (-1767.873) (-1762.854) [-1766.183] (-1764.040) * [-1767.049] (-1765.910) (-1765.316) (-1768.062) -- 0:00:58
      159500 -- (-1768.870) (-1768.283) [-1766.522] (-1767.106) * (-1771.112) (-1762.371) (-1767.145) [-1765.878] -- 0:00:57
      160000 -- [-1766.314] (-1765.018) (-1765.352) (-1768.817) * [-1768.785] (-1766.302) (-1764.536) (-1766.060) -- 0:00:57

      Average standard deviation of split frequencies: 0.016523

      160500 -- (-1764.024) [-1764.806] (-1765.691) (-1763.955) * [-1767.776] (-1762.770) (-1764.079) (-1767.601) -- 0:00:57
      161000 -- (-1764.575) (-1764.984) (-1764.388) [-1763.440] * (-1767.605) (-1763.641) (-1764.148) [-1762.262] -- 0:00:57
      161500 -- (-1762.866) [-1763.009] (-1764.269) (-1764.135) * (-1767.256) (-1763.228) [-1763.350] (-1762.455) -- 0:00:57
      162000 -- (-1765.370) (-1762.998) (-1764.393) [-1764.197] * (-1766.764) [-1764.557] (-1764.302) (-1764.666) -- 0:00:56
      162500 -- [-1764.269] (-1764.504) (-1762.704) (-1763.081) * (-1764.737) (-1764.108) [-1762.945] (-1764.786) -- 0:00:56
      163000 -- (-1765.240) [-1762.683] (-1764.929) (-1766.063) * [-1764.239] (-1764.224) (-1763.148) (-1763.106) -- 0:00:56
      163500 -- (-1763.066) [-1763.604] (-1769.434) (-1764.480) * (-1764.786) [-1765.307] (-1763.971) (-1764.085) -- 0:00:56
      164000 -- (-1762.377) (-1763.685) [-1768.925] (-1766.539) * (-1763.975) (-1762.942) [-1764.076] (-1762.779) -- 0:00:56
      164500 -- (-1763.061) [-1764.452] (-1766.820) (-1763.346) * (-1766.090) (-1762.756) (-1763.576) [-1764.026] -- 0:00:55
      165000 -- (-1763.047) (-1773.872) (-1762.874) [-1763.346] * (-1770.097) [-1768.163] (-1763.122) (-1764.602) -- 0:00:55

      Average standard deviation of split frequencies: 0.016329

      165500 -- (-1764.389) [-1770.468] (-1763.233) (-1763.346) * [-1766.514] (-1765.837) (-1764.218) (-1766.883) -- 0:00:55
      166000 -- (-1766.320) (-1770.257) (-1765.130) [-1765.742] * (-1762.965) [-1762.534] (-1763.714) (-1763.535) -- 0:00:55
      166500 -- (-1766.364) (-1766.748) [-1765.458] (-1767.301) * [-1763.192] (-1764.271) (-1763.071) (-1763.632) -- 0:00:55
      167000 -- (-1765.184) (-1767.365) (-1763.326) [-1764.290] * (-1763.833) (-1763.612) (-1768.118) [-1763.632] -- 0:00:54
      167500 -- (-1762.944) [-1766.340] (-1763.106) (-1764.290) * (-1764.172) (-1763.577) [-1764.074] (-1763.648) -- 0:00:54
      168000 -- (-1763.459) (-1766.802) [-1762.956] (-1767.111) * (-1765.565) (-1762.593) (-1763.805) [-1764.135] -- 0:00:54
      168500 -- (-1763.466) (-1766.852) [-1766.650] (-1767.790) * (-1762.848) (-1764.875) [-1765.532] (-1766.605) -- 0:00:59
      169000 -- (-1765.827) [-1764.995] (-1765.665) (-1763.235) * (-1763.456) (-1765.969) [-1762.897] (-1767.003) -- 0:00:59
      169500 -- (-1765.449) (-1763.744) [-1766.099] (-1764.170) * (-1763.522) [-1763.025] (-1765.265) (-1770.425) -- 0:00:58
      170000 -- (-1765.547) (-1763.035) [-1763.599] (-1762.260) * (-1763.874) [-1763.142] (-1766.361) (-1765.357) -- 0:00:58

      Average standard deviation of split frequencies: 0.017647

      170500 -- [-1767.780] (-1769.426) (-1763.081) (-1765.346) * [-1763.430] (-1764.195) (-1765.096) (-1764.717) -- 0:00:58
      171000 -- (-1764.162) (-1767.773) [-1764.814] (-1763.676) * (-1767.131) (-1764.439) (-1765.457) [-1762.978] -- 0:00:58
      171500 -- [-1763.124] (-1764.141) (-1766.800) (-1764.776) * (-1765.897) [-1766.060] (-1764.227) (-1765.727) -- 0:00:57
      172000 -- (-1766.155) [-1762.859] (-1766.368) (-1763.272) * (-1766.819) (-1767.446) (-1764.128) [-1764.147] -- 0:00:57
      172500 -- [-1763.337] (-1764.166) (-1765.343) (-1763.125) * (-1766.136) [-1763.268] (-1763.996) (-1763.551) -- 0:00:57
      173000 -- (-1764.285) [-1763.717] (-1762.937) (-1762.989) * (-1762.914) (-1764.611) [-1764.703] (-1764.498) -- 0:00:57
      173500 -- [-1763.101] (-1763.647) (-1764.173) (-1764.480) * [-1763.059] (-1764.381) (-1764.186) (-1763.404) -- 0:00:57
      174000 -- (-1763.012) [-1764.326] (-1764.000) (-1762.814) * [-1763.048] (-1764.900) (-1765.582) (-1764.658) -- 0:00:56
      174500 -- (-1764.984) (-1765.261) [-1764.480] (-1762.700) * (-1762.963) (-1765.539) [-1764.855] (-1763.240) -- 0:00:56
      175000 -- (-1763.898) (-1766.185) (-1764.738) [-1762.913] * (-1764.217) (-1766.171) [-1766.780] (-1763.345) -- 0:00:56

      Average standard deviation of split frequencies: 0.019595

      175500 -- (-1765.001) (-1767.930) [-1766.148] (-1763.752) * (-1766.334) (-1764.098) [-1765.766] (-1763.103) -- 0:00:56
      176000 -- (-1763.661) (-1762.607) [-1765.200] (-1763.327) * (-1767.834) (-1766.486) [-1766.560] (-1765.332) -- 0:00:56
      176500 -- (-1763.581) (-1767.872) [-1764.861] (-1767.573) * (-1769.983) [-1766.235] (-1766.399) (-1765.582) -- 0:00:55
      177000 -- (-1763.144) [-1762.873] (-1766.216) (-1763.533) * (-1765.021) [-1766.541] (-1766.841) (-1766.075) -- 0:00:55
      177500 -- (-1765.303) [-1763.877] (-1764.383) (-1763.360) * [-1762.722] (-1769.115) (-1764.049) (-1763.884) -- 0:00:55
      178000 -- (-1766.356) (-1765.243) (-1768.531) [-1763.549] * (-1763.177) (-1770.238) (-1766.251) [-1763.865] -- 0:00:55
      178500 -- (-1766.477) (-1765.241) [-1769.070] (-1765.743) * (-1764.763) (-1768.605) (-1766.964) [-1764.283] -- 0:00:55
      179000 -- (-1763.252) (-1762.523) [-1764.951] (-1763.376) * (-1763.106) (-1768.164) [-1762.284] (-1764.216) -- 0:00:55
      179500 -- [-1762.999] (-1763.737) (-1765.344) (-1764.558) * [-1762.889] (-1766.005) (-1762.268) (-1766.083) -- 0:00:54
      180000 -- (-1764.014) (-1764.498) [-1762.163] (-1767.985) * (-1765.519) (-1763.700) [-1762.488] (-1763.589) -- 0:00:54

      Average standard deviation of split frequencies: 0.021599

      180500 -- (-1765.673) (-1770.690) (-1766.986) [-1765.818] * (-1768.874) [-1766.579] (-1762.252) (-1767.113) -- 0:00:54
      181000 -- (-1765.252) (-1767.537) (-1767.346) [-1767.841] * (-1763.525) (-1765.149) (-1762.364) [-1767.833] -- 0:00:54
      181500 -- (-1764.064) (-1765.909) (-1768.442) [-1765.468] * (-1762.919) [-1763.956] (-1762.665) (-1766.139) -- 0:00:54
      182000 -- (-1763.782) [-1763.507] (-1766.875) (-1763.136) * [-1765.525] (-1762.874) (-1762.665) (-1762.620) -- 0:00:53
      182500 -- (-1763.680) [-1764.494] (-1766.522) (-1762.781) * [-1764.489] (-1763.092) (-1764.443) (-1768.074) -- 0:00:53
      183000 -- (-1765.259) (-1762.477) [-1764.459] (-1762.860) * [-1763.234] (-1764.142) (-1763.392) (-1765.362) -- 0:00:53
      183500 -- (-1763.528) (-1762.604) [-1765.954] (-1767.671) * [-1763.280] (-1764.283) (-1763.245) (-1764.756) -- 0:00:53
      184000 -- (-1771.263) (-1762.711) (-1764.044) [-1764.018] * (-1764.115) (-1768.159) [-1762.969] (-1765.089) -- 0:00:57
      184500 -- (-1764.247) [-1763.078] (-1764.474) (-1764.247) * (-1762.820) [-1765.161] (-1763.503) (-1764.783) -- 0:00:57
      185000 -- (-1765.334) (-1762.801) (-1765.719) [-1762.460] * (-1766.857) (-1762.834) (-1763.866) [-1764.536] -- 0:00:57

      Average standard deviation of split frequencies: 0.019342

      185500 -- (-1765.497) [-1763.094] (-1767.009) (-1763.024) * (-1764.080) (-1762.883) (-1763.884) [-1763.199] -- 0:00:57
      186000 -- (-1767.974) [-1763.811] (-1763.808) (-1762.571) * (-1766.429) (-1767.750) [-1763.884] (-1765.912) -- 0:00:56
      186500 -- (-1768.076) (-1762.685) (-1766.137) [-1764.008] * (-1764.346) [-1769.491] (-1764.839) (-1765.519) -- 0:00:56
      187000 -- (-1764.083) (-1762.972) (-1766.342) [-1764.533] * (-1766.067) [-1768.307] (-1763.421) (-1764.792) -- 0:00:56
      187500 -- (-1763.140) [-1762.314] (-1765.465) (-1766.520) * [-1765.494] (-1764.283) (-1762.820) (-1763.297) -- 0:00:56
      188000 -- (-1765.797) [-1762.065] (-1763.907) (-1767.866) * (-1765.087) (-1764.984) (-1768.049) [-1762.850] -- 0:00:56
      188500 -- [-1763.706] (-1764.477) (-1764.383) (-1766.419) * (-1764.878) (-1763.375) (-1767.682) [-1763.411] -- 0:00:55
      189000 -- (-1763.560) (-1762.966) [-1765.390] (-1766.666) * (-1766.070) (-1763.204) [-1768.711] (-1762.905) -- 0:00:55
      189500 -- [-1763.372] (-1762.619) (-1764.185) (-1767.986) * [-1765.123] (-1763.994) (-1764.035) (-1763.000) -- 0:00:55
      190000 -- (-1762.286) (-1763.357) [-1762.202] (-1767.904) * [-1763.816] (-1763.961) (-1763.269) (-1763.044) -- 0:00:55

      Average standard deviation of split frequencies: 0.020054

      190500 -- (-1762.931) (-1763.123) [-1762.993] (-1765.786) * (-1762.927) (-1769.145) (-1763.014) [-1762.833] -- 0:00:55
      191000 -- (-1763.243) [-1764.337] (-1763.132) (-1765.712) * (-1764.485) [-1764.509] (-1767.205) (-1764.171) -- 0:00:55
      191500 -- [-1763.027] (-1763.307) (-1762.569) (-1764.786) * (-1762.358) [-1763.083] (-1763.929) (-1764.848) -- 0:00:54
      192000 -- (-1766.106) (-1764.446) [-1763.806] (-1770.025) * (-1762.378) (-1764.537) [-1763.427] (-1764.289) -- 0:00:54
      192500 -- (-1764.171) [-1767.202] (-1764.767) (-1763.460) * [-1762.372] (-1767.570) (-1763.905) (-1765.406) -- 0:00:54
      193000 -- (-1764.376) (-1763.243) (-1766.263) [-1764.374] * (-1764.396) (-1763.442) (-1763.880) [-1763.707] -- 0:00:54
      193500 -- (-1764.107) (-1762.459) [-1762.602] (-1763.180) * (-1766.952) (-1765.090) (-1766.233) [-1767.031] -- 0:00:54
      194000 -- (-1767.035) (-1766.639) (-1763.619) [-1762.957] * (-1762.842) [-1764.528] (-1764.002) (-1767.970) -- 0:00:54
      194500 -- (-1764.315) (-1769.646) (-1763.546) [-1763.322] * (-1763.320) (-1762.753) [-1765.199] (-1767.785) -- 0:00:53
      195000 -- (-1764.533) (-1764.289) (-1766.245) [-1764.970] * (-1764.155) (-1762.362) [-1763.157] (-1764.541) -- 0:00:53

      Average standard deviation of split frequencies: 0.020444

      195500 -- (-1766.995) (-1766.977) (-1763.207) [-1763.218] * (-1767.004) (-1762.437) (-1764.013) [-1763.018] -- 0:00:53
      196000 -- [-1765.848] (-1764.226) (-1764.006) (-1763.357) * (-1767.272) (-1762.437) (-1767.339) [-1763.455] -- 0:00:53
      196500 -- (-1766.048) (-1766.782) [-1766.148] (-1763.419) * (-1763.874) (-1763.049) (-1764.735) [-1763.973] -- 0:00:53
      197000 -- (-1769.269) (-1764.762) (-1765.344) [-1762.672] * (-1762.929) (-1762.815) [-1764.904] (-1762.964) -- 0:00:52
      197500 -- (-1764.777) (-1764.547) (-1766.211) [-1762.751] * (-1762.643) (-1763.700) (-1768.451) [-1762.941] -- 0:00:52
      198000 -- (-1762.715) (-1766.403) (-1764.843) [-1762.459] * [-1762.626] (-1762.779) (-1764.307) (-1763.438) -- 0:00:52
      198500 -- (-1764.631) [-1763.684] (-1764.725) (-1764.761) * (-1763.588) (-1764.829) (-1764.057) [-1763.798] -- 0:00:52
      199000 -- (-1762.064) [-1767.135] (-1763.992) (-1765.438) * (-1763.254) (-1765.062) [-1763.870] (-1766.106) -- 0:00:52
      199500 -- (-1763.342) (-1769.563) [-1764.351] (-1765.104) * (-1762.524) (-1766.577) [-1767.878] (-1763.974) -- 0:00:56
      200000 -- (-1762.272) (-1770.042) [-1763.365] (-1767.277) * (-1763.422) [-1767.519] (-1767.394) (-1764.491) -- 0:00:55

      Average standard deviation of split frequencies: 0.021281

      200500 -- (-1763.146) (-1765.415) [-1763.148] (-1764.538) * [-1763.184] (-1764.623) (-1767.384) (-1762.792) -- 0:00:55
      201000 -- [-1764.446] (-1763.833) (-1762.928) (-1764.795) * [-1769.113] (-1764.003) (-1762.628) (-1763.370) -- 0:00:55
      201500 -- (-1765.967) (-1765.837) (-1764.789) [-1765.060] * [-1763.767] (-1765.529) (-1765.902) (-1764.052) -- 0:00:55
      202000 -- (-1767.386) (-1766.758) [-1767.590] (-1765.079) * (-1763.524) [-1765.079] (-1765.515) (-1763.712) -- 0:00:55
      202500 -- (-1766.003) [-1767.850] (-1765.376) (-1765.085) * (-1765.567) (-1765.490) [-1763.545] (-1766.387) -- 0:00:55
      203000 -- (-1765.230) [-1764.085] (-1766.494) (-1763.983) * [-1762.620] (-1764.455) (-1762.557) (-1765.360) -- 0:00:54
      203500 -- (-1767.081) (-1763.215) [-1762.585] (-1763.819) * (-1766.893) (-1765.335) [-1763.955] (-1763.724) -- 0:00:54
      204000 -- (-1768.982) (-1763.673) [-1763.816] (-1763.856) * (-1763.275) (-1763.469) [-1764.923] (-1763.162) -- 0:00:54
      204500 -- (-1768.613) [-1763.674] (-1762.939) (-1764.292) * (-1763.346) (-1766.060) (-1765.511) [-1762.754] -- 0:00:54
      205000 -- (-1764.220) [-1763.456] (-1763.119) (-1763.798) * (-1762.395) (-1765.938) (-1765.297) [-1762.790] -- 0:00:54

      Average standard deviation of split frequencies: 0.021231

      205500 -- [-1762.472] (-1763.345) (-1765.020) (-1763.770) * (-1762.423) (-1766.825) [-1764.334] (-1764.700) -- 0:00:54
      206000 -- (-1764.874) (-1767.132) [-1764.005] (-1763.910) * (-1765.022) (-1766.517) [-1763.250] (-1763.459) -- 0:00:53
      206500 -- [-1764.233] (-1763.265) (-1765.302) (-1764.035) * [-1763.174] (-1767.828) (-1763.467) (-1763.866) -- 0:00:53
      207000 -- (-1765.068) (-1765.870) (-1762.445) [-1762.758] * (-1767.892) [-1763.982] (-1764.556) (-1763.436) -- 0:00:53
      207500 -- (-1762.802) (-1764.354) [-1763.220] (-1762.716) * (-1763.328) (-1765.316) (-1763.728) [-1763.181] -- 0:00:53
      208000 -- (-1762.780) [-1764.204] (-1763.263) (-1762.906) * (-1765.803) (-1765.022) (-1764.266) [-1763.514] -- 0:00:53
      208500 -- (-1762.780) [-1763.890] (-1767.092) (-1768.001) * (-1765.848) (-1763.447) [-1764.393] (-1763.229) -- 0:00:53
      209000 -- [-1765.166] (-1763.913) (-1763.943) (-1762.270) * (-1767.364) (-1763.679) [-1765.110] (-1763.034) -- 0:00:52
      209500 -- (-1764.861) (-1763.757) (-1764.793) [-1762.939] * (-1765.557) (-1764.112) (-1768.086) [-1763.670] -- 0:00:52
      210000 -- (-1764.512) (-1764.470) [-1764.219] (-1763.098) * (-1766.356) (-1763.280) [-1765.878] (-1764.153) -- 0:00:52

      Average standard deviation of split frequencies: 0.018296

      210500 -- (-1764.876) [-1762.825] (-1763.439) (-1763.288) * (-1767.627) (-1763.609) (-1763.011) [-1762.640] -- 0:00:52
      211000 -- (-1766.252) (-1763.048) [-1763.237] (-1763.847) * (-1767.082) [-1763.645] (-1764.094) (-1768.135) -- 0:00:52
      211500 -- (-1764.292) (-1764.595) [-1762.408] (-1763.942) * [-1764.153] (-1763.677) (-1763.270) (-1766.154) -- 0:00:52
      212000 -- (-1764.489) [-1764.857] (-1764.246) (-1762.671) * (-1765.036) (-1763.722) (-1762.945) [-1764.711] -- 0:00:52
      212500 -- (-1763.858) [-1762.419] (-1764.379) (-1764.628) * (-1764.892) (-1765.153) [-1763.140] (-1766.397) -- 0:00:51
      213000 -- (-1764.981) (-1765.367) (-1764.403) [-1762.569] * (-1764.355) [-1762.882] (-1768.413) (-1763.510) -- 0:00:51
      213500 -- [-1762.968] (-1762.769) (-1767.972) (-1763.149) * [-1766.027] (-1762.835) (-1764.919) (-1763.474) -- 0:00:51
      214000 -- (-1766.017) (-1763.432) [-1767.182] (-1769.699) * [-1763.625] (-1764.473) (-1764.200) (-1763.341) -- 0:00:51
      214500 -- (-1764.117) [-1767.560] (-1764.052) (-1773.727) * [-1764.016] (-1769.274) (-1765.581) (-1762.799) -- 0:00:54
      215000 -- (-1764.117) (-1762.499) [-1771.901] (-1764.068) * (-1763.254) (-1764.724) (-1764.426) [-1765.314] -- 0:00:54

      Average standard deviation of split frequencies: 0.018101

      215500 -- [-1763.201] (-1763.750) (-1767.152) (-1762.992) * (-1763.301) (-1764.290) [-1766.586] (-1766.164) -- 0:00:54
      216000 -- [-1767.274] (-1766.619) (-1763.835) (-1763.307) * (-1763.550) [-1764.007] (-1763.099) (-1765.495) -- 0:00:54
      216500 -- (-1767.734) [-1764.246] (-1765.599) (-1764.216) * (-1763.072) (-1765.047) [-1763.375] (-1765.951) -- 0:00:54
      217000 -- (-1765.318) [-1764.776] (-1766.924) (-1766.286) * (-1764.464) (-1762.408) (-1764.793) [-1764.601] -- 0:00:54
      217500 -- (-1765.147) (-1762.818) (-1762.949) [-1764.951] * (-1765.654) (-1763.406) [-1763.825] (-1764.514) -- 0:00:53
      218000 -- (-1766.546) [-1762.900] (-1762.952) (-1763.810) * (-1762.413) [-1764.632] (-1763.008) (-1765.476) -- 0:00:53
      218500 -- (-1763.580) (-1763.216) [-1762.665] (-1764.172) * (-1765.359) (-1765.505) (-1764.516) [-1762.737] -- 0:00:53
      219000 -- (-1763.554) [-1762.703] (-1762.549) (-1764.579) * [-1763.524] (-1765.675) (-1763.614) (-1763.204) -- 0:00:53
      219500 -- (-1763.580) (-1762.485) [-1763.195] (-1765.935) * [-1766.806] (-1765.971) (-1763.950) (-1762.501) -- 0:00:53
      220000 -- (-1765.695) [-1763.312] (-1762.090) (-1768.632) * (-1768.571) [-1763.603] (-1764.150) (-1767.373) -- 0:00:53

      Average standard deviation of split frequencies: 0.017593

      220500 -- (-1762.586) (-1762.022) (-1763.295) [-1763.128] * (-1771.355) (-1766.896) (-1762.032) [-1764.878] -- 0:00:53
      221000 -- [-1762.686] (-1763.699) (-1764.330) (-1763.821) * (-1768.148) (-1766.263) (-1763.937) [-1765.430] -- 0:00:52
      221500 -- (-1764.623) (-1764.041) (-1768.333) [-1764.660] * (-1762.512) (-1762.300) [-1763.842] (-1762.778) -- 0:00:52
      222000 -- [-1764.732] (-1763.907) (-1767.124) (-1764.309) * [-1765.593] (-1763.573) (-1769.010) (-1762.305) -- 0:00:52
      222500 -- (-1764.502) [-1763.626] (-1764.260) (-1764.022) * (-1766.058) (-1762.602) (-1770.378) [-1765.342] -- 0:00:52
      223000 -- (-1766.799) (-1765.308) [-1765.328] (-1765.809) * (-1764.353) [-1767.513] (-1764.176) (-1765.267) -- 0:00:52
      223500 -- (-1763.174) (-1770.220) [-1762.136] (-1767.197) * (-1765.557) (-1763.338) (-1768.077) [-1762.878] -- 0:00:52
      224000 -- (-1764.856) [-1764.358] (-1764.255) (-1762.605) * (-1764.338) (-1764.248) [-1764.150] (-1763.680) -- 0:00:51
      224500 -- (-1763.844) (-1765.404) (-1763.779) [-1762.551] * (-1764.466) (-1763.000) [-1762.445] (-1766.389) -- 0:00:51
      225000 -- (-1764.481) [-1763.062] (-1764.185) (-1762.798) * (-1765.070) (-1762.734) [-1762.862] (-1766.363) -- 0:00:51

      Average standard deviation of split frequencies: 0.019871

      225500 -- (-1763.551) [-1766.822] (-1764.828) (-1762.410) * (-1762.726) (-1765.855) (-1762.825) [-1763.542] -- 0:00:51
      226000 -- (-1764.219) (-1765.742) (-1763.206) [-1763.123] * [-1763.163] (-1764.563) (-1762.433) (-1764.638) -- 0:00:51
      226500 -- (-1762.461) [-1763.643] (-1763.149) (-1764.519) * (-1763.453) (-1764.428) [-1762.564] (-1763.666) -- 0:00:51
      227000 -- (-1762.519) (-1764.862) (-1764.883) [-1767.377] * (-1765.955) [-1762.859] (-1762.159) (-1763.266) -- 0:00:51
      227500 -- [-1762.869] (-1765.414) (-1763.394) (-1766.620) * (-1765.944) (-1763.343) (-1762.914) [-1763.317] -- 0:00:50
      228000 -- (-1764.926) (-1768.090) [-1764.572] (-1765.829) * (-1765.511) (-1766.146) [-1762.506] (-1764.326) -- 0:00:50
      228500 -- (-1764.073) (-1772.020) (-1765.257) [-1766.379] * [-1764.007] (-1764.822) (-1763.477) (-1763.181) -- 0:00:50
      229000 -- (-1765.610) [-1767.251] (-1763.906) (-1764.071) * [-1764.101] (-1764.837) (-1763.541) (-1764.171) -- 0:00:50
      229500 -- (-1766.387) (-1767.287) (-1763.434) [-1764.044] * (-1769.914) (-1764.108) [-1763.213] (-1765.132) -- 0:00:50
      230000 -- (-1765.923) (-1772.052) [-1763.829] (-1764.499) * (-1770.325) (-1765.213) (-1763.591) [-1765.227] -- 0:00:50

      Average standard deviation of split frequencies: 0.016590

      230500 -- [-1766.188] (-1764.990) (-1763.827) (-1765.869) * [-1762.904] (-1766.137) (-1763.885) (-1770.763) -- 0:00:53
      231000 -- (-1764.748) (-1767.563) (-1763.624) [-1765.243] * [-1762.883] (-1766.202) (-1763.642) (-1765.106) -- 0:00:53
      231500 -- (-1765.353) (-1770.150) (-1763.876) [-1763.167] * [-1763.100] (-1763.521) (-1763.911) (-1766.531) -- 0:00:53
      232000 -- (-1763.618) (-1767.100) (-1764.036) [-1765.154] * [-1763.173] (-1763.911) (-1763.771) (-1764.844) -- 0:00:52
      232500 -- [-1764.116] (-1764.578) (-1763.747) (-1764.084) * (-1764.572) (-1762.689) (-1762.711) [-1764.219] -- 0:00:52
      233000 -- (-1765.044) [-1762.654] (-1763.143) (-1764.932) * (-1764.368) [-1763.067] (-1766.112) (-1762.834) -- 0:00:52
      233500 -- (-1763.699) [-1764.028] (-1763.009) (-1764.972) * (-1766.465) [-1763.104] (-1763.473) (-1764.259) -- 0:00:52
      234000 -- [-1762.028] (-1766.709) (-1763.009) (-1762.726) * (-1765.958) (-1763.069) [-1765.581] (-1765.308) -- 0:00:52
      234500 -- (-1762.246) (-1765.972) [-1765.389] (-1763.516) * (-1767.985) (-1763.069) [-1762.983] (-1766.102) -- 0:00:52
      235000 -- (-1765.859) (-1763.224) [-1764.637] (-1763.833) * (-1768.729) (-1763.069) [-1762.591] (-1767.329) -- 0:00:52

      Average standard deviation of split frequencies: 0.017478

      235500 -- (-1768.170) (-1764.406) [-1764.512] (-1763.586) * [-1769.606] (-1763.246) (-1764.714) (-1765.104) -- 0:00:51
      236000 -- (-1767.170) (-1763.870) (-1764.968) [-1763.145] * (-1770.172) [-1763.246] (-1762.923) (-1767.868) -- 0:00:51
      236500 -- (-1768.470) (-1765.025) (-1762.896) [-1763.087] * (-1767.850) (-1764.005) [-1763.130] (-1765.831) -- 0:00:51
      237000 -- (-1764.884) [-1763.445] (-1762.921) (-1763.435) * (-1767.467) (-1764.939) [-1763.540] (-1767.922) -- 0:00:51
      237500 -- (-1766.495) (-1764.076) (-1762.535) [-1763.375] * [-1763.387] (-1763.365) (-1764.143) (-1766.491) -- 0:00:51
      238000 -- (-1762.592) (-1764.773) [-1762.989] (-1763.391) * (-1764.422) [-1763.269] (-1764.725) (-1765.335) -- 0:00:51
      238500 -- (-1764.195) [-1764.188] (-1764.087) (-1763.044) * (-1764.421) [-1762.194] (-1763.094) (-1765.082) -- 0:00:51
      239000 -- [-1764.140] (-1766.624) (-1765.811) (-1766.165) * [-1762.756] (-1762.636) (-1769.026) (-1766.476) -- 0:00:50
      239500 -- (-1766.729) (-1764.326) (-1763.375) [-1764.601] * [-1763.731] (-1764.813) (-1763.940) (-1762.956) -- 0:00:50
      240000 -- (-1766.135) (-1764.079) (-1766.041) [-1763.048] * (-1763.731) (-1765.471) (-1763.628) [-1763.617] -- 0:00:50

      Average standard deviation of split frequencies: 0.016016

      240500 -- (-1766.850) (-1763.138) (-1765.363) [-1766.392] * [-1762.351] (-1766.629) (-1763.026) (-1763.470) -- 0:00:50
      241000 -- (-1768.951) [-1762.897] (-1764.705) (-1772.336) * (-1766.387) (-1765.881) [-1764.518] (-1769.716) -- 0:00:50
      241500 -- (-1764.011) (-1762.706) (-1762.699) [-1764.185] * (-1768.373) [-1771.808] (-1763.806) (-1766.417) -- 0:00:50
      242000 -- (-1764.245) (-1762.726) [-1762.593] (-1765.015) * (-1763.330) (-1765.916) (-1764.990) [-1765.578] -- 0:00:50
      242500 -- [-1765.290] (-1762.858) (-1763.653) (-1765.629) * (-1762.710) (-1764.550) [-1764.274] (-1764.686) -- 0:00:49
      243000 -- [-1765.514] (-1763.475) (-1763.680) (-1765.231) * [-1765.500] (-1766.930) (-1763.578) (-1764.905) -- 0:00:49
      243500 -- (-1763.159) [-1762.936] (-1767.431) (-1763.953) * [-1763.709] (-1764.760) (-1765.455) (-1765.904) -- 0:00:49
      244000 -- (-1763.984) (-1764.422) (-1763.869) [-1763.526] * (-1765.932) (-1766.453) [-1766.121] (-1768.460) -- 0:00:49
      244500 -- [-1765.867] (-1763.197) (-1763.922) (-1763.625) * (-1763.944) (-1766.758) [-1763.738] (-1763.753) -- 0:00:49
      245000 -- (-1763.622) (-1763.474) [-1770.081] (-1767.048) * [-1766.667] (-1765.421) (-1762.683) (-1763.609) -- 0:00:49

      Average standard deviation of split frequencies: 0.015330

      245500 -- (-1764.106) (-1764.588) (-1763.526) [-1763.662] * [-1763.853] (-1765.166) (-1763.489) (-1764.794) -- 0:00:49
      246000 -- (-1763.184) (-1763.563) [-1763.413] (-1766.192) * [-1763.570] (-1765.190) (-1765.412) (-1764.527) -- 0:00:52
      246500 -- [-1762.398] (-1762.313) (-1765.631) (-1768.849) * (-1765.034) (-1763.439) (-1764.056) [-1764.331] -- 0:00:51
      247000 -- [-1763.145] (-1762.250) (-1765.700) (-1764.096) * (-1763.843) (-1764.635) (-1771.482) [-1766.300] -- 0:00:51
      247500 -- (-1763.509) (-1770.270) [-1765.810] (-1765.992) * (-1763.770) (-1764.396) [-1769.131] (-1768.301) -- 0:00:51
      248000 -- (-1764.120) (-1763.121) [-1765.490] (-1767.201) * (-1763.506) (-1767.565) (-1775.209) [-1764.414] -- 0:00:51
      248500 -- (-1763.843) [-1762.581] (-1765.371) (-1771.047) * [-1764.455] (-1766.197) (-1769.329) (-1764.319) -- 0:00:51
      249000 -- [-1764.728] (-1762.090) (-1765.134) (-1763.927) * (-1763.309) [-1763.898] (-1763.572) (-1762.990) -- 0:00:51
      249500 -- (-1764.237) (-1762.221) [-1765.873] (-1768.219) * (-1763.251) (-1765.547) [-1763.210] (-1762.979) -- 0:00:51
      250000 -- [-1763.167] (-1762.388) (-1764.090) (-1764.320) * (-1763.277) (-1765.210) (-1765.047) [-1762.792] -- 0:00:51

      Average standard deviation of split frequencies: 0.016262

      250500 -- (-1765.655) (-1763.453) (-1763.446) [-1763.099] * (-1763.291) [-1763.946] (-1767.009) (-1764.077) -- 0:00:50
      251000 -- (-1766.144) (-1763.372) [-1763.457] (-1763.099) * (-1764.228) [-1763.738] (-1766.430) (-1762.446) -- 0:00:50
      251500 -- (-1766.051) (-1764.007) [-1763.976] (-1764.865) * [-1763.509] (-1764.569) (-1763.941) (-1765.257) -- 0:00:50
      252000 -- (-1766.004) (-1766.367) [-1765.948] (-1763.213) * (-1764.774) (-1765.830) [-1765.234] (-1764.563) -- 0:00:50
      252500 -- [-1768.415] (-1766.856) (-1763.149) (-1763.482) * [-1765.562] (-1766.048) (-1763.932) (-1765.983) -- 0:00:50
      253000 -- (-1765.663) [-1764.280] (-1764.482) (-1762.242) * (-1762.745) (-1765.742) [-1764.519] (-1766.562) -- 0:00:50
      253500 -- (-1764.192) (-1764.608) [-1765.245] (-1762.228) * (-1764.465) (-1765.372) [-1763.445] (-1766.064) -- 0:00:50
      254000 -- (-1764.591) (-1769.383) [-1764.188] (-1763.969) * (-1765.530) (-1762.679) [-1763.292] (-1765.293) -- 0:00:49
      254500 -- [-1765.176] (-1763.599) (-1764.877) (-1762.329) * [-1765.669] (-1762.548) (-1764.586) (-1764.506) -- 0:00:49
      255000 -- [-1763.522] (-1763.331) (-1765.929) (-1762.882) * [-1763.474] (-1762.558) (-1764.889) (-1763.409) -- 0:00:49

      Average standard deviation of split frequencies: 0.016471

      255500 -- (-1763.059) [-1763.714] (-1763.453) (-1762.637) * (-1765.999) (-1762.124) (-1762.829) [-1763.542] -- 0:00:49
      256000 -- (-1764.661) [-1768.648] (-1763.758) (-1763.088) * (-1766.397) (-1764.627) [-1763.340] (-1764.256) -- 0:00:49
      256500 -- [-1765.466] (-1766.726) (-1764.005) (-1763.819) * (-1766.548) [-1765.265] (-1764.038) (-1764.969) -- 0:00:49
      257000 -- (-1764.129) (-1763.974) (-1763.248) [-1762.881] * (-1771.566) (-1765.302) (-1764.842) [-1763.218] -- 0:00:49
      257500 -- (-1765.344) (-1765.891) (-1764.529) [-1763.089] * [-1768.841] (-1763.559) (-1763.305) (-1763.878) -- 0:00:49
      258000 -- (-1765.624) (-1769.442) (-1766.392) [-1762.848] * (-1771.839) (-1767.248) [-1763.414] (-1765.820) -- 0:00:48
      258500 -- (-1765.123) (-1763.019) [-1763.807] (-1762.219) * (-1767.439) [-1766.590] (-1762.971) (-1766.324) -- 0:00:48
      259000 -- (-1762.807) [-1765.419] (-1763.511) (-1766.368) * (-1763.333) [-1764.014] (-1763.223) (-1764.004) -- 0:00:48
      259500 -- (-1764.298) (-1762.222) [-1763.276] (-1762.092) * [-1763.394] (-1765.455) (-1763.662) (-1765.184) -- 0:00:48
      260000 -- [-1764.100] (-1762.414) (-1764.382) (-1764.001) * (-1763.931) (-1763.876) (-1763.422) [-1764.998] -- 0:00:48

      Average standard deviation of split frequencies: 0.015851

      260500 -- (-1763.441) [-1762.859] (-1764.520) (-1762.929) * (-1762.740) (-1763.936) (-1764.712) [-1766.514] -- 0:00:48
      261000 -- (-1765.158) (-1763.262) (-1764.889) [-1762.580] * (-1763.025) [-1762.653] (-1762.460) (-1767.015) -- 0:00:48
      261500 -- (-1762.907) (-1763.694) (-1766.302) [-1762.122] * (-1763.440) [-1763.823] (-1763.196) (-1764.832) -- 0:00:50
      262000 -- (-1763.726) [-1764.378] (-1764.825) (-1763.222) * (-1764.544) (-1764.935) (-1765.348) [-1762.673] -- 0:00:50
      262500 -- [-1766.501] (-1765.538) (-1762.714) (-1763.060) * [-1764.254] (-1769.089) (-1765.769) (-1766.855) -- 0:00:50
      263000 -- [-1766.300] (-1766.353) (-1766.511) (-1765.011) * [-1764.098] (-1768.073) (-1764.461) (-1764.458) -- 0:00:50
      263500 -- (-1768.002) [-1770.186] (-1764.697) (-1765.026) * (-1764.429) (-1765.024) [-1765.925] (-1763.730) -- 0:00:50
      264000 -- (-1764.495) [-1767.375] (-1763.137) (-1767.415) * (-1766.622) (-1768.244) [-1764.493] (-1765.662) -- 0:00:50
      264500 -- (-1763.937) (-1766.623) (-1765.376) [-1765.789] * (-1765.234) [-1764.873] (-1765.713) (-1763.942) -- 0:00:50
      265000 -- [-1763.762] (-1766.108) (-1765.267) (-1766.156) * [-1765.489] (-1766.858) (-1765.398) (-1763.996) -- 0:00:49

      Average standard deviation of split frequencies: 0.016048

      265500 -- (-1765.263) (-1763.921) [-1764.916] (-1764.007) * (-1763.411) [-1763.221] (-1768.159) (-1765.562) -- 0:00:49
      266000 -- (-1765.287) [-1762.364] (-1763.054) (-1762.565) * [-1763.555] (-1765.361) (-1765.098) (-1764.252) -- 0:00:49
      266500 -- [-1763.811] (-1765.335) (-1765.888) (-1764.983) * (-1762.447) (-1766.137) [-1764.836] (-1766.677) -- 0:00:49
      267000 -- [-1764.008] (-1762.053) (-1769.227) (-1764.192) * (-1763.154) (-1767.272) [-1764.893] (-1764.894) -- 0:00:49
      267500 -- [-1763.307] (-1765.290) (-1767.418) (-1763.551) * (-1762.653) [-1764.857] (-1768.233) (-1762.371) -- 0:00:49
      268000 -- [-1765.506] (-1762.918) (-1777.809) (-1763.864) * [-1762.989] (-1764.474) (-1763.469) (-1763.195) -- 0:00:49
      268500 -- (-1765.727) (-1762.519) (-1767.211) [-1762.822] * (-1766.988) (-1765.534) (-1763.873) [-1763.324] -- 0:00:49
      269000 -- (-1766.206) (-1762.943) (-1763.342) [-1764.408] * [-1764.565] (-1767.135) (-1764.007) (-1764.956) -- 0:00:48
      269500 -- (-1767.210) (-1765.742) (-1763.273) [-1764.765] * [-1766.605] (-1765.590) (-1763.030) (-1763.442) -- 0:00:48
      270000 -- (-1764.550) (-1765.973) [-1763.387] (-1763.315) * [-1765.936] (-1770.319) (-1763.817) (-1764.835) -- 0:00:48

      Average standard deviation of split frequencies: 0.015868

      270500 -- (-1766.060) (-1764.444) (-1763.364) [-1764.282] * (-1766.234) [-1766.195] (-1763.816) (-1763.468) -- 0:00:48
      271000 -- (-1768.262) (-1763.921) (-1762.932) [-1763.527] * (-1764.255) (-1762.407) (-1765.839) [-1765.318] -- 0:00:48
      271500 -- (-1764.011) (-1765.287) [-1762.567] (-1769.146) * (-1762.364) [-1762.387] (-1763.561) (-1764.605) -- 0:00:48
      272000 -- (-1764.116) (-1765.021) [-1762.865] (-1764.114) * [-1763.485] (-1762.503) (-1763.149) (-1764.286) -- 0:00:48
      272500 -- (-1763.661) (-1764.927) (-1763.956) [-1766.679] * (-1763.479) [-1765.153] (-1770.539) (-1765.876) -- 0:00:48
      273000 -- [-1762.971] (-1764.164) (-1763.653) (-1764.650) * (-1764.676) [-1766.065] (-1766.484) (-1765.876) -- 0:00:47
      273500 -- (-1762.665) [-1763.752] (-1768.541) (-1764.988) * (-1768.072) (-1766.065) (-1763.253) [-1766.135] -- 0:00:47
      274000 -- (-1762.870) [-1766.499] (-1763.914) (-1763.338) * (-1765.702) (-1765.255) (-1763.079) [-1765.937] -- 0:00:47
      274500 -- (-1762.938) [-1764.141] (-1764.302) (-1771.312) * (-1765.656) (-1764.644) [-1763.020] (-1768.443) -- 0:00:47
      275000 -- [-1763.259] (-1765.005) (-1765.622) (-1764.629) * (-1764.771) (-1765.749) [-1763.028] (-1766.711) -- 0:00:47

      Average standard deviation of split frequencies: 0.014468

      275500 -- [-1763.089] (-1763.409) (-1764.591) (-1768.772) * (-1765.187) (-1765.020) [-1766.645] (-1767.301) -- 0:00:47
      276000 -- (-1765.372) (-1763.464) [-1763.494] (-1766.359) * [-1764.142] (-1763.906) (-1762.856) (-1766.782) -- 0:00:47
      276500 -- (-1762.774) (-1763.883) [-1764.429] (-1766.601) * (-1764.099) [-1763.907] (-1765.549) (-1765.831) -- 0:00:47
      277000 -- (-1767.170) [-1763.707] (-1763.556) (-1763.822) * [-1763.570] (-1764.865) (-1763.821) (-1769.311) -- 0:00:49
      277500 -- (-1763.244) (-1767.367) [-1763.565] (-1765.766) * (-1763.440) (-1764.146) (-1764.753) [-1764.336] -- 0:00:49
      278000 -- [-1765.243] (-1767.091) (-1767.290) (-1765.320) * (-1766.381) (-1764.309) (-1764.627) [-1765.846] -- 0:00:49
      278500 -- [-1764.438] (-1765.205) (-1764.094) (-1764.886) * (-1763.998) [-1763.039] (-1762.653) (-1763.780) -- 0:00:49
      279000 -- (-1762.158) (-1762.374) (-1765.748) [-1767.809] * (-1764.349) (-1764.176) (-1762.588) [-1762.572] -- 0:00:49
      279500 -- [-1764.022] (-1762.126) (-1766.254) (-1766.493) * (-1765.938) (-1767.277) [-1762.583] (-1762.871) -- 0:00:48
      280000 -- (-1765.328) [-1762.126] (-1765.407) (-1766.477) * (-1764.317) (-1766.953) (-1765.005) [-1763.104] -- 0:00:48

      Average standard deviation of split frequencies: 0.014801

      280500 -- (-1764.402) [-1762.494] (-1765.984) (-1765.044) * [-1766.341] (-1763.928) (-1763.853) (-1763.002) -- 0:00:48
      281000 -- (-1766.002) [-1762.495] (-1769.011) (-1768.678) * [-1766.220] (-1762.934) (-1763.751) (-1763.397) -- 0:00:48
      281500 -- (-1765.305) (-1762.214) (-1765.537) [-1763.571] * (-1766.960) (-1765.449) [-1764.387] (-1766.345) -- 0:00:48
      282000 -- (-1762.744) (-1762.086) (-1765.706) [-1763.631] * [-1769.166] (-1764.186) (-1765.659) (-1765.112) -- 0:00:48
      282500 -- (-1763.797) (-1762.507) [-1767.765] (-1768.681) * [-1769.635] (-1767.150) (-1767.607) (-1762.519) -- 0:00:48
      283000 -- [-1763.823] (-1762.987) (-1769.346) (-1762.747) * (-1768.599) (-1767.372) [-1764.272] (-1763.263) -- 0:00:48
      283500 -- [-1762.998] (-1762.988) (-1764.559) (-1765.021) * (-1768.775) (-1768.991) (-1763.823) [-1762.969] -- 0:00:48
      284000 -- [-1762.999] (-1762.706) (-1763.104) (-1764.945) * [-1765.439] (-1768.234) (-1764.148) (-1764.011) -- 0:00:47
      284500 -- [-1764.764] (-1762.885) (-1763.955) (-1766.872) * (-1765.310) (-1770.441) [-1765.950] (-1762.475) -- 0:00:47
      285000 -- (-1767.191) (-1762.880) [-1762.856] (-1763.853) * (-1765.162) (-1765.662) [-1764.485] (-1762.977) -- 0:00:47

      Average standard deviation of split frequencies: 0.014059

      285500 -- (-1768.559) [-1762.401] (-1763.682) (-1763.919) * [-1764.258] (-1763.926) (-1769.083) (-1764.255) -- 0:00:47
      286000 -- (-1767.035) [-1763.480] (-1767.013) (-1763.543) * (-1765.594) (-1762.937) (-1763.660) [-1766.508] -- 0:00:47
      286500 -- (-1767.398) [-1763.757] (-1762.635) (-1763.505) * [-1762.254] (-1762.922) (-1767.282) (-1766.864) -- 0:00:47
      287000 -- (-1765.833) [-1764.898] (-1762.698) (-1765.283) * (-1766.230) (-1765.677) (-1766.510) [-1763.318] -- 0:00:47
      287500 -- (-1766.749) (-1766.437) [-1762.887] (-1763.647) * (-1765.516) [-1766.319] (-1765.613) (-1763.947) -- 0:00:47
      288000 -- (-1767.573) [-1764.398] (-1763.724) (-1764.461) * (-1765.708) [-1764.905] (-1762.715) (-1763.498) -- 0:00:46
      288500 -- (-1764.071) [-1765.851] (-1763.164) (-1762.491) * (-1766.896) (-1766.165) (-1762.847) [-1764.514] -- 0:00:46
      289000 -- (-1765.408) (-1764.177) (-1765.466) [-1762.861] * (-1767.532) (-1762.781) (-1762.712) [-1762.825] -- 0:00:46
      289500 -- (-1765.383) [-1762.156] (-1765.015) (-1764.635) * (-1770.975) (-1763.147) [-1764.234] (-1762.528) -- 0:00:46
      290000 -- (-1765.487) (-1762.322) [-1763.156] (-1766.215) * (-1766.266) (-1769.588) [-1762.428] (-1763.239) -- 0:00:46

      Average standard deviation of split frequencies: 0.013887

      290500 -- [-1762.798] (-1763.799) (-1763.246) (-1764.971) * (-1766.468) (-1764.426) [-1762.837] (-1763.537) -- 0:00:46
      291000 -- [-1763.180] (-1763.815) (-1762.875) (-1762.705) * [-1763.560] (-1762.924) (-1762.345) (-1765.347) -- 0:00:46
      291500 -- (-1762.850) (-1764.431) [-1762.512] (-1762.733) * (-1762.773) [-1768.725] (-1766.188) (-1765.295) -- 0:00:46
      292000 -- (-1763.437) (-1765.270) [-1764.618] (-1762.776) * (-1763.856) (-1768.045) [-1766.609] (-1764.044) -- 0:00:46
      292500 -- (-1763.486) (-1762.712) [-1764.774] (-1765.195) * (-1763.291) [-1763.008] (-1762.236) (-1764.895) -- 0:00:48
      293000 -- [-1762.235] (-1763.483) (-1765.345) (-1764.579) * (-1763.473) [-1763.738] (-1762.569) (-1766.047) -- 0:00:48
      293500 -- (-1763.112) (-1763.396) (-1767.002) [-1764.479] * [-1763.607] (-1763.819) (-1762.560) (-1765.147) -- 0:00:48
      294000 -- (-1763.112) (-1764.225) [-1764.754] (-1765.275) * (-1763.881) [-1765.939] (-1762.608) (-1766.323) -- 0:00:48
      294500 -- (-1763.760) (-1764.224) (-1765.842) [-1765.170] * [-1771.023] (-1762.592) (-1764.235) (-1764.136) -- 0:00:47
      295000 -- (-1762.471) (-1764.457) [-1765.060] (-1764.659) * [-1764.608] (-1762.592) (-1766.109) (-1766.586) -- 0:00:47

      Average standard deviation of split frequencies: 0.013338

      295500 -- (-1762.248) [-1763.416] (-1768.326) (-1765.405) * (-1771.575) (-1763.720) (-1762.672) [-1765.139] -- 0:00:47
      296000 -- (-1762.248) [-1763.402] (-1764.829) (-1765.198) * (-1766.531) [-1769.897] (-1763.794) (-1763.851) -- 0:00:47
      296500 -- (-1763.046) (-1763.401) (-1764.533) [-1762.106] * (-1763.893) [-1763.377] (-1766.650) (-1763.915) -- 0:00:47
      297000 -- (-1764.504) [-1764.342] (-1766.801) (-1764.200) * (-1763.996) [-1764.379] (-1766.617) (-1765.197) -- 0:00:47
      297500 -- [-1763.874] (-1762.854) (-1765.452) (-1765.317) * (-1765.595) (-1765.125) (-1764.648) [-1766.134] -- 0:00:47
      298000 -- (-1763.233) (-1762.686) [-1764.583] (-1764.517) * [-1765.680] (-1765.070) (-1762.703) (-1767.070) -- 0:00:47
      298500 -- (-1766.350) (-1762.792) [-1764.003] (-1766.312) * [-1766.321] (-1765.350) (-1766.096) (-1763.870) -- 0:00:47
      299000 -- (-1771.540) [-1768.098] (-1766.361) (-1764.607) * [-1762.883] (-1767.253) (-1764.589) (-1763.422) -- 0:00:46
      299500 -- (-1762.693) [-1764.812] (-1763.588) (-1764.011) * (-1762.288) (-1767.986) [-1765.080] (-1765.208) -- 0:00:46
      300000 -- (-1762.859) (-1766.460) (-1763.622) [-1768.648] * (-1763.907) (-1766.131) [-1768.577] (-1767.928) -- 0:00:46

      Average standard deviation of split frequencies: 0.012249

      300500 -- (-1763.980) (-1769.971) (-1762.669) [-1768.208] * (-1763.005) (-1765.758) [-1765.269] (-1765.658) -- 0:00:46
      301000 -- (-1763.278) (-1764.724) [-1764.693] (-1767.631) * [-1763.120] (-1766.503) (-1763.056) (-1763.727) -- 0:00:46
      301500 -- (-1764.454) (-1763.786) [-1765.646] (-1763.543) * (-1766.696) (-1767.783) (-1763.270) [-1764.288] -- 0:00:46
      302000 -- (-1763.869) [-1764.420] (-1763.902) (-1762.881) * (-1762.938) (-1763.883) [-1766.142] (-1763.216) -- 0:00:46
      302500 -- [-1762.702] (-1765.484) (-1763.428) (-1762.945) * (-1763.276) (-1763.883) [-1765.040] (-1763.128) -- 0:00:46
      303000 -- (-1764.198) (-1766.161) [-1763.442] (-1764.818) * (-1764.024) (-1765.573) (-1765.304) [-1768.175] -- 0:00:46
      303500 -- (-1767.081) (-1768.551) (-1766.094) [-1763.798] * (-1765.561) [-1763.484] (-1762.097) (-1765.349) -- 0:00:45
      304000 -- [-1762.962] (-1770.660) (-1763.211) (-1763.600) * [-1767.061] (-1762.132) (-1762.736) (-1764.544) -- 0:00:45
      304500 -- [-1763.737] (-1766.704) (-1765.038) (-1764.662) * [-1764.331] (-1762.993) (-1763.236) (-1764.207) -- 0:00:45
      305000 -- (-1765.866) [-1767.221] (-1766.045) (-1764.576) * (-1766.461) (-1762.758) (-1762.166) [-1766.203] -- 0:00:45

      Average standard deviation of split frequencies: 0.012324

      305500 -- (-1764.991) (-1768.121) [-1763.899] (-1763.355) * (-1767.403) (-1766.546) [-1762.453] (-1764.216) -- 0:00:45
      306000 -- (-1765.707) (-1768.132) [-1763.339] (-1767.151) * (-1765.070) [-1763.951] (-1762.953) (-1763.230) -- 0:00:45
      306500 -- (-1764.845) [-1764.351] (-1762.684) (-1767.317) * (-1766.678) (-1762.374) (-1768.227) [-1762.410] -- 0:00:45
      307000 -- [-1763.601] (-1764.952) (-1764.903) (-1765.962) * [-1763.527] (-1762.596) (-1770.397) (-1763.050) -- 0:00:45
      307500 -- (-1763.475) (-1762.798) [-1763.027] (-1762.945) * (-1765.725) (-1767.463) (-1768.958) [-1763.870] -- 0:00:45
      308000 -- (-1767.116) (-1763.663) [-1766.741] (-1763.038) * (-1762.827) (-1763.778) (-1767.600) [-1762.993] -- 0:00:47
      308500 -- (-1765.155) (-1762.797) (-1768.298) [-1764.623] * (-1765.364) [-1763.860] (-1766.463) (-1764.861) -- 0:00:47
      309000 -- (-1766.055) (-1764.142) [-1767.147] (-1763.248) * (-1763.256) (-1765.248) [-1763.413] (-1764.887) -- 0:00:46
      309500 -- (-1766.860) (-1763.204) [-1766.965] (-1762.446) * [-1764.062] (-1766.191) (-1764.454) (-1763.672) -- 0:00:46
      310000 -- [-1763.959] (-1762.697) (-1764.807) (-1763.085) * (-1763.151) (-1767.969) [-1764.310] (-1763.542) -- 0:00:46

      Average standard deviation of split frequencies: 0.012853

      310500 -- (-1762.245) (-1764.812) (-1767.333) [-1763.726] * [-1763.086] (-1772.146) (-1764.589) (-1764.692) -- 0:00:46
      311000 -- [-1762.328] (-1767.258) (-1766.590) (-1764.180) * (-1770.242) [-1767.442] (-1763.716) (-1765.802) -- 0:00:46
      311500 -- (-1765.351) (-1768.537) (-1762.707) [-1763.200] * (-1767.304) [-1764.294] (-1763.530) (-1769.452) -- 0:00:46
      312000 -- (-1763.714) [-1764.489] (-1765.362) (-1763.703) * (-1764.697) [-1763.882] (-1764.381) (-1769.854) -- 0:00:46
      312500 -- (-1763.779) (-1766.712) (-1764.313) [-1763.285] * (-1766.326) [-1763.642] (-1765.214) (-1766.454) -- 0:00:46
      313000 -- (-1763.878) (-1766.616) (-1763.639) [-1764.870] * (-1764.448) (-1763.117) [-1767.493] (-1764.322) -- 0:00:46
      313500 -- (-1765.907) (-1767.831) [-1763.117] (-1765.036) * [-1763.834] (-1762.241) (-1766.520) (-1764.529) -- 0:00:45
      314000 -- (-1765.277) [-1764.424] (-1762.909) (-1764.449) * [-1764.985] (-1762.242) (-1763.207) (-1766.255) -- 0:00:45
      314500 -- (-1765.051) [-1763.067] (-1764.621) (-1764.281) * (-1764.362) [-1764.101] (-1763.198) (-1765.551) -- 0:00:45
      315000 -- (-1765.080) (-1765.986) [-1765.275] (-1766.142) * (-1766.517) (-1764.236) [-1764.313] (-1767.994) -- 0:00:45

      Average standard deviation of split frequencies: 0.013075

      315500 -- [-1766.756] (-1766.035) (-1767.241) (-1764.428) * [-1765.543] (-1765.575) (-1762.295) (-1765.878) -- 0:00:45
      316000 -- [-1766.985] (-1766.718) (-1767.124) (-1762.660) * [-1764.436] (-1764.562) (-1762.302) (-1764.706) -- 0:00:45
      316500 -- (-1768.442) (-1765.605) [-1767.322] (-1766.604) * (-1766.903) (-1763.233) (-1763.089) [-1764.766] -- 0:00:45
      317000 -- (-1765.643) [-1771.453] (-1764.489) (-1767.173) * (-1768.034) [-1762.561] (-1763.032) (-1764.715) -- 0:00:45
      317500 -- (-1769.397) [-1768.236] (-1762.394) (-1765.824) * [-1764.004] (-1763.619) (-1762.596) (-1765.551) -- 0:00:45
      318000 -- (-1771.492) [-1766.808] (-1763.571) (-1768.612) * (-1763.476) (-1763.415) [-1763.391] (-1764.052) -- 0:00:45
      318500 -- (-1765.551) [-1766.125] (-1763.931) (-1764.998) * (-1768.294) [-1764.069] (-1764.188) (-1762.160) -- 0:00:44
      319000 -- (-1766.511) [-1762.930] (-1767.716) (-1764.971) * (-1765.116) (-1762.447) (-1764.529) [-1768.178] -- 0:00:44
      319500 -- [-1764.887] (-1765.582) (-1763.463) (-1765.287) * (-1764.717) [-1763.361] (-1763.623) (-1772.190) -- 0:00:44
      320000 -- (-1764.829) (-1763.461) (-1766.454) [-1764.297] * [-1769.173] (-1765.548) (-1766.395) (-1777.988) -- 0:00:44

      Average standard deviation of split frequencies: 0.013490

      320500 -- [-1764.018] (-1764.405) (-1765.308) (-1763.659) * [-1763.869] (-1768.799) (-1768.594) (-1762.661) -- 0:00:44
      321000 -- [-1766.935] (-1768.231) (-1763.585) (-1764.571) * (-1762.915) (-1769.256) (-1767.203) [-1767.312] -- 0:00:44
      321500 -- (-1764.377) (-1766.667) (-1763.852) [-1763.575] * (-1763.057) (-1766.470) [-1766.127] (-1762.757) -- 0:00:44
      322000 -- (-1764.089) [-1764.284] (-1762.307) (-1764.760) * [-1763.117] (-1764.787) (-1766.157) (-1765.609) -- 0:00:44
      322500 -- (-1765.354) (-1764.658) (-1767.254) [-1764.400] * (-1767.268) (-1764.738) [-1764.427] (-1765.183) -- 0:00:44
      323000 -- (-1764.141) (-1764.088) [-1763.253] (-1765.558) * (-1764.981) (-1763.528) [-1764.376] (-1764.572) -- 0:00:44
      323500 -- (-1763.249) (-1764.372) (-1773.730) [-1763.300] * (-1767.566) [-1763.431] (-1765.495) (-1765.699) -- 0:00:46
      324000 -- (-1763.509) [-1763.546] (-1763.519) (-1763.425) * (-1768.652) [-1762.801] (-1766.257) (-1765.704) -- 0:00:45
      324500 -- (-1763.445) (-1763.136) [-1773.256] (-1763.107) * (-1766.848) [-1763.990] (-1765.347) (-1762.592) -- 0:00:45
      325000 -- [-1766.819] (-1763.746) (-1768.082) (-1763.602) * [-1764.295] (-1763.785) (-1764.517) (-1763.227) -- 0:00:45

      Average standard deviation of split frequencies: 0.012532

      325500 -- (-1767.723) (-1764.970) (-1763.596) [-1763.783] * (-1768.288) [-1762.290] (-1770.204) (-1764.738) -- 0:00:45
      326000 -- (-1764.841) (-1764.142) [-1763.622] (-1764.000) * [-1764.607] (-1763.421) (-1767.492) (-1763.225) -- 0:00:45
      326500 -- (-1763.073) [-1764.790] (-1765.336) (-1765.405) * (-1769.912) [-1763.079] (-1764.285) (-1763.349) -- 0:00:45
      327000 -- [-1763.395] (-1767.040) (-1762.666) (-1764.837) * [-1765.912] (-1762.873) (-1766.770) (-1763.778) -- 0:00:45
      327500 -- (-1766.497) (-1765.594) (-1762.693) [-1765.428] * (-1763.841) [-1762.721] (-1768.272) (-1764.132) -- 0:00:45
      328000 -- (-1764.401) (-1762.789) (-1763.717) [-1764.453] * [-1762.979] (-1765.869) (-1764.705) (-1762.969) -- 0:00:45
      328500 -- (-1763.647) (-1762.352) [-1764.598] (-1767.669) * [-1763.713] (-1768.486) (-1766.110) (-1764.070) -- 0:00:44
      329000 -- (-1763.127) [-1762.322] (-1764.881) (-1764.884) * (-1765.624) (-1764.496) (-1765.912) [-1762.451] -- 0:00:44
      329500 -- (-1770.171) [-1766.848] (-1763.891) (-1764.728) * (-1763.486) [-1764.301] (-1763.534) (-1763.066) -- 0:00:44
      330000 -- (-1767.621) (-1763.805) [-1762.821] (-1764.958) * (-1764.336) [-1764.482] (-1766.502) (-1762.908) -- 0:00:44

      Average standard deviation of split frequencies: 0.013227

      330500 -- (-1769.628) [-1764.216] (-1762.424) (-1769.066) * (-1765.639) [-1764.440] (-1766.010) (-1763.231) -- 0:00:44
      331000 -- (-1766.034) [-1764.769] (-1763.739) (-1768.160) * (-1765.407) (-1764.858) [-1763.465] (-1762.447) -- 0:00:44
      331500 -- (-1766.461) [-1764.306] (-1765.032) (-1768.398) * [-1765.555] (-1763.730) (-1765.977) (-1763.796) -- 0:00:44
      332000 -- (-1765.766) (-1763.292) [-1764.198] (-1763.124) * (-1763.245) (-1763.945) (-1767.754) [-1767.374] -- 0:00:44
      332500 -- (-1767.318) (-1765.390) (-1763.766) [-1762.832] * (-1763.140) (-1763.946) (-1765.954) [-1765.229] -- 0:00:44
      333000 -- (-1764.547) [-1765.945] (-1763.550) (-1762.895) * (-1767.960) [-1764.446] (-1766.151) (-1764.463) -- 0:00:44
      333500 -- (-1764.819) [-1762.076] (-1764.203) (-1762.421) * (-1764.441) (-1764.447) [-1762.891] (-1765.265) -- 0:00:43
      334000 -- (-1763.620) (-1763.419) (-1765.315) [-1764.470] * (-1764.638) [-1767.785] (-1764.528) (-1762.628) -- 0:00:43
      334500 -- [-1765.856] (-1762.929) (-1766.564) (-1768.073) * (-1762.981) (-1768.894) (-1763.990) [-1762.725] -- 0:00:43
      335000 -- (-1764.741) [-1762.874] (-1766.473) (-1768.499) * (-1763.467) (-1767.793) (-1764.654) [-1763.020] -- 0:00:43

      Average standard deviation of split frequencies: 0.013874

      335500 -- (-1764.823) (-1764.536) [-1766.988] (-1767.024) * [-1764.265] (-1766.680) (-1764.839) (-1764.445) -- 0:00:43
      336000 -- (-1770.213) (-1764.731) (-1766.573) [-1762.560] * (-1763.683) (-1767.600) (-1764.421) [-1762.474] -- 0:00:43
      336500 -- (-1769.477) [-1765.012] (-1762.788) (-1762.601) * (-1763.727) (-1765.799) (-1764.168) [-1763.051] -- 0:00:43
      337000 -- (-1778.919) (-1764.371) [-1764.208] (-1763.239) * (-1763.388) (-1764.074) [-1761.989] (-1763.307) -- 0:00:43
      337500 -- (-1763.604) (-1765.025) [-1766.839] (-1765.290) * (-1765.073) (-1763.326) (-1761.969) [-1763.280] -- 0:00:43
      338000 -- (-1766.659) (-1764.387) [-1765.225] (-1765.432) * (-1765.823) (-1763.294) [-1763.810] (-1765.167) -- 0:00:43
      338500 -- (-1765.596) [-1764.139] (-1764.662) (-1764.051) * (-1765.530) [-1763.505] (-1762.626) (-1762.694) -- 0:00:42
      339000 -- (-1769.770) (-1765.358) [-1764.711] (-1763.892) * (-1769.570) [-1764.121] (-1764.214) (-1762.164) -- 0:00:44
      339500 -- [-1764.360] (-1765.631) (-1764.163) (-1763.100) * (-1771.196) (-1763.182) (-1765.456) [-1763.501] -- 0:00:44
      340000 -- (-1762.989) (-1766.254) (-1762.861) [-1763.580] * (-1774.229) [-1763.353] (-1766.798) (-1763.005) -- 0:00:44

      Average standard deviation of split frequencies: 0.013349

      340500 -- (-1763.096) (-1769.938) [-1763.784] (-1763.283) * (-1765.172) [-1762.950] (-1765.161) (-1762.490) -- 0:00:44
      341000 -- (-1764.826) (-1764.340) [-1762.798] (-1764.122) * (-1767.445) [-1762.947] (-1763.717) (-1763.275) -- 0:00:44
      341500 -- (-1762.812) [-1766.019] (-1762.917) (-1763.574) * (-1764.989) [-1763.341] (-1765.413) (-1766.583) -- 0:00:44
      342000 -- [-1762.523] (-1764.947) (-1762.676) (-1762.942) * (-1763.365) (-1762.889) [-1764.614] (-1764.237) -- 0:00:44
      342500 -- (-1764.028) [-1762.264] (-1764.048) (-1762.947) * (-1763.399) [-1763.508] (-1763.464) (-1763.886) -- 0:00:44
      343000 -- (-1766.181) [-1762.239] (-1766.066) (-1762.430) * [-1764.789] (-1763.453) (-1764.084) (-1766.232) -- 0:00:44
      343500 -- (-1763.154) [-1766.362] (-1765.713) (-1762.732) * (-1765.212) [-1762.455] (-1765.826) (-1765.078) -- 0:00:43
      344000 -- (-1763.902) (-1762.273) [-1762.656] (-1762.307) * (-1763.893) [-1765.381] (-1763.951) (-1762.101) -- 0:00:43
      344500 -- (-1763.620) (-1763.707) (-1763.072) [-1762.505] * (-1764.835) [-1763.720] (-1768.946) (-1764.529) -- 0:00:43
      345000 -- [-1764.984] (-1763.252) (-1765.299) (-1772.082) * [-1763.635] (-1763.764) (-1763.627) (-1764.853) -- 0:00:43

      Average standard deviation of split frequencies: 0.013705

      345500 -- (-1765.341) (-1764.691) [-1761.912] (-1764.449) * (-1763.759) (-1767.748) [-1762.298] (-1764.145) -- 0:00:43
      346000 -- (-1764.975) (-1764.741) [-1761.959] (-1763.358) * [-1763.444] (-1762.636) (-1766.859) (-1762.689) -- 0:00:43
      346500 -- [-1762.984] (-1763.631) (-1768.477) (-1762.643) * (-1763.444) (-1762.618) (-1765.443) [-1763.168] -- 0:00:43
      347000 -- (-1766.506) (-1764.399) (-1763.065) [-1762.582] * (-1763.280) (-1762.746) [-1766.300] (-1763.056) -- 0:00:43
      347500 -- (-1763.265) (-1763.397) (-1762.702) [-1762.583] * [-1762.732] (-1762.665) (-1763.243) (-1764.108) -- 0:00:43
      348000 -- (-1766.651) (-1762.433) (-1764.131) [-1763.105] * (-1764.296) (-1762.567) [-1766.405] (-1765.555) -- 0:00:43
      348500 -- (-1767.175) [-1762.433] (-1762.391) (-1762.774) * [-1762.550] (-1767.927) (-1764.566) (-1764.371) -- 0:00:42
      349000 -- (-1765.893) (-1762.768) [-1763.012] (-1763.071) * (-1762.555) (-1763.738) (-1763.309) [-1763.578] -- 0:00:42
      349500 -- (-1765.134) (-1762.655) (-1765.442) [-1762.954] * (-1763.202) (-1762.838) [-1763.133] (-1767.559) -- 0:00:42
      350000 -- (-1764.834) [-1762.652] (-1762.828) (-1762.798) * [-1763.786] (-1764.422) (-1767.067) (-1765.264) -- 0:00:42

      Average standard deviation of split frequencies: 0.013048

      350500 -- [-1763.985] (-1763.087) (-1762.188) (-1765.358) * [-1767.394] (-1764.927) (-1765.715) (-1764.942) -- 0:00:42
      351000 -- (-1763.383) (-1764.845) (-1764.765) [-1763.099] * (-1768.742) [-1765.243] (-1764.867) (-1767.649) -- 0:00:42
      351500 -- (-1762.102) [-1763.858] (-1762.819) (-1766.686) * (-1766.255) (-1763.417) [-1766.227] (-1766.206) -- 0:00:42
      352000 -- (-1764.742) (-1765.498) (-1762.893) [-1769.020] * (-1765.360) [-1766.082] (-1766.740) (-1764.989) -- 0:00:42
      352500 -- [-1764.079] (-1763.934) (-1762.848) (-1764.347) * [-1767.144] (-1763.255) (-1768.239) (-1765.772) -- 0:00:42
      353000 -- (-1762.865) (-1765.821) [-1765.343] (-1764.033) * (-1766.474) [-1764.604] (-1765.008) (-1763.296) -- 0:00:42
      353500 -- (-1763.917) (-1765.441) (-1763.060) [-1763.541] * (-1769.337) (-1765.887) (-1763.419) [-1764.288] -- 0:00:42
      354000 -- (-1763.392) [-1765.276] (-1763.252) (-1763.006) * (-1763.640) (-1763.663) [-1764.805] (-1763.815) -- 0:00:41
      354500 -- (-1764.872) (-1763.239) [-1763.252] (-1763.015) * (-1765.106) [-1766.500] (-1763.414) (-1763.940) -- 0:00:43
      355000 -- (-1763.849) [-1768.240] (-1764.062) (-1762.399) * (-1762.467) (-1766.762) [-1765.665] (-1762.038) -- 0:00:43

      Average standard deviation of split frequencies: 0.012359

      355500 -- (-1763.424) [-1763.670] (-1764.994) (-1762.500) * (-1767.967) (-1767.720) (-1766.308) [-1762.744] -- 0:00:43
      356000 -- [-1763.507] (-1764.130) (-1763.326) (-1764.864) * [-1766.749] (-1763.300) (-1767.011) (-1766.008) -- 0:00:43
      356500 -- (-1765.536) (-1769.840) (-1765.072) [-1762.846] * (-1765.190) [-1764.555] (-1765.496) (-1763.570) -- 0:00:43
      357000 -- [-1764.723] (-1778.894) (-1764.181) (-1763.763) * (-1766.184) [-1763.682] (-1764.140) (-1762.502) -- 0:00:43
      357500 -- (-1765.056) (-1762.820) [-1764.207] (-1762.429) * (-1764.762) (-1766.807) [-1765.796] (-1763.545) -- 0:00:43
      358000 -- (-1762.572) (-1762.001) [-1762.672] (-1762.331) * [-1763.442] (-1765.646) (-1765.796) (-1763.888) -- 0:00:43
      358500 -- (-1764.873) [-1766.952] (-1765.423) (-1762.704) * (-1763.606) [-1763.516] (-1770.127) (-1762.241) -- 0:00:42
      359000 -- (-1764.793) (-1764.036) (-1763.273) [-1763.027] * [-1765.168] (-1763.516) (-1766.202) (-1768.641) -- 0:00:42
      359500 -- (-1762.149) (-1762.635) (-1762.106) [-1765.009] * [-1765.296] (-1763.753) (-1766.846) (-1766.122) -- 0:00:42
      360000 -- [-1762.820] (-1765.983) (-1763.129) (-1762.987) * (-1764.841) (-1764.243) (-1764.450) [-1766.260] -- 0:00:42

      Average standard deviation of split frequencies: 0.011917

      360500 -- (-1764.427) (-1765.883) [-1763.455] (-1764.890) * (-1763.949) [-1764.774] (-1763.850) (-1766.977) -- 0:00:42
      361000 -- [-1762.554] (-1767.909) (-1763.745) (-1763.788) * (-1763.696) [-1764.746] (-1765.720) (-1764.688) -- 0:00:42
      361500 -- (-1763.495) (-1764.112) (-1766.207) [-1762.565] * (-1763.815) [-1766.184] (-1764.469) (-1766.506) -- 0:00:42
      362000 -- [-1763.773] (-1764.306) (-1763.194) (-1763.484) * (-1765.570) (-1765.210) (-1764.589) [-1764.465] -- 0:00:42
      362500 -- (-1765.119) (-1763.929) (-1764.199) [-1763.592] * [-1763.356] (-1762.923) (-1764.022) (-1768.563) -- 0:00:42
      363000 -- (-1765.422) [-1762.066] (-1764.970) (-1764.484) * [-1763.673] (-1763.652) (-1762.538) (-1763.599) -- 0:00:42
      363500 -- [-1764.362] (-1765.652) (-1764.985) (-1766.471) * [-1766.497] (-1764.103) (-1762.917) (-1765.830) -- 0:00:42
      364000 -- (-1764.047) [-1763.825] (-1767.230) (-1765.065) * (-1763.840) [-1765.146] (-1766.125) (-1762.846) -- 0:00:41
      364500 -- (-1764.375) (-1762.944) (-1763.359) [-1763.804] * [-1767.156] (-1763.759) (-1763.542) (-1763.371) -- 0:00:41
      365000 -- (-1764.420) (-1763.292) [-1762.589] (-1763.705) * (-1770.737) (-1764.593) (-1765.944) [-1764.342] -- 0:00:41

      Average standard deviation of split frequencies: 0.011819

      365500 -- [-1764.378] (-1763.292) (-1762.708) (-1763.228) * (-1772.747) [-1764.331] (-1764.174) (-1765.491) -- 0:00:41
      366000 -- (-1763.207) (-1764.341) [-1762.776] (-1763.812) * (-1768.964) [-1765.387] (-1764.281) (-1768.933) -- 0:00:41
      366500 -- (-1762.979) (-1764.555) [-1762.205] (-1763.430) * (-1768.613) (-1764.198) [-1762.093] (-1768.793) -- 0:00:41
      367000 -- (-1763.255) (-1763.828) (-1766.230) [-1765.065] * (-1766.723) (-1765.008) (-1762.580) [-1766.624] -- 0:00:41
      367500 -- (-1766.386) [-1762.641] (-1763.543) (-1765.439) * [-1767.326] (-1764.804) (-1764.978) (-1767.111) -- 0:00:41
      368000 -- (-1764.543) [-1764.887] (-1764.196) (-1763.227) * (-1762.831) (-1764.959) (-1763.668) [-1763.509] -- 0:00:41
      368500 -- (-1762.697) (-1763.019) (-1766.129) [-1763.416] * (-1762.707) [-1766.681] (-1766.002) (-1764.743) -- 0:00:41
      369000 -- (-1763.121) (-1763.769) [-1765.668] (-1763.159) * [-1764.895] (-1769.178) (-1763.604) (-1766.062) -- 0:00:41
      369500 -- (-1768.035) (-1763.826) (-1765.255) [-1764.092] * (-1763.045) [-1765.166] (-1762.623) (-1764.639) -- 0:00:40
      370000 -- (-1764.890) (-1763.122) [-1764.403] (-1768.439) * [-1767.432] (-1765.393) (-1762.641) (-1763.603) -- 0:00:40

      Average standard deviation of split frequencies: 0.010997

      370500 -- (-1771.335) (-1763.151) (-1769.265) [-1765.626] * (-1763.022) [-1764.346] (-1764.992) (-1765.042) -- 0:00:42
      371000 -- (-1763.101) (-1765.788) [-1764.965] (-1766.410) * (-1763.279) (-1767.594) [-1764.847] (-1764.514) -- 0:00:42
      371500 -- (-1765.348) (-1763.659) (-1764.832) [-1763.948] * (-1763.102) (-1765.497) [-1762.204] (-1764.145) -- 0:00:42
      372000 -- (-1768.248) (-1763.855) [-1769.147] (-1763.924) * (-1762.853) [-1768.090] (-1763.259) (-1764.574) -- 0:00:42
      372500 -- [-1764.192] (-1765.839) (-1767.200) (-1763.858) * (-1764.763) [-1764.557] (-1765.336) (-1764.123) -- 0:00:42
      373000 -- [-1764.961] (-1764.646) (-1763.586) (-1765.507) * [-1764.936] (-1765.831) (-1765.828) (-1764.786) -- 0:00:42
      373500 -- [-1766.215] (-1765.911) (-1763.475) (-1764.203) * (-1763.539) [-1765.512] (-1772.581) (-1767.141) -- 0:00:41
      374000 -- [-1767.013] (-1768.396) (-1764.170) (-1765.493) * [-1763.874] (-1765.742) (-1767.391) (-1763.144) -- 0:00:41
      374500 -- (-1763.464) [-1767.779] (-1767.064) (-1764.720) * (-1764.082) (-1765.879) (-1764.990) [-1763.604] -- 0:00:41
      375000 -- (-1764.676) (-1766.636) (-1765.795) [-1762.901] * [-1762.942] (-1762.910) (-1767.451) (-1763.246) -- 0:00:41

      Average standard deviation of split frequencies: 0.010620

      375500 -- (-1763.230) (-1767.275) (-1764.713) [-1765.635] * (-1762.955) (-1763.095) (-1762.684) [-1766.553] -- 0:00:41
      376000 -- [-1763.107] (-1763.407) (-1764.820) (-1762.465) * [-1764.756] (-1763.080) (-1763.165) (-1765.491) -- 0:00:41
      376500 -- (-1763.392) (-1763.952) [-1765.014] (-1762.247) * (-1763.102) (-1763.819) (-1767.520) [-1765.184] -- 0:00:41
      377000 -- (-1763.309) (-1765.005) [-1764.270] (-1762.601) * (-1765.846) (-1767.405) (-1767.805) [-1763.938] -- 0:00:41
      377500 -- (-1766.135) [-1765.585] (-1763.375) (-1764.314) * (-1767.148) (-1764.515) (-1765.421) [-1764.968] -- 0:00:41
      378000 -- (-1769.622) (-1765.153) (-1765.015) [-1768.405] * (-1762.093) (-1763.840) (-1768.367) [-1764.798] -- 0:00:41
      378500 -- (-1764.051) (-1765.768) (-1762.683) [-1765.756] * (-1762.527) (-1765.351) [-1764.691] (-1764.818) -- 0:00:41
      379000 -- [-1765.036] (-1767.188) (-1766.864) (-1765.341) * (-1763.060) (-1763.681) [-1764.432] (-1765.521) -- 0:00:40
      379500 -- (-1762.290) (-1770.462) (-1764.464) [-1766.225] * (-1762.696) [-1765.542] (-1764.474) (-1765.758) -- 0:00:40
      380000 -- (-1768.094) [-1764.271] (-1763.658) (-1771.027) * (-1767.114) (-1769.901) (-1763.771) [-1764.548] -- 0:00:40

      Average standard deviation of split frequencies: 0.010053

      380500 -- (-1768.197) [-1762.638] (-1763.849) (-1764.155) * [-1766.941] (-1766.546) (-1764.112) (-1767.690) -- 0:00:40
      381000 -- (-1765.159) [-1762.719] (-1764.069) (-1763.295) * [-1763.653] (-1766.685) (-1763.295) (-1764.079) -- 0:00:40
      381500 -- (-1766.356) [-1762.892] (-1765.476) (-1762.812) * (-1767.436) (-1764.328) [-1762.723] (-1765.468) -- 0:00:40
      382000 -- [-1763.340] (-1764.594) (-1763.055) (-1765.339) * (-1770.437) (-1763.323) [-1762.357] (-1765.776) -- 0:00:40
      382500 -- (-1768.773) (-1764.353) [-1763.799] (-1766.032) * (-1772.599) (-1762.876) (-1762.283) [-1765.975] -- 0:00:40
      383000 -- (-1765.099) [-1763.400] (-1764.639) (-1768.028) * [-1766.963] (-1763.859) (-1763.045) (-1764.320) -- 0:00:40
      383500 -- (-1763.242) [-1763.357] (-1764.275) (-1766.858) * (-1765.061) [-1767.070] (-1763.390) (-1766.126) -- 0:00:40
      384000 -- (-1766.909) [-1762.947] (-1763.458) (-1763.726) * (-1764.840) (-1762.998) [-1764.903] (-1765.284) -- 0:00:40
      384500 -- (-1764.127) [-1762.947] (-1770.255) (-1764.824) * (-1778.130) [-1766.797] (-1763.134) (-1763.875) -- 0:00:40
      385000 -- [-1764.449] (-1763.000) (-1762.844) (-1767.542) * (-1766.712) (-1764.140) (-1762.032) [-1763.379] -- 0:00:39

      Average standard deviation of split frequencies: 0.010129

      385500 -- [-1766.134] (-1762.872) (-1763.537) (-1771.323) * (-1764.392) [-1762.780] (-1763.911) (-1763.695) -- 0:00:39
      386000 -- (-1768.105) [-1763.685] (-1766.486) (-1768.100) * (-1765.857) (-1762.940) (-1768.461) [-1763.670] -- 0:00:41
      386500 -- (-1765.320) [-1763.166] (-1764.362) (-1763.598) * (-1766.588) [-1764.176] (-1767.568) (-1763.101) -- 0:00:41
      387000 -- (-1765.432) (-1762.963) [-1765.558] (-1764.150) * (-1764.102) (-1767.894) (-1762.296) [-1762.636] -- 0:00:41
      387500 -- (-1765.604) [-1763.371] (-1762.548) (-1762.271) * (-1765.244) (-1769.838) (-1764.841) [-1763.429] -- 0:00:41
      388000 -- (-1765.575) (-1762.541) (-1762.279) [-1762.672] * (-1766.384) (-1766.918) (-1766.238) [-1763.424] -- 0:00:41
      388500 -- (-1765.774) (-1765.888) (-1765.224) [-1762.365] * (-1763.722) (-1764.660) (-1762.406) [-1763.884] -- 0:00:40
      389000 -- (-1766.411) (-1763.595) (-1764.319) [-1764.079] * (-1767.898) (-1766.646) [-1762.414] (-1764.705) -- 0:00:40
      389500 -- (-1765.023) (-1764.266) [-1766.289] (-1762.614) * (-1764.685) (-1767.264) (-1763.818) [-1766.895] -- 0:00:40
      390000 -- (-1765.049) [-1763.512] (-1767.098) (-1765.447) * [-1763.766] (-1766.885) (-1764.522) (-1764.282) -- 0:00:40

      Average standard deviation of split frequencies: 0.010363

      390500 -- [-1763.994] (-1766.118) (-1762.254) (-1764.067) * (-1763.427) (-1769.487) [-1764.514] (-1766.968) -- 0:00:40
      391000 -- [-1763.917] (-1768.061) (-1763.811) (-1765.120) * (-1765.060) [-1767.884] (-1764.375) (-1763.384) -- 0:00:40
      391500 -- (-1765.348) (-1766.803) [-1765.067] (-1763.512) * (-1765.118) (-1767.292) (-1764.848) [-1764.506] -- 0:00:40
      392000 -- [-1767.851] (-1763.485) (-1765.068) (-1763.398) * (-1764.652) (-1767.821) [-1765.793] (-1764.340) -- 0:00:40
      392500 -- (-1766.298) (-1765.073) [-1767.901] (-1763.348) * (-1763.907) [-1762.496] (-1764.835) (-1765.481) -- 0:00:40
      393000 -- (-1763.064) [-1764.728] (-1768.466) (-1766.835) * (-1771.079) (-1763.590) (-1766.223) [-1767.437] -- 0:00:40
      393500 -- (-1762.889) [-1765.159] (-1766.652) (-1764.399) * [-1764.439] (-1764.043) (-1767.700) (-1765.666) -- 0:00:40
      394000 -- (-1764.651) (-1766.821) [-1763.250] (-1765.455) * [-1763.157] (-1763.049) (-1764.666) (-1765.133) -- 0:00:39
      394500 -- (-1762.579) (-1767.535) (-1764.275) [-1765.143] * (-1763.236) [-1762.516] (-1764.068) (-1766.982) -- 0:00:39
      395000 -- (-1764.195) (-1767.516) (-1762.193) [-1764.995] * (-1768.104) [-1764.849] (-1764.600) (-1763.533) -- 0:00:39

      Average standard deviation of split frequencies: 0.010294

      395500 -- (-1763.295) [-1764.315] (-1763.425) (-1765.725) * (-1763.308) [-1763.934] (-1768.246) (-1764.113) -- 0:00:39
      396000 -- (-1764.604) [-1765.465] (-1762.394) (-1764.306) * (-1763.342) (-1763.397) [-1766.474] (-1762.981) -- 0:00:39
      396500 -- [-1765.466] (-1764.819) (-1762.910) (-1766.109) * (-1764.171) (-1764.190) [-1764.305] (-1763.237) -- 0:00:39
      397000 -- [-1763.084] (-1765.584) (-1762.910) (-1765.871) * [-1766.416] (-1764.636) (-1763.771) (-1767.224) -- 0:00:39
      397500 -- [-1763.256] (-1765.897) (-1762.931) (-1766.436) * [-1763.279] (-1764.934) (-1763.258) (-1765.883) -- 0:00:39
      398000 -- (-1762.970) (-1772.007) (-1762.930) [-1764.249] * [-1763.760] (-1764.405) (-1767.329) (-1763.886) -- 0:00:39
      398500 -- (-1762.966) [-1770.003] (-1765.173) (-1764.648) * (-1767.408) (-1762.644) (-1763.095) [-1763.409] -- 0:00:39
      399000 -- (-1764.189) [-1763.539] (-1765.750) (-1764.828) * (-1762.295) [-1765.994] (-1767.383) (-1764.364) -- 0:00:39
      399500 -- (-1763.971) (-1765.578) (-1767.597) [-1765.461] * (-1765.703) [-1765.327] (-1766.118) (-1762.938) -- 0:00:39
      400000 -- (-1765.328) (-1763.553) [-1765.061] (-1763.378) * (-1765.041) [-1764.669] (-1765.809) (-1764.324) -- 0:00:39

      Average standard deviation of split frequencies: 0.010935

      400500 -- (-1763.383) [-1763.110] (-1766.019) (-1763.706) * (-1763.511) (-1762.592) (-1768.476) [-1763.552] -- 0:00:38
      401000 -- (-1763.855) (-1764.463) [-1763.681] (-1763.761) * (-1763.468) [-1764.930] (-1762.080) (-1766.072) -- 0:00:40
      401500 -- (-1764.919) [-1763.622] (-1765.836) (-1765.926) * (-1765.180) [-1763.279] (-1765.316) (-1764.964) -- 0:00:40
      402000 -- [-1764.436] (-1764.767) (-1764.874) (-1764.762) * [-1764.720] (-1765.359) (-1763.898) (-1766.682) -- 0:00:40
      402500 -- (-1765.137) (-1764.241) (-1764.674) [-1763.679] * (-1766.592) (-1765.581) (-1762.485) [-1766.837] -- 0:00:40
      403000 -- [-1762.763] (-1763.628) (-1767.072) (-1765.954) * (-1769.967) (-1768.165) [-1762.174] (-1764.781) -- 0:00:39
      403500 -- (-1762.711) (-1762.462) (-1769.107) [-1768.868] * [-1769.865] (-1764.100) (-1764.066) (-1766.412) -- 0:00:39
      404000 -- [-1765.178] (-1762.025) (-1764.977) (-1765.183) * (-1766.159) (-1766.595) [-1763.930] (-1769.068) -- 0:00:39
      404500 -- (-1762.990) (-1763.482) [-1765.460] (-1764.852) * [-1762.940] (-1768.241) (-1765.519) (-1763.724) -- 0:00:39
      405000 -- (-1763.609) [-1762.574] (-1764.162) (-1766.888) * (-1765.964) [-1766.593] (-1765.244) (-1763.798) -- 0:00:39

      Average standard deviation of split frequencies: 0.010996

      405500 -- [-1763.880] (-1764.771) (-1765.993) (-1764.377) * (-1762.792) (-1764.314) [-1762.546] (-1765.122) -- 0:00:39
      406000 -- (-1765.920) (-1764.995) (-1765.456) [-1764.567] * (-1763.546) (-1763.740) [-1762.583] (-1765.335) -- 0:00:39
      406500 -- (-1765.636) (-1763.788) (-1764.907) [-1766.060] * (-1764.097) (-1763.628) [-1763.115] (-1766.943) -- 0:00:39
      407000 -- (-1762.218) (-1762.586) (-1764.435) [-1763.773] * [-1762.914] (-1763.486) (-1764.428) (-1768.560) -- 0:00:39
      407500 -- (-1762.300) (-1762.692) (-1766.841) [-1763.090] * (-1763.659) (-1765.394) (-1765.497) [-1764.053] -- 0:00:39
      408000 -- (-1763.628) (-1764.070) [-1762.918] (-1764.477) * (-1762.293) (-1768.791) [-1763.754] (-1770.187) -- 0:00:39
      408500 -- (-1764.034) (-1763.998) [-1763.099] (-1767.647) * [-1765.859] (-1764.310) (-1763.733) (-1770.665) -- 0:00:39
      409000 -- (-1762.037) (-1766.681) [-1762.792] (-1769.428) * (-1765.859) (-1771.845) (-1763.177) [-1766.581] -- 0:00:39
      409500 -- (-1765.289) (-1764.259) (-1762.465) [-1764.147] * (-1763.297) [-1765.440] (-1763.444) (-1764.075) -- 0:00:38
      410000 -- (-1768.073) [-1763.802] (-1764.563) (-1764.415) * [-1764.478] (-1764.935) (-1764.159) (-1765.159) -- 0:00:38

      Average standard deviation of split frequencies: 0.011407

      410500 -- (-1767.509) (-1764.584) (-1763.130) [-1762.848] * (-1764.616) (-1767.321) [-1762.648] (-1767.663) -- 0:00:38
      411000 -- (-1768.483) [-1764.702] (-1762.549) (-1764.303) * [-1763.885] (-1766.781) (-1762.701) (-1765.724) -- 0:00:38
      411500 -- (-1766.758) [-1764.249] (-1763.201) (-1764.269) * [-1763.483] (-1769.199) (-1763.380) (-1768.411) -- 0:00:38
      412000 -- [-1762.866] (-1764.586) (-1762.614) (-1764.553) * (-1763.061) (-1770.566) [-1762.832] (-1764.262) -- 0:00:38
      412500 -- [-1763.978] (-1765.893) (-1764.011) (-1764.884) * (-1763.372) (-1768.044) [-1764.864] (-1763.484) -- 0:00:38
      413000 -- (-1764.692) (-1770.806) [-1762.506] (-1763.205) * (-1762.357) (-1769.960) [-1764.330] (-1763.077) -- 0:00:38
      413500 -- [-1764.759] (-1766.760) (-1763.624) (-1763.481) * (-1762.368) [-1771.939] (-1765.894) (-1764.792) -- 0:00:38
      414000 -- (-1763.824) [-1764.036] (-1764.394) (-1764.563) * [-1763.357] (-1768.552) (-1765.503) (-1768.451) -- 0:00:38
      414500 -- (-1764.382) (-1763.571) (-1765.562) [-1763.280] * (-1764.277) (-1768.765) (-1766.530) [-1764.290] -- 0:00:38
      415000 -- [-1765.443] (-1763.299) (-1764.800) (-1763.192) * [-1763.690] (-1764.755) (-1765.312) (-1764.320) -- 0:00:38

      Average standard deviation of split frequencies: 0.011332

      415500 -- (-1765.122) (-1763.221) (-1765.562) [-1763.798] * (-1766.377) (-1764.348) (-1765.858) [-1764.110] -- 0:00:37
      416000 -- (-1763.550) [-1762.503] (-1765.425) (-1763.576) * (-1765.458) [-1764.131] (-1769.044) (-1767.096) -- 0:00:37
      416500 -- [-1765.664] (-1762.209) (-1763.637) (-1762.934) * (-1764.909) [-1767.419] (-1764.808) (-1765.101) -- 0:00:39
      417000 -- (-1764.876) (-1765.710) [-1763.492] (-1763.860) * (-1764.148) (-1764.079) (-1767.293) [-1763.522] -- 0:00:39
      417500 -- (-1765.814) (-1765.915) (-1769.338) [-1764.533] * (-1764.474) [-1764.419] (-1767.820) (-1762.604) -- 0:00:39
      418000 -- (-1764.924) (-1765.943) (-1767.783) [-1764.464] * (-1767.097) (-1764.749) (-1767.623) [-1762.236] -- 0:00:38
      418500 -- [-1764.326] (-1764.029) (-1767.428) (-1763.041) * (-1765.432) (-1764.591) (-1766.028) [-1762.033] -- 0:00:38
      419000 -- (-1764.516) (-1766.263) [-1767.823] (-1762.273) * (-1766.013) (-1765.272) [-1764.178] (-1764.378) -- 0:00:38
      419500 -- (-1763.680) (-1764.715) (-1765.331) [-1763.264] * (-1764.098) [-1766.848] (-1764.052) (-1763.785) -- 0:00:38
      420000 -- (-1763.161) (-1767.271) (-1764.620) [-1762.616] * (-1769.227) [-1765.237] (-1763.220) (-1763.790) -- 0:00:38

      Average standard deviation of split frequencies: 0.011346

      420500 -- (-1765.499) (-1764.415) [-1766.041] (-1762.550) * (-1764.730) (-1765.518) [-1763.569] (-1766.569) -- 0:00:38
      421000 -- [-1765.753] (-1764.400) (-1764.709) (-1764.514) * (-1764.304) [-1764.153] (-1765.146) (-1764.312) -- 0:00:38
      421500 -- [-1764.197] (-1762.949) (-1762.790) (-1768.532) * (-1764.646) (-1766.656) [-1763.647] (-1766.879) -- 0:00:38
      422000 -- (-1764.692) [-1764.451] (-1763.021) (-1764.479) * (-1764.540) [-1765.022] (-1763.447) (-1765.635) -- 0:00:38
      422500 -- (-1764.139) (-1765.494) [-1763.862] (-1764.462) * (-1763.150) (-1767.230) (-1763.166) [-1762.624] -- 0:00:38
      423000 -- (-1763.080) (-1764.332) [-1766.197] (-1764.525) * (-1763.324) [-1765.643] (-1762.593) (-1762.874) -- 0:00:38
      423500 -- [-1763.871] (-1762.771) (-1767.492) (-1768.448) * (-1763.324) (-1764.926) [-1763.769] (-1763.083) -- 0:00:38
      424000 -- (-1764.676) [-1764.084] (-1767.906) (-1769.837) * (-1767.937) (-1764.850) (-1765.934) [-1768.347] -- 0:00:38
      424500 -- [-1764.001] (-1765.292) (-1763.583) (-1765.323) * [-1764.646] (-1763.743) (-1764.878) (-1764.251) -- 0:00:37
      425000 -- [-1763.197] (-1763.203) (-1763.583) (-1764.867) * (-1765.828) (-1762.950) (-1764.570) [-1764.555] -- 0:00:37

      Average standard deviation of split frequencies: 0.011496

      425500 -- [-1768.622] (-1764.132) (-1764.048) (-1764.459) * (-1763.649) (-1765.931) (-1763.165) [-1764.618] -- 0:00:37
      426000 -- [-1766.448] (-1763.603) (-1764.032) (-1763.027) * (-1762.817) (-1766.131) (-1766.721) [-1766.603] -- 0:00:37
      426500 -- (-1766.414) (-1764.882) [-1764.617] (-1763.000) * (-1763.116) (-1763.087) (-1764.903) [-1766.881] -- 0:00:37
      427000 -- (-1766.630) (-1764.296) (-1766.133) [-1766.525] * [-1763.186] (-1766.245) (-1765.433) (-1762.569) -- 0:00:37
      427500 -- (-1765.641) (-1764.794) [-1763.528] (-1764.393) * (-1762.423) (-1764.315) [-1765.398] (-1763.658) -- 0:00:37
      428000 -- (-1765.303) (-1769.335) [-1762.363] (-1763.470) * [-1762.735] (-1764.214) (-1766.024) (-1766.406) -- 0:00:37
      428500 -- [-1763.419] (-1764.258) (-1762.920) (-1763.671) * (-1763.225) (-1764.341) (-1765.907) [-1762.642] -- 0:00:37
      429000 -- (-1763.715) [-1764.373] (-1763.068) (-1763.268) * (-1764.092) (-1765.329) [-1764.422] (-1766.219) -- 0:00:37
      429500 -- [-1766.283] (-1764.205) (-1768.893) (-1766.929) * [-1763.098] (-1765.468) (-1766.300) (-1766.229) -- 0:00:37
      430000 -- (-1765.745) (-1762.091) (-1766.385) [-1764.930] * (-1763.104) [-1765.386] (-1765.458) (-1764.855) -- 0:00:37

      Average standard deviation of split frequencies: 0.010672

      430500 -- (-1767.627) [-1762.173] (-1766.310) (-1765.983) * (-1764.611) [-1764.235] (-1764.916) (-1771.765) -- 0:00:37
      431000 -- (-1770.057) (-1764.759) [-1765.063] (-1766.597) * (-1767.524) [-1764.886] (-1764.959) (-1768.735) -- 0:00:36
      431500 -- (-1769.200) (-1764.554) [-1763.483] (-1766.416) * (-1763.870) (-1765.318) (-1763.703) [-1764.279] -- 0:00:36
      432000 -- (-1765.992) (-1766.310) [-1764.252] (-1766.124) * [-1767.013] (-1763.638) (-1763.346) (-1764.179) -- 0:00:38
      432500 -- [-1764.950] (-1766.598) (-1763.039) (-1765.550) * (-1768.763) (-1762.835) [-1763.369] (-1763.122) -- 0:00:38
      433000 -- (-1764.762) [-1764.208] (-1764.159) (-1764.340) * (-1766.485) (-1763.099) [-1768.559] (-1763.339) -- 0:00:37
      433500 -- [-1763.523] (-1766.645) (-1765.346) (-1763.481) * (-1770.899) (-1765.684) [-1765.480] (-1768.136) -- 0:00:37
      434000 -- (-1764.400) (-1763.478) (-1766.127) [-1762.526] * (-1765.627) [-1764.196] (-1763.532) (-1769.587) -- 0:00:37
      434500 -- (-1765.352) (-1763.683) (-1767.321) [-1765.320] * [-1765.500] (-1766.252) (-1762.921) (-1763.845) -- 0:00:37
      435000 -- (-1763.515) (-1764.373) (-1765.364) [-1765.674] * [-1763.445] (-1766.573) (-1767.779) (-1763.664) -- 0:00:37

      Average standard deviation of split frequencies: 0.009866

      435500 -- (-1766.904) (-1762.813) (-1765.493) [-1763.313] * [-1763.736] (-1764.218) (-1769.183) (-1763.529) -- 0:00:37
      436000 -- (-1765.285) (-1766.780) (-1766.637) [-1763.993] * (-1763.617) [-1764.065] (-1768.278) (-1765.395) -- 0:00:37
      436500 -- (-1765.601) (-1767.885) (-1767.521) [-1766.406] * (-1763.862) (-1762.887) (-1767.535) [-1764.101] -- 0:00:37
      437000 -- (-1766.921) [-1768.404] (-1766.526) (-1766.311) * (-1765.949) (-1766.353) [-1764.681] (-1764.507) -- 0:00:37
      437500 -- (-1765.787) [-1766.589] (-1769.725) (-1769.218) * [-1763.685] (-1763.201) (-1764.633) (-1764.189) -- 0:00:37
      438000 -- (-1766.124) (-1768.743) (-1764.911) [-1763.911] * (-1762.754) (-1763.368) (-1764.817) [-1765.213] -- 0:00:37
      438500 -- [-1763.449] (-1769.138) (-1764.082) (-1764.371) * [-1762.660] (-1764.254) (-1765.684) (-1764.039) -- 0:00:37
      439000 -- (-1766.565) (-1767.141) [-1762.907] (-1765.494) * (-1766.561) [-1765.083] (-1764.922) (-1764.045) -- 0:00:37
      439500 -- (-1764.665) [-1764.342] (-1768.150) (-1765.502) * (-1763.212) [-1764.336] (-1764.075) (-1763.880) -- 0:00:36
      440000 -- [-1765.988] (-1762.837) (-1763.326) (-1764.470) * (-1764.479) (-1763.123) (-1764.116) [-1763.055] -- 0:00:36

      Average standard deviation of split frequencies: 0.010230

      440500 -- [-1765.068] (-1763.884) (-1762.969) (-1764.413) * (-1764.280) (-1764.407) (-1762.867) [-1766.150] -- 0:00:36
      441000 -- [-1765.701] (-1764.882) (-1765.140) (-1765.314) * (-1764.426) [-1763.539] (-1763.343) (-1763.494) -- 0:00:36
      441500 -- (-1769.989) (-1763.465) (-1765.486) [-1763.603] * (-1763.340) [-1764.263] (-1763.252) (-1763.068) -- 0:00:36
      442000 -- (-1765.837) [-1764.407] (-1768.522) (-1763.321) * (-1765.092) (-1764.794) (-1763.751) [-1764.189] -- 0:00:36
      442500 -- (-1765.980) (-1766.138) (-1764.061) [-1763.794] * (-1765.714) [-1766.024] (-1764.434) (-1763.828) -- 0:00:36
      443000 -- (-1765.687) (-1764.682) [-1765.147] (-1763.821) * (-1765.621) (-1766.512) (-1773.902) [-1766.008] -- 0:00:36
      443500 -- (-1763.590) (-1765.715) (-1764.335) [-1763.983] * (-1767.512) (-1764.118) (-1769.566) [-1764.222] -- 0:00:36
      444000 -- (-1771.773) (-1768.224) (-1763.519) [-1765.798] * [-1766.735] (-1766.691) (-1762.815) (-1764.265) -- 0:00:36
      444500 -- [-1768.639] (-1771.411) (-1763.669) (-1764.169) * (-1768.434) [-1762.141] (-1762.914) (-1763.032) -- 0:00:36
      445000 -- (-1764.974) (-1764.574) [-