--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:20:31 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/phoS2/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/phoS2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/phoS2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/phoS2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1523.72         -1526.84
2      -1523.72         -1526.65
--------------------------------------
TOTAL    -1523.72         -1526.75
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/phoS2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/phoS2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/phoS2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.903922    0.089253    0.366969    1.464380    0.876656   1176.98   1222.13    1.000
r(A<->C){all}   0.167215    0.019214    0.000092    0.444966    0.133361    266.88    300.87    1.000
r(A<->G){all}   0.158033    0.018716    0.000098    0.431296    0.120528    246.28    262.25    1.000
r(A<->T){all}   0.174982    0.020428    0.000191    0.461823    0.137915    155.43    284.49    1.003
r(C<->G){all}   0.156701    0.018262    0.000011    0.419009    0.121692    223.55    263.41    1.013
r(C<->T){all}   0.176885    0.020857    0.000041    0.464395    0.142852    185.70    203.72    1.000
r(G<->T){all}   0.166184    0.018999    0.000107    0.437850    0.132506    169.35    241.28    1.005
pi(A){all}      0.221968    0.000156    0.199444    0.246882    0.221848   1046.47   1110.71    1.000
pi(C){all}      0.267266    0.000175    0.241355    0.292868    0.267140   1288.56   1298.40    1.000
pi(G){all}      0.303057    0.000194    0.275777    0.329642    0.302957   1192.96   1337.40    1.000
pi(T){all}      0.207709    0.000144    0.183555    0.230546    0.207641   1313.76   1375.44    1.000
alpha{1,2}      0.423397    0.243904    0.000307    1.459280    0.245350   1214.98   1301.94    1.000
alpha{3}        0.464708    0.256964    0.000192    1.526133    0.301899   1133.35   1223.55    1.000
pinvar{all}     0.998580    0.000003    0.995512    1.000000    0.999103    911.32    998.29    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1470.358583
Model 2: PositiveSelection	-1470.358418
Model 0: one-ratio	-1470.358626
Model 7: beta	-1470.358684
Model 8: beta&w>1	-1470.358417


Model 0 vs 1	8.600000001024455E-5

Model 2 vs 1	3.299999998489511E-4

Model 8 vs 7	5.340000002433953E-4
>C1
LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
VPIPDSFKSRLSTAANAIA
>C2
LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
VPIPDSFKSRLSTAANAIA
>C3
LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
VPIPDSFKSRLSTAANAIA
>C4
LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
VPIPDSFKSRLSTAANAIA
>C5
LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
VPIPDSFKSRLSTAANAIA
>C6
LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
VPIPDSFKSRLSTAANAIA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=369 

C1              LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
C2              LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
C3              LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
C4              LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
C5              LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
C6              LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
                **************************************************

C1              KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
C2              KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
C3              KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
C4              KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
C5              KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
C6              KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
                **************************************************

C1              GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
C2              GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
C3              GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
C4              GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
C5              GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
C6              GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
                **************************************************

C1              TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
C2              TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
C3              TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
C4              TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
C5              TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
C6              TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
                **************************************************

C1              DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
C2              DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
C3              DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
C4              DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
C5              DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
C6              DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
                **************************************************

C1              ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
C2              ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
C3              ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
C4              ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
C5              ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
C6              ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
                **************************************************

C1              PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
C2              PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
C3              PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
C4              PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
C5              PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
C6              PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
                **************************************************

C1              VPIPDSFKSRLSTAANAIA
C2              VPIPDSFKSRLSTAANAIA
C3              VPIPDSFKSRLSTAANAIA
C4              VPIPDSFKSRLSTAANAIA
C5              VPIPDSFKSRLSTAANAIA
C6              VPIPDSFKSRLSTAANAIA
                *******************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11070]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [11070]--->[11070]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.525 Mb, Max= 30.944 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
C2              LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
C3              LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
C4              LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
C5              LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
C6              LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
                **************************************************

C1              KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
C2              KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
C3              KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
C4              KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
C5              KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
C6              KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
                **************************************************

C1              GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
C2              GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
C3              GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
C4              GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
C5              GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
C6              GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
                **************************************************

C1              TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
C2              TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
C3              TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
C4              TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
C5              TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
C6              TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
                **************************************************

C1              DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
C2              DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
C3              DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
C4              DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
C5              DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
C6              DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
                **************************************************

C1              ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
C2              ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
C3              ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
C4              ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
C5              ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
C6              ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
                **************************************************

C1              PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
C2              PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
C3              PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
C4              PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
C5              PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
C6              PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
                **************************************************

C1              VPIPDSFKSRLSTAANAIA
C2              VPIPDSFKSRLSTAANAIA
C3              VPIPDSFKSRLSTAANAIA
C4              VPIPDSFKSRLSTAANAIA
C5              VPIPDSFKSRLSTAANAIA
C6              VPIPDSFKSRLSTAANAIA
                *******************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              TTGAAGCTCAACCAGTTTGGTGCCGCGATTGGGCTCCTGGCTACTGGTGC
C2              TTGAAGCTCAACCAGTTTGGTGCCGCGATTGGGCTCCTGGCTACTGGTGC
C3              TTGAAGCTCAACCAGTTTGGTGCCGCGATTGGGCTCCTGGCTACTGGTGC
C4              TTGAAGCTCAACCAGTTTGGTGCCGCGATTGGGCTCCTGGCTACTGGTGC
C5              TTGAAGCTCAACCAGTTTGGTGCCGCGATTGGGCTCCTGGCTACTGGTGC
C6              TTGAAGCTCAACCAGTTTGGTGCCGCGATTGGGCTCCTGGCTACTGGTGC
                **************************************************

C1              GCTGTTGTCGGGCTGCGGCAGCGACAACAACGCAGCTGTAGGAAGTGCAC
C2              GCTGTTGTCGGGCTGCGGCAGCGACAACAACGCAGCTGTAGGAAGTGCAC
C3              GCTGTTGTCGGGCTGCGGCAGCGACAACAACGCAGCTGTAGGAAGTGCAC
C4              GCTGTTGTCGGGCTGCGGCAGCGACAACAACGCAGCTGTAGGAAGTGCAC
C5              GCTGTTGTCGGGCTGCGGCAGCGACAACAACGCAGCTGTAGGAAGTGCAC
C6              GCTGTTGTCGGGCTGCGGCAGCGACAACAACGCAGCTGTAGGAAGTGCAC
                **************************************************

C1              GGACAGGCCCATCGTCAGGCCAGGTGAGCTGCGGTGGGAAGCCGACACTG
C2              GGACAGGCCCATCGTCAGGCCAGGTGAGCTGCGGTGGGAAGCCGACACTG
C3              GGACAGGCCCATCGTCAGGCCAGGTGAGCTGCGGTGGGAAGCCGACACTG
C4              GGACAGGCCCATCGTCAGGCCAGGTGAGCTGCGGTGGGAAGCCGACACTG
C5              GGACAGGCCCATCGTCAGGCCAGGTGAGCTGCGGTGGGAAGCCGACACTG
C6              GGACAGGCCCATCGTCAGGCCAGGTGAGCTGCGGTGGGAAGCCGACACTG
                **************************************************

C1              AAAGCTAGCGGGTCGACAGCCCAGGCCAACGCGATGACCCGCTTTGTTAA
C2              AAAGCTAGCGGGTCGACAGCCCAGGCCAACGCGATGACCCGCTTTGTTAA
C3              AAAGCTAGCGGGTCGACAGCCCAGGCCAACGCGATGACCCGCTTTGTTAA
C4              AAAGCTAGCGGGTCGACAGCCCAGGCCAACGCGATGACCCGCTTTGTTAA
C5              AAAGCTAGCGGGTCGACAGCCCAGGCCAACGCGATGACCCGCTTTGTTAA
C6              AAAGCTAGCGGGTCGACAGCCCAGGCCAACGCGATGACCCGCTTTGTTAA
                **************************************************

C1              TGCGTTCGAACGGTCATGTCCAGGACAGACGTTGAACTATACGGCTAATG
C2              TGCGTTCGAACGGTCATGTCCAGGACAGACGTTGAACTATACGGCTAATG
C3              TGCGTTCGAACGGTCATGTCCAGGACAGACGTTGAACTATACGGCTAATG
C4              TGCGTTCGAACGGTCATGTCCAGGACAGACGTTGAACTATACGGCTAATG
C5              TGCGTTCGAACGGTCATGTCCAGGACAGACGTTGAACTATACGGCTAATG
C6              TGCGTTCGAACGGTCATGTCCAGGACAGACGTTGAACTATACGGCTAATG
                **************************************************

C1              GTTCCGGTGCGGGGGTTAGCGAATTCAACGGTAATCAAACAGATTTCGGT
C2              GTTCCGGTGCGGGGGTTAGCGAATTCAACGGTAATCAAACAGATTTCGGT
C3              GTTCCGGTGCGGGGGTTAGCGAATTCAACGGTAATCAAACAGATTTCGGT
C4              GTTCCGGTGCGGGGGTTAGCGAATTCAACGGTAATCAAACAGATTTCGGT
C5              GTTCCGGTGCGGGGGTTAGCGAATTCAACGGTAATCAAACAGATTTCGGT
C6              GTTCCGGTGCGGGGGTTAGCGAATTCAACGGTAATCAAACAGATTTCGGT
                **************************************************

C1              GGCTCAGACTCACCGTTGAGTAGGAAGGAGTATGCCGCAGCAGAGCAACG
C2              GGCTCAGACTCACCGTTGAGTAGGAAGGAGTATGCCGCAGCAGAGCAACG
C3              GGCTCAGACTCACCGTTGAGTAGGAAGGAGTATGCCGCAGCAGAGCAACG
C4              GGCTCAGACTCACCGTTGAGTAGGAAGGAGTATGCCGCAGCAGAGCAACG
C5              GGCTCAGACTCACCGTTGAGTAGGAAGGAGTATGCCGCAGCAGAGCAACG
C6              GGCTCAGACTCACCGTTGAGTAGGAAGGAGTATGCCGCAGCAGAGCAACG
                **************************************************

C1              TTGTGGCTCGCAGGCGTGGAATTTACCGGTGGTCTTCGGCCCCATCGCGA
C2              TTGTGGCTCGCAGGCGTGGAATTTACCGGTGGTCTTCGGCCCCATCGCGA
C3              TTGTGGCTCGCAGGCGTGGAATTTACCGGTGGTCTTCGGCCCCATCGCGA
C4              TTGTGGCTCGCAGGCGTGGAATTTACCGGTGGTCTTCGGCCCCATCGCGA
C5              TTGTGGCTCGCAGGCGTGGAATTTACCGGTGGTCTTCGGCCCCATCGCGA
C6              TTGTGGCTCGCAGGCGTGGAATTTACCGGTGGTCTTCGGCCCCATCGCGA
                **************************************************

C1              TCACTTACAACGTGAACGGCCTGAGTTCACTGAACCTGGACGGTCCGACA
C2              TCACTTACAACGTGAACGGCCTGAGTTCACTGAACCTGGACGGTCCGACA
C3              TCACTTACAACGTGAACGGCCTGAGTTCACTGAACCTGGACGGTCCGACA
C4              TCACTTACAACGTGAACGGCCTGAGTTCACTGAACCTGGACGGTCCGACA
C5              TCACTTACAACGTGAACGGCCTGAGTTCACTGAACCTGGACGGTCCGACA
C6              TCACTTACAACGTGAACGGCCTGAGTTCACTGAACCTGGACGGTCCGACA
                **************************************************

C1              ACCGCGAAGATCTTCAATGGTTCCATCGCCAGTTGGAACGATCCCGCGAT
C2              ACCGCGAAGATCTTCAATGGTTCCATCGCCAGTTGGAACGATCCCGCGAT
C3              ACCGCGAAGATCTTCAATGGTTCCATCGCCAGTTGGAACGATCCCGCGAT
C4              ACCGCGAAGATCTTCAATGGTTCCATCGCCAGTTGGAACGATCCCGCGAT
C5              ACCGCGAAGATCTTCAATGGTTCCATCGCCAGTTGGAACGATCCCGCGAT
C6              ACCGCGAAGATCTTCAATGGTTCCATCGCCAGTTGGAACGATCCCGCGAT
                **************************************************

C1              CCAAGCGCTGAACACTGGCGTCGCCCTTCCGGCTGAGCCGATTCATGTCG
C2              CCAAGCGCTGAACACTGGCGTCGCCCTTCCGGCTGAGCCGATTCATGTCG
C3              CCAAGCGCTGAACACTGGCGTCGCCCTTCCGGCTGAGCCGATTCATGTCG
C4              CCAAGCGCTGAACACTGGCGTCGCCCTTCCGGCTGAGCCGATTCATGTCG
C5              CCAAGCGCTGAACACTGGCGTCGCCCTTCCGGCTGAGCCGATTCATGTCG
C6              CCAAGCGCTGAACACTGGCGTCGCCCTTCCGGCTGAGCCGATTCATGTCG
                **************************************************

C1              TGTTCCGCAACGACGAGTCCGGTACCACGGATAATTTCCAGAGGTACCTT
C2              TGTTCCGCAACGACGAGTCCGGTACCACGGATAATTTCCAGAGGTACCTT
C3              TGTTCCGCAACGACGAGTCCGGTACCACGGATAATTTCCAGAGGTACCTT
C4              TGTTCCGCAACGACGAGTCCGGTACCACGGATAATTTCCAGAGGTACCTT
C5              TGTTCCGCAACGACGAGTCCGGTACCACGGATAATTTCCAGAGGTACCTT
C6              TGTTCCGCAACGACGAGTCCGGTACCACGGATAATTTCCAGAGGTACCTT
                **************************************************

C1              GACGTCGCATCAAACGGTGAGTGGGGCAAAGGTATCGGCAAGACCTTTAA
C2              GACGTCGCATCAAACGGTGAGTGGGGCAAAGGTATCGGCAAGACCTTTAA
C3              GACGTCGCATCAAACGGTGAGTGGGGCAAAGGTATCGGCAAGACCTTTAA
C4              GACGTCGCATCAAACGGTGAGTGGGGCAAAGGTATCGGCAAGACCTTTAA
C5              GACGTCGCATCAAACGGTGAGTGGGGCAAAGGTATCGGCAAGACCTTTAA
C6              GACGTCGCATCAAACGGTGAGTGGGGCAAAGGTATCGGCAAGACCTTTAA
                **************************************************

C1              AGGCGGTGTTGGTGAGGGTGCCAAGGGCAATGACGGTACGTCGGCGGCCG
C2              AGGCGGTGTTGGTGAGGGTGCCAAGGGCAATGACGGTACGTCGGCGGCCG
C3              AGGCGGTGTTGGTGAGGGTGCCAAGGGCAATGACGGTACGTCGGCGGCCG
C4              AGGCGGTGTTGGTGAGGGTGCCAAGGGCAATGACGGTACGTCGGCGGCCG
C5              AGGCGGTGTTGGTGAGGGTGCCAAGGGCAATGACGGTACGTCGGCGGCCG
C6              AGGCGGTGTTGGTGAGGGTGCCAAGGGCAATGACGGTACGTCGGCGGCCG
                **************************************************

C1              TCAAGTCCACTGAAGGGTCGATCACCTACAACGAATGGTCGTTCGCTTCG
C2              TCAAGTCCACTGAAGGGTCGATCACCTACAACGAATGGTCGTTCGCTTCG
C3              TCAAGTCCACTGAAGGGTCGATCACCTACAACGAATGGTCGTTCGCTTCG
C4              TCAAGTCCACTGAAGGGTCGATCACCTACAACGAATGGTCGTTCGCTTCG
C5              TCAAGTCCACTGAAGGGTCGATCACCTACAACGAATGGTCGTTCGCTTCG
C6              TCAAGTCCACTGAAGGGTCGATCACCTACAACGAATGGTCGTTCGCTTCG
                **************************************************

C1              GCGCGGAAGCTGAACACGGCCAAGATCGCCACGTCGGCCGATCCAGAACC
C2              GCGCGGAAGCTGAACACGGCCAAGATCGCCACGTCGGCCGATCCAGAACC
C3              GCGCGGAAGCTGAACACGGCCAAGATCGCCACGTCGGCCGATCCAGAACC
C4              GCGCGGAAGCTGAACACGGCCAAGATCGCCACGTCGGCCGATCCAGAACC
C5              GCGCGGAAGCTGAACACGGCCAAGATCGCCACGTCGGCCGATCCAGAACC
C6              GCGCGGAAGCTGAACACGGCCAAGATCGCCACGTCGGCCGATCCAGAACC
                **************************************************

C1              CATTGCGATCAGCGTCGACTCGGTCGGCAAGACAATTTCTGGGGCTACGA
C2              CATTGCGATCAGCGTCGACTCGGTCGGCAAGACAATTTCTGGGGCTACGA
C3              CATTGCGATCAGCGTCGACTCGGTCGGCAAGACAATTTCTGGGGCTACGA
C4              CATTGCGATCAGCGTCGACTCGGTCGGCAAGACAATTTCTGGGGCTACGA
C5              CATTGCGATCAGCGTCGACTCGGTCGGCAAGACAATTTCTGGGGCTACGA
C6              CATTGCGATCAGCGTCGACTCGGTCGGCAAGACAATTTCTGGGGCTACGA
                **************************************************

C1              TCATTGGAGAGGGTAACGATTTAGTGCTTGACACGGTCTCGTTTTACAAG
C2              TCATTGGAGAGGGTAACGATTTAGTGCTTGACACGGTCTCGTTTTACAAG
C3              TCATTGGAGAGGGTAACGATTTAGTGCTTGACACGGTCTCGTTTTACAAG
C4              TCATTGGAGAGGGTAACGATTTAGTGCTTGACACGGTCTCGTTTTACAAG
C5              TCATTGGAGAGGGTAACGATTTAGTGCTTGACACGGTCTCGTTTTACAAG
C6              TCATTGGAGAGGGTAACGATTTAGTGCTTGACACGGTCTCGTTTTACAAG
                **************************************************

C1              CCGGCTCAGCCCGGCTCCTACCCAATCGTGCTGGCGACCTACGAGATTGT
C2              CCGGCTCAGCCCGGCTCCTACCCAATCGTGCTGGCGACCTACGAGATTGT
C3              CCGGCTCAGCCCGGCTCCTACCCAATCGTGCTGGCGACCTACGAGATTGT
C4              CCGGCTCAGCCCGGCTCCTACCCAATCGTGCTGGCGACCTACGAGATTGT
C5              CCGGCTCAGCCCGGCTCCTACCCAATCGTGCTGGCGACCTACGAGATTGT
C6              CCGGCTCAGCCCGGCTCCTACCCAATCGTGCTGGCGACCTACGAGATTGT
                **************************************************

C1              CTGCTCGAAGTATCCCGATGCCCAGGTCGGTAGGGCTGTGAAGGCATTCC
C2              CTGCTCGAAGTATCCCGATGCCCAGGTCGGTAGGGCTGTGAAGGCATTCC
C3              CTGCTCGAAGTATCCCGATGCCCAGGTCGGTAGGGCTGTGAAGGCATTCC
C4              CTGCTCGAAGTATCCCGATGCCCAGGTCGGTAGGGCTGTGAAGGCATTCC
C5              CTGCTCGAAGTATCCCGATGCCCAGGTCGGTAGGGCTGTGAAGGCATTCC
C6              CTGCTCGAAGTATCCCGATGCCCAGGTCGGTAGGGCTGTGAAGGCATTCC
                **************************************************

C1              TGCAGAGCACCATCGGTGGAGGCCAGAATGGCCTAGGGGACAACGGATAT
C2              TGCAGAGCACCATCGGTGGAGGCCAGAATGGCCTAGGGGACAACGGATAT
C3              TGCAGAGCACCATCGGTGGAGGCCAGAATGGCCTAGGGGACAACGGATAT
C4              TGCAGAGCACCATCGGTGGAGGCCAGAATGGCCTAGGGGACAACGGATAT
C5              TGCAGAGCACCATCGGTGGAGGCCAGAATGGCCTAGGGGACAACGGATAT
C6              TGCAGAGCACCATCGGTGGAGGCCAGAATGGCCTAGGGGACAACGGATAT
                **************************************************

C1              GTACCTATTCCGGATTCTTTCAAATCCAGATTGTCGACTGCGGCTAATGC
C2              GTACCTATTCCGGATTCTTTCAAATCCAGATTGTCGACTGCGGCTAATGC
C3              GTACCTATTCCGGATTCTTTCAAATCCAGATTGTCGACTGCGGCTAATGC
C4              GTACCTATTCCGGATTCTTTCAAATCCAGATTGTCGACTGCGGCTAATGC
C5              GTACCTATTCCGGATTCTTTCAAATCCAGATTGTCGACTGCGGCTAATGC
C6              GTACCTATTCCGGATTCTTTCAAATCCAGATTGTCGACTGCGGCTAATGC
                **************************************************

C1              CATCGCT
C2              CATCGCT
C3              CATCGCT
C4              CATCGCT
C5              CATCGCT
C6              CATCGCT
                *******



>C1
TTGAAGCTCAACCAGTTTGGTGCCGCGATTGGGCTCCTGGCTACTGGTGC
GCTGTTGTCGGGCTGCGGCAGCGACAACAACGCAGCTGTAGGAAGTGCAC
GGACAGGCCCATCGTCAGGCCAGGTGAGCTGCGGTGGGAAGCCGACACTG
AAAGCTAGCGGGTCGACAGCCCAGGCCAACGCGATGACCCGCTTTGTTAA
TGCGTTCGAACGGTCATGTCCAGGACAGACGTTGAACTATACGGCTAATG
GTTCCGGTGCGGGGGTTAGCGAATTCAACGGTAATCAAACAGATTTCGGT
GGCTCAGACTCACCGTTGAGTAGGAAGGAGTATGCCGCAGCAGAGCAACG
TTGTGGCTCGCAGGCGTGGAATTTACCGGTGGTCTTCGGCCCCATCGCGA
TCACTTACAACGTGAACGGCCTGAGTTCACTGAACCTGGACGGTCCGACA
ACCGCGAAGATCTTCAATGGTTCCATCGCCAGTTGGAACGATCCCGCGAT
CCAAGCGCTGAACACTGGCGTCGCCCTTCCGGCTGAGCCGATTCATGTCG
TGTTCCGCAACGACGAGTCCGGTACCACGGATAATTTCCAGAGGTACCTT
GACGTCGCATCAAACGGTGAGTGGGGCAAAGGTATCGGCAAGACCTTTAA
AGGCGGTGTTGGTGAGGGTGCCAAGGGCAATGACGGTACGTCGGCGGCCG
TCAAGTCCACTGAAGGGTCGATCACCTACAACGAATGGTCGTTCGCTTCG
GCGCGGAAGCTGAACACGGCCAAGATCGCCACGTCGGCCGATCCAGAACC
CATTGCGATCAGCGTCGACTCGGTCGGCAAGACAATTTCTGGGGCTACGA
TCATTGGAGAGGGTAACGATTTAGTGCTTGACACGGTCTCGTTTTACAAG
CCGGCTCAGCCCGGCTCCTACCCAATCGTGCTGGCGACCTACGAGATTGT
CTGCTCGAAGTATCCCGATGCCCAGGTCGGTAGGGCTGTGAAGGCATTCC
TGCAGAGCACCATCGGTGGAGGCCAGAATGGCCTAGGGGACAACGGATAT
GTACCTATTCCGGATTCTTTCAAATCCAGATTGTCGACTGCGGCTAATGC
CATCGCT
>C2
TTGAAGCTCAACCAGTTTGGTGCCGCGATTGGGCTCCTGGCTACTGGTGC
GCTGTTGTCGGGCTGCGGCAGCGACAACAACGCAGCTGTAGGAAGTGCAC
GGACAGGCCCATCGTCAGGCCAGGTGAGCTGCGGTGGGAAGCCGACACTG
AAAGCTAGCGGGTCGACAGCCCAGGCCAACGCGATGACCCGCTTTGTTAA
TGCGTTCGAACGGTCATGTCCAGGACAGACGTTGAACTATACGGCTAATG
GTTCCGGTGCGGGGGTTAGCGAATTCAACGGTAATCAAACAGATTTCGGT
GGCTCAGACTCACCGTTGAGTAGGAAGGAGTATGCCGCAGCAGAGCAACG
TTGTGGCTCGCAGGCGTGGAATTTACCGGTGGTCTTCGGCCCCATCGCGA
TCACTTACAACGTGAACGGCCTGAGTTCACTGAACCTGGACGGTCCGACA
ACCGCGAAGATCTTCAATGGTTCCATCGCCAGTTGGAACGATCCCGCGAT
CCAAGCGCTGAACACTGGCGTCGCCCTTCCGGCTGAGCCGATTCATGTCG
TGTTCCGCAACGACGAGTCCGGTACCACGGATAATTTCCAGAGGTACCTT
GACGTCGCATCAAACGGTGAGTGGGGCAAAGGTATCGGCAAGACCTTTAA
AGGCGGTGTTGGTGAGGGTGCCAAGGGCAATGACGGTACGTCGGCGGCCG
TCAAGTCCACTGAAGGGTCGATCACCTACAACGAATGGTCGTTCGCTTCG
GCGCGGAAGCTGAACACGGCCAAGATCGCCACGTCGGCCGATCCAGAACC
CATTGCGATCAGCGTCGACTCGGTCGGCAAGACAATTTCTGGGGCTACGA
TCATTGGAGAGGGTAACGATTTAGTGCTTGACACGGTCTCGTTTTACAAG
CCGGCTCAGCCCGGCTCCTACCCAATCGTGCTGGCGACCTACGAGATTGT
CTGCTCGAAGTATCCCGATGCCCAGGTCGGTAGGGCTGTGAAGGCATTCC
TGCAGAGCACCATCGGTGGAGGCCAGAATGGCCTAGGGGACAACGGATAT
GTACCTATTCCGGATTCTTTCAAATCCAGATTGTCGACTGCGGCTAATGC
CATCGCT
>C3
TTGAAGCTCAACCAGTTTGGTGCCGCGATTGGGCTCCTGGCTACTGGTGC
GCTGTTGTCGGGCTGCGGCAGCGACAACAACGCAGCTGTAGGAAGTGCAC
GGACAGGCCCATCGTCAGGCCAGGTGAGCTGCGGTGGGAAGCCGACACTG
AAAGCTAGCGGGTCGACAGCCCAGGCCAACGCGATGACCCGCTTTGTTAA
TGCGTTCGAACGGTCATGTCCAGGACAGACGTTGAACTATACGGCTAATG
GTTCCGGTGCGGGGGTTAGCGAATTCAACGGTAATCAAACAGATTTCGGT
GGCTCAGACTCACCGTTGAGTAGGAAGGAGTATGCCGCAGCAGAGCAACG
TTGTGGCTCGCAGGCGTGGAATTTACCGGTGGTCTTCGGCCCCATCGCGA
TCACTTACAACGTGAACGGCCTGAGTTCACTGAACCTGGACGGTCCGACA
ACCGCGAAGATCTTCAATGGTTCCATCGCCAGTTGGAACGATCCCGCGAT
CCAAGCGCTGAACACTGGCGTCGCCCTTCCGGCTGAGCCGATTCATGTCG
TGTTCCGCAACGACGAGTCCGGTACCACGGATAATTTCCAGAGGTACCTT
GACGTCGCATCAAACGGTGAGTGGGGCAAAGGTATCGGCAAGACCTTTAA
AGGCGGTGTTGGTGAGGGTGCCAAGGGCAATGACGGTACGTCGGCGGCCG
TCAAGTCCACTGAAGGGTCGATCACCTACAACGAATGGTCGTTCGCTTCG
GCGCGGAAGCTGAACACGGCCAAGATCGCCACGTCGGCCGATCCAGAACC
CATTGCGATCAGCGTCGACTCGGTCGGCAAGACAATTTCTGGGGCTACGA
TCATTGGAGAGGGTAACGATTTAGTGCTTGACACGGTCTCGTTTTACAAG
CCGGCTCAGCCCGGCTCCTACCCAATCGTGCTGGCGACCTACGAGATTGT
CTGCTCGAAGTATCCCGATGCCCAGGTCGGTAGGGCTGTGAAGGCATTCC
TGCAGAGCACCATCGGTGGAGGCCAGAATGGCCTAGGGGACAACGGATAT
GTACCTATTCCGGATTCTTTCAAATCCAGATTGTCGACTGCGGCTAATGC
CATCGCT
>C4
TTGAAGCTCAACCAGTTTGGTGCCGCGATTGGGCTCCTGGCTACTGGTGC
GCTGTTGTCGGGCTGCGGCAGCGACAACAACGCAGCTGTAGGAAGTGCAC
GGACAGGCCCATCGTCAGGCCAGGTGAGCTGCGGTGGGAAGCCGACACTG
AAAGCTAGCGGGTCGACAGCCCAGGCCAACGCGATGACCCGCTTTGTTAA
TGCGTTCGAACGGTCATGTCCAGGACAGACGTTGAACTATACGGCTAATG
GTTCCGGTGCGGGGGTTAGCGAATTCAACGGTAATCAAACAGATTTCGGT
GGCTCAGACTCACCGTTGAGTAGGAAGGAGTATGCCGCAGCAGAGCAACG
TTGTGGCTCGCAGGCGTGGAATTTACCGGTGGTCTTCGGCCCCATCGCGA
TCACTTACAACGTGAACGGCCTGAGTTCACTGAACCTGGACGGTCCGACA
ACCGCGAAGATCTTCAATGGTTCCATCGCCAGTTGGAACGATCCCGCGAT
CCAAGCGCTGAACACTGGCGTCGCCCTTCCGGCTGAGCCGATTCATGTCG
TGTTCCGCAACGACGAGTCCGGTACCACGGATAATTTCCAGAGGTACCTT
GACGTCGCATCAAACGGTGAGTGGGGCAAAGGTATCGGCAAGACCTTTAA
AGGCGGTGTTGGTGAGGGTGCCAAGGGCAATGACGGTACGTCGGCGGCCG
TCAAGTCCACTGAAGGGTCGATCACCTACAACGAATGGTCGTTCGCTTCG
GCGCGGAAGCTGAACACGGCCAAGATCGCCACGTCGGCCGATCCAGAACC
CATTGCGATCAGCGTCGACTCGGTCGGCAAGACAATTTCTGGGGCTACGA
TCATTGGAGAGGGTAACGATTTAGTGCTTGACACGGTCTCGTTTTACAAG
CCGGCTCAGCCCGGCTCCTACCCAATCGTGCTGGCGACCTACGAGATTGT
CTGCTCGAAGTATCCCGATGCCCAGGTCGGTAGGGCTGTGAAGGCATTCC
TGCAGAGCACCATCGGTGGAGGCCAGAATGGCCTAGGGGACAACGGATAT
GTACCTATTCCGGATTCTTTCAAATCCAGATTGTCGACTGCGGCTAATGC
CATCGCT
>C5
TTGAAGCTCAACCAGTTTGGTGCCGCGATTGGGCTCCTGGCTACTGGTGC
GCTGTTGTCGGGCTGCGGCAGCGACAACAACGCAGCTGTAGGAAGTGCAC
GGACAGGCCCATCGTCAGGCCAGGTGAGCTGCGGTGGGAAGCCGACACTG
AAAGCTAGCGGGTCGACAGCCCAGGCCAACGCGATGACCCGCTTTGTTAA
TGCGTTCGAACGGTCATGTCCAGGACAGACGTTGAACTATACGGCTAATG
GTTCCGGTGCGGGGGTTAGCGAATTCAACGGTAATCAAACAGATTTCGGT
GGCTCAGACTCACCGTTGAGTAGGAAGGAGTATGCCGCAGCAGAGCAACG
TTGTGGCTCGCAGGCGTGGAATTTACCGGTGGTCTTCGGCCCCATCGCGA
TCACTTACAACGTGAACGGCCTGAGTTCACTGAACCTGGACGGTCCGACA
ACCGCGAAGATCTTCAATGGTTCCATCGCCAGTTGGAACGATCCCGCGAT
CCAAGCGCTGAACACTGGCGTCGCCCTTCCGGCTGAGCCGATTCATGTCG
TGTTCCGCAACGACGAGTCCGGTACCACGGATAATTTCCAGAGGTACCTT
GACGTCGCATCAAACGGTGAGTGGGGCAAAGGTATCGGCAAGACCTTTAA
AGGCGGTGTTGGTGAGGGTGCCAAGGGCAATGACGGTACGTCGGCGGCCG
TCAAGTCCACTGAAGGGTCGATCACCTACAACGAATGGTCGTTCGCTTCG
GCGCGGAAGCTGAACACGGCCAAGATCGCCACGTCGGCCGATCCAGAACC
CATTGCGATCAGCGTCGACTCGGTCGGCAAGACAATTTCTGGGGCTACGA
TCATTGGAGAGGGTAACGATTTAGTGCTTGACACGGTCTCGTTTTACAAG
CCGGCTCAGCCCGGCTCCTACCCAATCGTGCTGGCGACCTACGAGATTGT
CTGCTCGAAGTATCCCGATGCCCAGGTCGGTAGGGCTGTGAAGGCATTCC
TGCAGAGCACCATCGGTGGAGGCCAGAATGGCCTAGGGGACAACGGATAT
GTACCTATTCCGGATTCTTTCAAATCCAGATTGTCGACTGCGGCTAATGC
CATCGCT
>C6
TTGAAGCTCAACCAGTTTGGTGCCGCGATTGGGCTCCTGGCTACTGGTGC
GCTGTTGTCGGGCTGCGGCAGCGACAACAACGCAGCTGTAGGAAGTGCAC
GGACAGGCCCATCGTCAGGCCAGGTGAGCTGCGGTGGGAAGCCGACACTG
AAAGCTAGCGGGTCGACAGCCCAGGCCAACGCGATGACCCGCTTTGTTAA
TGCGTTCGAACGGTCATGTCCAGGACAGACGTTGAACTATACGGCTAATG
GTTCCGGTGCGGGGGTTAGCGAATTCAACGGTAATCAAACAGATTTCGGT
GGCTCAGACTCACCGTTGAGTAGGAAGGAGTATGCCGCAGCAGAGCAACG
TTGTGGCTCGCAGGCGTGGAATTTACCGGTGGTCTTCGGCCCCATCGCGA
TCACTTACAACGTGAACGGCCTGAGTTCACTGAACCTGGACGGTCCGACA
ACCGCGAAGATCTTCAATGGTTCCATCGCCAGTTGGAACGATCCCGCGAT
CCAAGCGCTGAACACTGGCGTCGCCCTTCCGGCTGAGCCGATTCATGTCG
TGTTCCGCAACGACGAGTCCGGTACCACGGATAATTTCCAGAGGTACCTT
GACGTCGCATCAAACGGTGAGTGGGGCAAAGGTATCGGCAAGACCTTTAA
AGGCGGTGTTGGTGAGGGTGCCAAGGGCAATGACGGTACGTCGGCGGCCG
TCAAGTCCACTGAAGGGTCGATCACCTACAACGAATGGTCGTTCGCTTCG
GCGCGGAAGCTGAACACGGCCAAGATCGCCACGTCGGCCGATCCAGAACC
CATTGCGATCAGCGTCGACTCGGTCGGCAAGACAATTTCTGGGGCTACGA
TCATTGGAGAGGGTAACGATTTAGTGCTTGACACGGTCTCGTTTTACAAG
CCGGCTCAGCCCGGCTCCTACCCAATCGTGCTGGCGACCTACGAGATTGT
CTGCTCGAAGTATCCCGATGCCCAGGTCGGTAGGGCTGTGAAGGCATTCC
TGCAGAGCACCATCGGTGGAGGCCAGAATGGCCTAGGGGACAACGGATAT
GTACCTATTCCGGATTCTTTCAAATCCAGATTGTCGACTGCGGCTAATGC
CATCGCT
>C1
LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
VPIPDSFKSRLSTAANAIA
>C2
LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
VPIPDSFKSRLSTAANAIA
>C3
LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
VPIPDSFKSRLSTAANAIA
>C4
LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
VPIPDSFKSRLSTAANAIA
>C5
LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
VPIPDSFKSRLSTAANAIA
>C6
LKLNQFGAAIGLLATGALLSGCGSDNNAAVGSARTGPSSGQVSCGGKPTL
KASGSTAQANAMTRFVNAFERSCPGQTLNYTANGSGAGVSEFNGNQTDFG
GSDSPLSRKEYAAAEQRCGSQAWNLPVVFGPIAITYNVNGLSSLNLDGPT
TAKIFNGSIASWNDPAIQALNTGVALPAEPIHVVFRNDESGTTDNFQRYL
DVASNGEWGKGIGKTFKGGVGEGAKGNDGTSAAVKSTEGSITYNEWSFAS
ARKLNTAKIATSADPEPIAISVDSVGKTISGATIIGEGNDLVLDTVSFYK
PAQPGSYPIVLATYEIVCSKYPDAQVGRAVKAFLQSTIGGGQNGLGDNGY
VPIPDSFKSRLSTAANAIA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/phoS2/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1107 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579785551
      Setting output file names to "/data/10res/phoS2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1061074397
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9123789776
      Seed = 159736951
      Swapseed = 1579785551
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2477.518928 -- -24.965149
         Chain 2 -- -2477.519070 -- -24.965149
         Chain 3 -- -2477.518928 -- -24.965149
         Chain 4 -- -2477.518928 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2477.519070 -- -24.965149
         Chain 2 -- -2477.518693 -- -24.965149
         Chain 3 -- -2477.518693 -- -24.965149
         Chain 4 -- -2477.518693 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2477.519] (-2477.519) (-2477.519) (-2477.519) * [-2477.519] (-2477.519) (-2477.519) (-2477.519) 
        500 -- (-1533.201) [-1532.093] (-1533.823) (-1536.228) * [-1528.162] (-1536.173) (-1539.954) (-1537.288) -- 0:00:00
       1000 -- (-1531.796) (-1535.791) (-1537.719) [-1532.946] * (-1536.964) (-1532.097) [-1528.097] (-1533.168) -- 0:00:00
       1500 -- (-1529.185) [-1537.430] (-1531.481) (-1533.084) * (-1532.645) [-1531.220] (-1532.672) (-1530.459) -- 0:00:00
       2000 -- (-1533.776) [-1532.722] (-1539.690) (-1534.466) * [-1534.388] (-1535.960) (-1530.933) (-1541.677) -- 0:00:00
       2500 -- [-1534.855] (-1540.714) (-1534.255) (-1538.857) * (-1537.926) [-1537.021] (-1542.839) (-1528.066) -- 0:00:00
       3000 -- (-1528.534) (-1541.765) (-1535.331) [-1532.683] * (-1537.122) [-1531.470] (-1534.714) (-1528.412) -- 0:00:00
       3500 -- (-1530.365) (-1531.681) (-1535.227) [-1531.378] * (-1534.758) (-1531.151) (-1531.394) [-1537.559] -- 0:00:00
       4000 -- (-1534.254) (-1530.392) (-1534.712) [-1539.223] * (-1534.218) (-1536.313) [-1527.493] (-1536.914) -- 0:00:00
       4500 -- (-1535.247) (-1530.364) [-1531.104] (-1527.065) * (-1535.959) (-1532.277) (-1538.276) [-1532.005] -- 0:00:00
       5000 -- (-1533.717) (-1529.174) [-1532.627] (-1532.611) * (-1535.607) (-1534.540) [-1536.395] (-1530.314) -- 0:00:00

      Average standard deviation of split frequencies: 0.122975

       5500 -- (-1534.128) [-1537.733] (-1530.576) (-1539.447) * [-1527.375] (-1535.068) (-1533.020) (-1532.616) -- 0:00:00
       6000 -- [-1533.303] (-1530.034) (-1538.802) (-1538.774) * (-1531.448) (-1534.645) (-1527.655) [-1532.702] -- 0:00:00
       6500 -- [-1533.464] (-1531.842) (-1535.678) (-1530.353) * (-1531.210) (-1536.629) (-1532.852) [-1534.814] -- 0:00:00
       7000 -- [-1532.747] (-1535.074) (-1533.225) (-1536.922) * (-1534.688) (-1532.390) [-1528.788] (-1537.555) -- 0:00:00
       7500 -- [-1537.532] (-1538.382) (-1532.248) (-1534.263) * (-1533.505) (-1535.899) (-1538.753) [-1534.822] -- 0:00:00
       8000 -- [-1529.714] (-1543.218) (-1530.241) (-1535.255) * [-1528.761] (-1535.106) (-1530.377) (-1530.564) -- 0:02:04
       8500 -- [-1530.124] (-1537.907) (-1531.712) (-1537.109) * (-1531.422) [-1531.526] (-1538.470) (-1528.491) -- 0:01:56
       9000 -- (-1536.605) (-1539.607) [-1534.556] (-1538.632) * (-1545.073) (-1532.485) [-1533.349] (-1532.306) -- 0:01:50
       9500 -- [-1528.616] (-1542.523) (-1539.425) (-1536.119) * (-1532.679) [-1535.279] (-1532.204) (-1545.549) -- 0:01:44
      10000 -- (-1540.364) (-1528.681) (-1542.603) [-1529.298] * (-1537.746) (-1530.859) (-1533.566) [-1531.231] -- 0:01:39

      Average standard deviation of split frequencies: 0.072920

      10500 -- [-1531.286] (-1535.353) (-1540.990) (-1532.610) * (-1534.492) [-1539.339] (-1537.772) (-1537.116) -- 0:01:34
      11000 -- [-1531.082] (-1534.684) (-1533.488) (-1545.932) * (-1540.392) [-1531.382] (-1528.691) (-1530.712) -- 0:01:29
      11500 -- (-1538.392) (-1538.768) [-1533.979] (-1535.399) * (-1544.575) (-1533.524) [-1531.743] (-1534.104) -- 0:01:25
      12000 -- (-1529.938) [-1530.743] (-1531.012) (-1531.966) * (-1538.572) (-1534.137) [-1537.203] (-1529.408) -- 0:01:22
      12500 -- (-1548.658) (-1534.724) (-1539.711) [-1537.948] * (-1535.064) [-1538.289] (-1534.229) (-1534.729) -- 0:01:19
      13000 -- (-1543.515) [-1529.801] (-1532.761) (-1539.924) * (-1531.353) [-1536.061] (-1535.866) (-1537.270) -- 0:01:15
      13500 -- (-1540.401) (-1531.868) (-1539.321) [-1528.492] * (-1534.172) [-1528.639] (-1532.578) (-1537.522) -- 0:01:13
      14000 -- (-1542.132) (-1531.975) (-1535.453) [-1534.702] * [-1534.502] (-1536.184) (-1537.021) (-1530.616) -- 0:01:10
      14500 -- (-1532.534) (-1534.223) [-1530.294] (-1544.183) * [-1531.775] (-1537.577) (-1533.600) (-1535.388) -- 0:01:07
      15000 -- (-1533.814) (-1528.841) [-1524.297] (-1533.985) * [-1529.300] (-1536.602) (-1531.049) (-1538.533) -- 0:01:05

      Average standard deviation of split frequencies: 0.057452

      15500 -- (-1531.881) (-1529.831) [-1525.536] (-1534.850) * [-1530.467] (-1532.717) (-1542.760) (-1538.912) -- 0:01:03
      16000 -- (-1538.982) [-1532.175] (-1524.560) (-1529.058) * (-1538.291) (-1529.707) [-1536.409] (-1531.922) -- 0:01:01
      16500 -- (-1539.683) (-1532.247) (-1525.384) [-1545.168] * (-1532.339) (-1530.456) (-1533.859) [-1530.079] -- 0:00:59
      17000 -- (-1531.837) (-1529.225) (-1525.288) [-1529.555] * (-1532.497) (-1533.676) (-1533.002) [-1532.205] -- 0:00:57
      17500 -- (-1542.195) [-1535.405] (-1529.244) (-1538.971) * (-1537.312) (-1538.780) [-1531.442] (-1531.395) -- 0:00:56
      18000 -- [-1529.836] (-1538.751) (-1526.971) (-1541.104) * [-1531.463] (-1531.299) (-1532.151) (-1530.447) -- 0:00:54
      18500 -- (-1528.805) (-1537.434) [-1526.216] (-1534.467) * (-1529.828) (-1535.532) [-1532.348] (-1531.679) -- 0:00:53
      19000 -- [-1536.589] (-1526.030) (-1525.653) (-1533.531) * [-1532.867] (-1537.387) (-1532.091) (-1535.106) -- 0:00:51
      19500 -- [-1526.716] (-1535.690) (-1523.737) (-1528.480) * (-1538.035) [-1529.660] (-1533.048) (-1530.602) -- 0:00:50
      20000 -- [-1531.256] (-1537.309) (-1523.113) (-1530.269) * (-1528.442) (-1533.380) [-1530.999] (-1535.695) -- 0:00:49

      Average standard deviation of split frequencies: 0.036749

      20500 -- (-1533.062) (-1531.551) (-1523.088) [-1526.831] * [-1533.262] (-1536.963) (-1533.385) (-1533.375) -- 0:00:47
      21000 -- (-1536.193) [-1533.332] (-1523.994) (-1533.128) * (-1538.481) (-1535.841) (-1533.237) [-1536.879] -- 0:00:46
      21500 -- (-1536.922) (-1532.358) [-1523.205] (-1538.036) * (-1537.377) (-1532.989) [-1530.753] (-1540.917) -- 0:00:45
      22000 -- [-1534.931] (-1529.336) (-1523.669) (-1537.709) * (-1537.651) [-1542.533] (-1527.654) (-1533.937) -- 0:00:44
      22500 -- (-1541.218) (-1533.404) (-1525.416) [-1525.187] * (-1537.328) (-1532.004) (-1533.558) [-1535.875] -- 0:00:43
      23000 -- [-1532.227] (-1532.635) (-1525.747) (-1525.920) * (-1536.853) (-1533.569) (-1532.711) [-1534.020] -- 0:01:24
      23500 -- [-1527.722] (-1537.357) (-1525.528) (-1527.343) * (-1532.038) [-1531.332] (-1528.991) (-1531.764) -- 0:01:23
      24000 -- (-1537.237) (-1531.665) (-1525.316) [-1523.909] * [-1533.489] (-1535.500) (-1527.950) (-1539.746) -- 0:01:21
      24500 -- (-1529.850) [-1532.297] (-1523.827) (-1523.510) * (-1535.622) [-1535.910] (-1525.162) (-1528.532) -- 0:01:19
      25000 -- (-1531.960) (-1538.036) (-1523.631) [-1527.029] * (-1534.769) (-1533.967) [-1522.797] (-1534.512) -- 0:01:18

      Average standard deviation of split frequencies: 0.039558

      25500 -- (-1535.636) (-1536.037) [-1525.344] (-1528.240) * (-1532.013) (-1533.507) [-1522.847] (-1528.961) -- 0:01:16
      26000 -- (-1537.169) [-1534.861] (-1525.837) (-1524.402) * (-1543.030) (-1537.043) [-1525.093] (-1527.735) -- 0:01:14
      26500 -- (-1536.598) (-1537.148) [-1524.889] (-1522.846) * (-1532.032) (-1529.096) [-1522.191] (-1527.398) -- 0:01:13
      27000 -- [-1530.161] (-1533.286) (-1524.737) (-1523.945) * (-1537.688) (-1530.890) [-1522.769] (-1525.143) -- 0:01:12
      27500 -- (-1530.638) [-1530.956] (-1526.409) (-1525.059) * [-1531.768] (-1531.643) (-1522.745) (-1523.072) -- 0:01:10
      28000 -- (-1530.914) (-1535.452) [-1523.017] (-1523.031) * (-1538.066) (-1534.176) (-1522.745) [-1524.870] -- 0:01:09
      28500 -- (-1530.766) [-1530.236] (-1523.455) (-1530.122) * (-1529.082) (-1537.098) [-1522.879] (-1524.461) -- 0:01:08
      29000 -- (-1536.335) (-1531.156) [-1524.580] (-1526.348) * (-1529.873) (-1536.901) [-1523.435] (-1528.146) -- 0:01:06
      29500 -- [-1528.445] (-1530.927) (-1524.823) (-1527.039) * [-1532.834] (-1546.479) (-1522.991) (-1524.689) -- 0:01:05
      30000 -- (-1536.507) (-1531.158) [-1524.447] (-1523.786) * [-1538.264] (-1527.774) (-1522.967) (-1526.035) -- 0:01:04

      Average standard deviation of split frequencies: 0.035422

      30500 -- (-1535.017) [-1537.912] (-1525.506) (-1524.556) * (-1532.964) [-1537.977] (-1524.103) (-1523.057) -- 0:01:03
      31000 -- (-1536.756) [-1531.204] (-1529.234) (-1525.970) * (-1534.245) (-1540.036) [-1525.526] (-1524.135) -- 0:01:02
      31500 -- (-1534.378) [-1527.655] (-1526.266) (-1526.954) * [-1532.588] (-1531.955) (-1523.174) (-1523.489) -- 0:01:01
      32000 -- (-1536.724) (-1533.660) [-1525.762] (-1524.018) * (-1535.246) (-1536.532) [-1523.625] (-1525.787) -- 0:01:00
      32500 -- [-1538.826] (-1533.203) (-1525.413) (-1523.841) * (-1528.178) (-1539.782) (-1525.723) [-1526.925] -- 0:00:59
      33000 -- [-1532.829] (-1534.754) (-1525.299) (-1524.088) * [-1534.350] (-1532.838) (-1524.719) (-1525.581) -- 0:00:58
      33500 -- [-1535.084] (-1543.146) (-1525.310) (-1524.058) * (-1538.318) (-1532.599) (-1523.581) [-1523.840] -- 0:00:57
      34000 -- (-1529.814) [-1534.226] (-1524.779) (-1523.100) * (-1539.747) (-1535.521) (-1527.960) [-1524.450] -- 0:00:56
      34500 -- (-1534.429) (-1537.712) [-1523.618] (-1523.101) * (-1537.925) [-1532.256] (-1525.546) (-1523.662) -- 0:00:55
      35000 -- [-1531.961] (-1537.356) (-1524.796) (-1523.387) * [-1527.331] (-1537.932) (-1527.740) (-1524.686) -- 0:00:55

      Average standard deviation of split frequencies: 0.029760

      35500 -- (-1536.900) (-1532.096) [-1525.652] (-1522.938) * (-1538.394) (-1540.912) [-1528.869] (-1523.412) -- 0:00:54
      36000 -- [-1527.809] (-1534.101) (-1525.093) (-1522.959) * [-1535.783] (-1544.340) (-1525.733) (-1523.619) -- 0:00:53
      36500 -- (-1538.217) (-1531.115) [-1524.606] (-1522.706) * (-1532.699) (-1522.862) (-1524.129) [-1523.745] -- 0:00:52
      37000 -- (-1538.669) [-1527.777] (-1524.309) (-1526.129) * (-1532.557) (-1527.962) (-1523.509) [-1523.224] -- 0:00:52
      37500 -- (-1540.370) (-1529.209) [-1525.953] (-1525.577) * (-1534.513) [-1526.002] (-1523.985) (-1522.804) -- 0:00:51
      38000 -- (-1537.644) (-1532.450) [-1525.548] (-1525.059) * [-1538.116] (-1526.941) (-1522.491) (-1522.804) -- 0:01:15
      38500 -- (-1537.562) [-1535.031] (-1527.711) (-1525.061) * (-1533.524) (-1524.491) (-1524.714) [-1524.045] -- 0:01:14
      39000 -- [-1535.027] (-1538.070) (-1525.398) (-1525.049) * (-1536.698) (-1523.573) (-1523.215) [-1522.605] -- 0:01:13
      39500 -- (-1529.373) (-1533.527) [-1524.592] (-1525.208) * [-1530.739] (-1522.569) (-1522.680) (-1527.188) -- 0:01:12
      40000 -- (-1540.089) (-1535.097) (-1523.478) [-1525.968] * (-1535.624) (-1523.359) [-1525.209] (-1523.851) -- 0:01:12

      Average standard deviation of split frequencies: 0.029808

      40500 -- (-1533.198) (-1535.482) [-1528.909] (-1525.732) * (-1532.563) [-1522.828] (-1524.543) (-1525.763) -- 0:01:11
      41000 -- [-1533.724] (-1531.781) (-1523.487) (-1523.844) * (-1533.627) (-1524.141) (-1523.997) [-1525.827] -- 0:01:10
      41500 -- [-1533.832] (-1538.053) (-1523.155) (-1525.395) * (-1532.910) (-1524.048) (-1524.922) [-1524.266] -- 0:01:09
      42000 -- [-1532.131] (-1536.387) (-1524.179) (-1524.791) * (-1537.491) (-1524.079) (-1522.727) [-1523.046] -- 0:01:08
      42500 -- (-1535.056) (-1537.986) (-1524.548) [-1525.819] * (-1536.009) (-1522.817) [-1523.222] (-1524.727) -- 0:01:07
      43000 -- (-1532.916) [-1539.896] (-1525.078) (-1526.165) * (-1538.319) (-1522.277) [-1522.559] (-1524.803) -- 0:01:06
      43500 -- [-1531.132] (-1537.003) (-1526.441) (-1526.074) * [-1528.977] (-1522.780) (-1523.645) (-1525.846) -- 0:01:05
      44000 -- [-1535.999] (-1527.978) (-1523.886) (-1523.712) * [-1535.761] (-1522.978) (-1524.853) (-1526.660) -- 0:01:05
      44500 -- (-1529.321) (-1527.526) (-1524.029) [-1522.955] * (-1529.988) [-1524.339] (-1525.960) (-1523.990) -- 0:01:04
      45000 -- (-1539.099) (-1527.373) [-1523.875] (-1525.749) * [-1534.931] (-1526.350) (-1523.594) (-1524.786) -- 0:01:03

      Average standard deviation of split frequencies: 0.029853

      45500 -- (-1533.791) [-1525.696] (-1522.915) (-1525.222) * [-1530.778] (-1525.684) (-1524.113) (-1524.452) -- 0:01:02
      46000 -- [-1532.899] (-1525.717) (-1523.179) (-1523.672) * (-1532.227) [-1524.958] (-1524.154) (-1526.736) -- 0:01:02
      46500 -- (-1538.146) (-1522.761) (-1523.256) [-1524.524] * (-1534.648) (-1524.958) (-1523.415) [-1525.526] -- 0:01:01
      47000 -- (-1533.909) (-1522.763) [-1523.909] (-1522.573) * [-1536.574] (-1522.693) (-1523.554) (-1523.148) -- 0:01:00
      47500 -- (-1536.469) [-1524.457] (-1523.177) (-1522.165) * (-1530.501) (-1523.533) (-1524.511) [-1523.268] -- 0:01:00
      48000 -- [-1533.090] (-1522.767) (-1522.709) (-1522.366) * (-1535.011) (-1526.142) [-1525.483] (-1524.062) -- 0:00:59
      48500 -- [-1532.876] (-1525.350) (-1523.571) (-1522.366) * (-1531.536) (-1523.108) (-1524.025) [-1527.032] -- 0:00:58
      49000 -- (-1539.248) [-1523.965] (-1526.622) (-1522.384) * (-1529.019) (-1523.278) (-1525.632) [-1526.185] -- 0:00:58
      49500 -- (-1534.620) [-1525.751] (-1523.359) (-1522.365) * (-1538.463) [-1524.003] (-1526.418) (-1526.025) -- 0:00:57
      50000 -- [-1532.863] (-1524.068) (-1522.564) (-1522.282) * (-1536.668) [-1524.484] (-1526.806) (-1523.518) -- 0:00:57

      Average standard deviation of split frequencies: 0.024368

      50500 -- (-1534.989) (-1523.709) [-1525.552] (-1526.984) * [-1531.364] (-1524.379) (-1528.450) (-1523.506) -- 0:00:56
      51000 -- (-1524.970) (-1523.666) (-1524.059) [-1523.455] * (-1535.102) (-1524.933) (-1529.841) [-1523.556] -- 0:00:55
      51500 -- [-1523.477] (-1523.590) (-1523.537) (-1523.089) * (-1539.509) (-1525.224) (-1524.924) [-1526.282] -- 0:00:55
      52000 -- (-1523.388) [-1523.482] (-1523.767) (-1522.603) * (-1533.208) (-1524.897) (-1528.220) [-1525.674] -- 0:00:54
      52500 -- (-1523.405) [-1523.255] (-1523.292) (-1522.749) * (-1534.742) (-1526.746) [-1527.265] (-1524.890) -- 0:00:54
      53000 -- (-1523.870) (-1523.507) (-1523.452) [-1522.780] * (-1538.343) (-1522.732) (-1523.987) [-1524.865] -- 0:01:11
      53500 -- (-1525.573) (-1525.890) (-1525.066) [-1523.509] * (-1542.557) [-1523.536] (-1523.993) (-1524.051) -- 0:01:10
      54000 -- (-1524.635) (-1525.632) [-1523.357] (-1524.122) * (-1538.268) (-1525.245) [-1526.036] (-1523.183) -- 0:01:10
      54500 -- (-1524.602) (-1522.950) [-1524.114] (-1523.963) * (-1535.241) (-1526.781) (-1524.703) [-1526.831] -- 0:01:09
      55000 -- (-1525.929) (-1523.216) (-1525.866) [-1522.809] * (-1533.978) [-1525.536] (-1527.045) (-1527.132) -- 0:01:08

      Average standard deviation of split frequencies: 0.025254

      55500 -- [-1525.033] (-1524.876) (-1524.130) (-1522.970) * (-1537.800) [-1526.053] (-1533.270) (-1524.341) -- 0:01:08
      56000 -- (-1525.410) (-1527.351) [-1523.995] (-1522.715) * (-1524.489) (-1524.614) (-1532.987) [-1523.465] -- 0:01:07
      56500 -- [-1524.657] (-1526.894) (-1524.619) (-1522.774) * (-1525.590) (-1524.211) [-1523.505] (-1525.624) -- 0:01:06
      57000 -- (-1523.877) (-1528.567) (-1523.690) [-1524.489] * (-1525.893) [-1523.510] (-1524.380) (-1526.752) -- 0:01:06
      57500 -- (-1524.494) (-1526.643) [-1523.115] (-1522.681) * (-1527.261) [-1523.925] (-1523.728) (-1525.480) -- 0:01:05
      58000 -- (-1524.995) (-1527.544) (-1523.333) [-1523.023] * (-1528.320) [-1526.895] (-1523.501) (-1522.102) -- 0:01:04
      58500 -- [-1524.276] (-1528.893) (-1522.494) (-1522.047) * [-1523.572] (-1523.101) (-1523.944) (-1523.588) -- 0:01:04
      59000 -- (-1524.126) (-1526.707) (-1523.362) [-1522.249] * (-1523.625) [-1523.359] (-1525.059) (-1523.318) -- 0:01:03
      59500 -- (-1523.925) (-1528.770) (-1531.822) [-1523.764] * (-1524.592) (-1523.964) [-1522.695] (-1522.714) -- 0:01:03
      60000 -- (-1525.905) (-1526.380) (-1526.338) [-1522.352] * (-1522.822) (-1523.847) [-1525.465] (-1522.533) -- 0:01:02

      Average standard deviation of split frequencies: 0.024791

      60500 -- (-1523.165) (-1527.886) [-1527.841] (-1524.434) * (-1522.770) (-1523.485) (-1525.536) [-1523.898] -- 0:01:02
      61000 -- (-1523.643) (-1527.886) (-1524.836) [-1523.918] * (-1524.366) (-1523.451) [-1524.149] (-1522.299) -- 0:01:01
      61500 -- (-1527.562) [-1525.210] (-1523.694) (-1525.061) * (-1523.943) (-1522.733) [-1525.749] (-1522.471) -- 0:01:01
      62000 -- (-1529.206) (-1523.797) [-1525.350] (-1525.867) * (-1525.173) [-1523.395] (-1525.159) (-1528.383) -- 0:01:00
      62500 -- (-1525.938) (-1523.214) (-1525.218) [-1524.266] * [-1522.959] (-1523.859) (-1524.121) (-1533.537) -- 0:01:00
      63000 -- (-1524.171) (-1523.566) [-1523.834] (-1525.700) * (-1529.139) (-1525.326) (-1524.901) [-1532.618] -- 0:00:59
      63500 -- (-1523.999) (-1523.097) (-1524.877) [-1523.110] * (-1529.372) (-1526.920) [-1522.458] (-1532.097) -- 0:00:58
      64000 -- (-1524.909) (-1525.167) [-1525.429] (-1525.451) * (-1526.275) (-1527.028) (-1522.973) [-1529.469] -- 0:00:58
      64500 -- [-1522.378] (-1525.022) (-1525.399) (-1522.815) * (-1526.623) (-1527.628) [-1526.208] (-1527.454) -- 0:00:58
      65000 -- (-1522.377) [-1524.916] (-1524.007) (-1523.627) * [-1531.918] (-1529.144) (-1523.771) (-1523.615) -- 0:00:57

      Average standard deviation of split frequencies: 0.021768

      65500 -- [-1525.413] (-1524.197) (-1526.606) (-1523.385) * (-1535.160) (-1524.645) (-1523.833) [-1523.615] -- 0:00:57
      66000 -- (-1526.683) [-1525.669] (-1528.855) (-1522.724) * (-1535.279) (-1522.408) [-1523.479] (-1524.791) -- 0:00:56
      66500 -- [-1523.367] (-1526.292) (-1523.666) (-1523.160) * (-1530.569) [-1523.978] (-1524.784) (-1527.464) -- 0:00:56
      67000 -- [-1524.315] (-1525.269) (-1523.887) (-1526.910) * (-1526.989) [-1524.108] (-1527.245) (-1525.641) -- 0:00:55
      67500 -- [-1524.291] (-1525.794) (-1527.115) (-1525.901) * (-1528.650) (-1529.500) [-1525.973] (-1522.960) -- 0:00:55
      68000 -- [-1523.207] (-1523.242) (-1524.629) (-1525.257) * (-1524.371) (-1523.280) [-1523.066] (-1523.262) -- 0:00:54
      68500 -- [-1523.367] (-1523.146) (-1523.386) (-1526.604) * (-1525.123) (-1524.532) [-1522.499] (-1523.307) -- 0:01:07
      69000 -- [-1525.182] (-1522.567) (-1525.693) (-1527.972) * (-1525.596) [-1526.755] (-1523.779) (-1523.456) -- 0:01:07
      69500 -- (-1523.130) (-1527.221) (-1524.394) [-1523.210] * [-1523.402] (-1523.133) (-1524.759) (-1527.949) -- 0:01:06
      70000 -- (-1523.153) [-1524.788] (-1522.195) (-1524.148) * (-1523.727) (-1524.377) (-1525.732) [-1523.692] -- 0:01:06

      Average standard deviation of split frequencies: 0.020012

      70500 -- (-1523.100) (-1524.858) (-1523.506) [-1523.253] * (-1523.727) [-1523.470] (-1525.699) (-1525.069) -- 0:01:05
      71000 -- (-1524.511) [-1527.666] (-1523.928) (-1523.388) * (-1522.640) (-1525.137) [-1525.020] (-1523.790) -- 0:01:05
      71500 -- [-1523.575] (-1525.896) (-1523.700) (-1528.176) * [-1523.318] (-1525.087) (-1527.645) (-1528.468) -- 0:01:04
      72000 -- (-1523.233) [-1523.741] (-1526.443) (-1523.557) * (-1523.301) [-1524.917] (-1525.914) (-1527.858) -- 0:01:04
      72500 -- [-1526.017] (-1524.149) (-1523.897) (-1523.190) * (-1523.301) (-1523.634) (-1528.593) [-1527.726] -- 0:01:03
      73000 -- (-1523.102) (-1524.904) [-1523.291] (-1526.086) * (-1523.254) (-1524.235) (-1524.622) [-1523.379] -- 0:01:03
      73500 -- (-1524.529) (-1524.439) [-1525.784] (-1525.729) * (-1522.997) (-1523.671) (-1527.355) [-1523.081] -- 0:01:03
      74000 -- (-1527.665) (-1522.749) (-1525.408) [-1524.667] * (-1523.339) (-1523.684) (-1533.229) [-1526.887] -- 0:01:02
      74500 -- (-1524.297) [-1523.302] (-1525.717) (-1523.408) * (-1524.148) [-1524.780] (-1534.274) (-1523.197) -- 0:01:02
      75000 -- (-1524.514) (-1524.420) [-1525.886] (-1522.439) * (-1524.015) (-1523.510) [-1524.241] (-1524.442) -- 0:01:01

      Average standard deviation of split frequencies: 0.023462

      75500 -- [-1522.713] (-1526.698) (-1526.597) (-1522.439) * (-1526.622) [-1523.278] (-1522.647) (-1524.469) -- 0:01:01
      76000 -- [-1524.090] (-1528.374) (-1523.225) (-1523.614) * (-1523.993) (-1526.760) [-1523.742] (-1524.988) -- 0:01:00
      76500 -- (-1524.881) (-1523.331) [-1523.513] (-1525.178) * (-1528.557) [-1524.682] (-1522.255) (-1526.857) -- 0:01:00
      77000 -- (-1525.002) [-1524.332] (-1527.058) (-1525.178) * (-1522.606) (-1523.702) [-1524.282] (-1525.275) -- 0:00:59
      77500 -- (-1526.045) (-1528.223) [-1527.339] (-1526.156) * (-1522.463) (-1525.674) [-1523.416] (-1524.652) -- 0:00:59
      78000 -- (-1526.045) [-1523.803] (-1527.373) (-1527.795) * [-1523.392] (-1527.315) (-1522.541) (-1523.394) -- 0:00:59
      78500 -- [-1523.082] (-1528.015) (-1526.391) (-1525.169) * (-1523.694) (-1526.952) (-1522.185) [-1523.345] -- 0:00:58
      79000 -- (-1523.783) [-1525.167] (-1525.367) (-1523.784) * (-1529.025) (-1526.086) [-1522.415] (-1524.216) -- 0:00:58
      79500 -- [-1524.645] (-1523.794) (-1525.375) (-1522.678) * (-1529.375) (-1523.257) (-1522.416) [-1522.685] -- 0:00:57
      80000 -- (-1527.722) [-1523.734] (-1524.648) (-1523.763) * (-1527.043) [-1523.456] (-1526.872) (-1524.024) -- 0:00:57

      Average standard deviation of split frequencies: 0.020454

      80500 -- (-1527.826) (-1523.578) (-1524.330) [-1522.706] * (-1527.481) (-1523.633) (-1528.782) [-1524.041] -- 0:00:57
      81000 -- (-1527.532) (-1527.170) (-1523.818) [-1526.187] * (-1525.336) (-1524.312) (-1528.293) [-1524.593] -- 0:00:56
      81500 -- [-1522.993] (-1527.815) (-1524.511) (-1525.016) * [-1524.148] (-1526.647) (-1530.320) (-1524.690) -- 0:00:56
      82000 -- [-1522.912] (-1523.802) (-1524.535) (-1523.675) * (-1524.193) (-1524.925) (-1523.878) [-1523.627] -- 0:00:55
      82500 -- (-1524.448) (-1527.653) (-1525.345) [-1525.754] * (-1523.989) [-1522.332] (-1525.630) (-1525.018) -- 0:00:55
      83000 -- (-1524.758) (-1525.465) [-1523.884] (-1525.633) * [-1523.514] (-1522.201) (-1525.620) (-1525.039) -- 0:00:55
      83500 -- (-1525.347) (-1528.966) (-1525.016) [-1526.367] * (-1522.119) [-1525.011] (-1525.255) (-1524.246) -- 0:00:54
      84000 -- (-1527.082) (-1526.711) (-1523.235) [-1525.879] * [-1522.456] (-1524.134) (-1524.942) (-1524.874) -- 0:00:54
      84500 -- (-1526.499) (-1523.350) [-1523.563] (-1524.431) * (-1522.603) [-1524.292] (-1523.823) (-1524.615) -- 0:01:05
      85000 -- (-1524.063) (-1523.979) [-1523.152] (-1523.625) * (-1522.250) [-1524.059] (-1525.898) (-1523.169) -- 0:01:04

      Average standard deviation of split frequencies: 0.021143

      85500 -- (-1526.782) (-1528.208) (-1524.847) [-1525.833] * (-1522.467) [-1526.449] (-1527.120) (-1526.729) -- 0:01:04
      86000 -- (-1522.880) (-1523.624) (-1527.949) [-1523.940] * (-1522.468) [-1525.572] (-1527.145) (-1523.417) -- 0:01:03
      86500 -- (-1523.089) (-1523.332) [-1527.531] (-1523.883) * (-1523.590) (-1525.607) [-1525.196] (-1523.789) -- 0:01:03
      87000 -- (-1523.008) (-1525.067) (-1523.717) [-1523.406] * (-1525.717) (-1525.527) (-1528.487) [-1522.824] -- 0:01:02
      87500 -- (-1522.903) (-1527.709) [-1523.740] (-1524.621) * (-1522.879) (-1527.494) (-1528.091) [-1524.942] -- 0:01:02
      88000 -- (-1525.166) [-1525.719] (-1523.198) (-1525.301) * [-1523.007] (-1524.698) (-1529.601) (-1523.189) -- 0:01:02
      88500 -- (-1523.560) (-1526.852) [-1524.443] (-1525.506) * [-1522.996] (-1525.266) (-1531.824) (-1523.173) -- 0:01:01
      89000 -- (-1523.349) (-1525.396) (-1526.635) [-1525.394] * (-1523.975) (-1525.748) [-1523.430] (-1523.472) -- 0:01:01
      89500 -- [-1524.417] (-1523.947) (-1527.135) (-1524.965) * (-1526.308) [-1523.806] (-1523.489) (-1525.563) -- 0:01:01
      90000 -- (-1523.220) [-1524.217] (-1523.415) (-1523.953) * (-1525.560) [-1526.112] (-1525.088) (-1534.197) -- 0:01:00

      Average standard deviation of split frequencies: 0.021270

      90500 -- [-1525.275] (-1523.208) (-1525.205) (-1524.600) * [-1526.077] (-1523.232) (-1523.893) (-1525.548) -- 0:01:00
      91000 -- (-1528.817) (-1523.007) [-1523.525] (-1525.250) * [-1529.157] (-1523.408) (-1526.142) (-1523.669) -- 0:00:59
      91500 -- (-1526.567) [-1523.274] (-1523.031) (-1524.418) * (-1524.202) (-1527.214) (-1523.578) [-1523.401] -- 0:00:59
      92000 -- (-1524.374) (-1524.481) [-1523.818] (-1524.929) * [-1523.935] (-1522.708) (-1523.477) (-1523.478) -- 0:00:59
      92500 -- (-1526.457) [-1523.625] (-1526.867) (-1523.943) * (-1524.363) (-1524.227) [-1525.025] (-1524.696) -- 0:00:58
      93000 -- (-1523.476) (-1524.536) (-1527.177) [-1527.449] * (-1524.611) [-1524.240] (-1524.871) (-1526.732) -- 0:00:58
      93500 -- (-1527.464) (-1524.849) [-1523.556] (-1525.476) * (-1525.049) (-1523.824) [-1527.657] (-1525.146) -- 0:00:58
      94000 -- [-1523.379] (-1524.680) (-1523.584) (-1525.105) * (-1523.766) (-1524.673) (-1526.313) [-1528.020] -- 0:00:57
      94500 -- (-1523.761) (-1525.112) [-1523.315] (-1523.438) * (-1524.096) [-1523.368] (-1523.901) (-1524.787) -- 0:00:57
      95000 -- (-1522.867) (-1523.721) (-1523.501) [-1524.772] * [-1523.097] (-1524.452) (-1533.456) (-1524.265) -- 0:00:57

      Average standard deviation of split frequencies: 0.023851

      95500 -- [-1522.552] (-1523.184) (-1528.184) (-1523.356) * (-1524.208) (-1524.977) [-1524.901] (-1523.228) -- 0:00:56
      96000 -- [-1524.108] (-1523.452) (-1529.391) (-1525.039) * (-1522.463) [-1522.802] (-1525.400) (-1523.780) -- 0:00:56
      96500 -- [-1526.531] (-1524.123) (-1527.787) (-1529.810) * [-1526.506] (-1524.436) (-1525.402) (-1525.591) -- 0:00:56
      97000 -- (-1524.956) [-1524.036] (-1524.106) (-1523.819) * (-1524.211) [-1525.238] (-1527.479) (-1525.982) -- 0:00:55
      97500 -- [-1529.275] (-1523.601) (-1524.315) (-1522.918) * (-1524.237) [-1524.154] (-1526.130) (-1523.807) -- 0:00:55
      98000 -- (-1526.292) (-1522.399) [-1524.816] (-1523.821) * (-1525.864) [-1524.635] (-1526.772) (-1524.721) -- 0:00:55
      98500 -- (-1525.506) (-1522.398) [-1524.575] (-1525.242) * (-1523.632) (-1523.706) (-1526.144) [-1524.762] -- 0:00:54
      99000 -- (-1525.876) (-1523.095) [-1524.065] (-1525.815) * (-1523.211) (-1524.360) (-1527.239) [-1523.133] -- 0:00:54
      99500 -- (-1526.752) [-1523.281] (-1530.095) (-1526.670) * [-1523.909] (-1526.335) (-1524.913) (-1525.410) -- 0:00:54
      100000 -- (-1527.602) (-1522.617) (-1527.061) [-1525.290] * (-1524.887) (-1523.173) (-1524.029) [-1523.014] -- 0:01:02

      Average standard deviation of split frequencies: 0.027160

      100500 -- (-1529.470) (-1523.032) (-1524.292) [-1525.110] * (-1525.324) (-1526.908) (-1524.386) [-1525.245] -- 0:01:02
      101000 -- (-1531.524) [-1524.245] (-1524.886) (-1525.181) * [-1525.826] (-1525.241) (-1524.242) (-1524.097) -- 0:01:02
      101500 -- [-1523.916] (-1527.465) (-1524.836) (-1527.677) * (-1523.710) (-1525.484) (-1523.938) [-1522.576] -- 0:01:01
      102000 -- (-1526.646) (-1525.732) [-1529.654] (-1529.543) * (-1527.546) (-1524.954) [-1523.357] (-1527.083) -- 0:01:01
      102500 -- (-1522.325) (-1526.437) (-1528.412) [-1527.528] * (-1524.952) (-1525.103) [-1525.394] (-1523.789) -- 0:01:01
      103000 -- (-1524.673) [-1524.028] (-1525.828) (-1523.666) * (-1524.823) (-1525.104) (-1526.792) [-1522.315] -- 0:01:00
      103500 -- [-1524.486] (-1525.714) (-1526.014) (-1524.491) * (-1524.776) (-1525.087) [-1525.731] (-1524.092) -- 0:01:00
      104000 -- (-1524.042) (-1527.970) (-1525.039) [-1523.663] * [-1525.896] (-1523.863) (-1524.648) (-1522.137) -- 0:01:00
      104500 -- (-1523.388) (-1525.969) [-1523.890] (-1525.668) * (-1525.452) (-1523.361) [-1524.367] (-1522.880) -- 0:00:59
      105000 -- (-1522.845) (-1527.535) [-1524.429] (-1525.948) * [-1527.495] (-1522.689) (-1525.300) (-1525.489) -- 0:00:59

      Average standard deviation of split frequencies: 0.027573

      105500 -- (-1524.086) [-1522.486] (-1527.407) (-1525.111) * (-1523.418) (-1525.821) [-1524.210] (-1523.728) -- 0:00:59
      106000 -- (-1522.560) (-1522.385) (-1523.169) [-1524.901] * (-1522.928) (-1527.232) (-1524.045) [-1522.523] -- 0:00:59
      106500 -- (-1522.992) (-1523.391) [-1523.373] (-1528.796) * [-1525.157] (-1523.060) (-1525.147) (-1522.989) -- 0:00:58
      107000 -- [-1524.049] (-1523.227) (-1530.765) (-1525.757) * (-1525.460) (-1523.632) [-1525.389] (-1522.989) -- 0:00:58
      107500 -- [-1525.781] (-1525.393) (-1526.814) (-1524.906) * (-1525.852) (-1522.961) (-1525.877) [-1525.539] -- 0:00:58
      108000 -- (-1527.510) [-1526.026] (-1523.174) (-1523.972) * (-1525.266) (-1522.743) [-1524.834] (-1523.725) -- 0:00:57
      108500 -- (-1525.144) [-1522.842] (-1523.116) (-1525.422) * (-1524.585) [-1523.716] (-1524.273) (-1523.051) -- 0:00:57
      109000 -- (-1523.126) (-1522.858) (-1526.230) [-1525.325] * [-1523.465] (-1523.408) (-1522.947) (-1522.906) -- 0:00:57
      109500 -- (-1522.556) [-1522.804] (-1526.838) (-1530.239) * (-1523.501) (-1523.358) (-1524.230) [-1522.687] -- 0:00:56
      110000 -- (-1525.454) [-1522.808] (-1526.445) (-1532.048) * (-1523.501) [-1524.417] (-1522.367) (-1522.465) -- 0:00:56

      Average standard deviation of split frequencies: 0.026836

      110500 -- (-1524.392) [-1523.266] (-1523.389) (-1529.133) * (-1526.185) (-1523.805) [-1522.771] (-1522.497) -- 0:00:56
      111000 -- (-1529.395) (-1523.239) [-1524.451] (-1524.413) * (-1523.993) (-1523.159) [-1522.655] (-1523.581) -- 0:00:56
      111500 -- (-1524.662) [-1523.200] (-1524.302) (-1526.119) * (-1524.018) [-1524.383] (-1522.655) (-1525.662) -- 0:00:55
      112000 -- (-1524.382) (-1523.221) (-1523.736) [-1524.804] * (-1525.587) (-1524.739) [-1522.268] (-1523.725) -- 0:00:55
      112500 -- (-1524.732) (-1522.720) (-1523.152) [-1524.312] * (-1524.584) [-1524.860] (-1524.539) (-1522.972) -- 0:00:55
      113000 -- [-1524.787] (-1526.484) (-1523.222) (-1524.478) * (-1524.289) [-1525.143] (-1524.189) (-1523.431) -- 0:00:54
      113500 -- (-1525.456) [-1526.455] (-1523.528) (-1523.812) * (-1524.430) (-1524.393) [-1523.278] (-1523.431) -- 0:00:54
      114000 -- (-1527.289) [-1522.625] (-1525.027) (-1523.727) * (-1525.565) (-1527.074) (-1523.278) [-1523.431] -- 0:00:54
      114500 -- (-1524.965) (-1524.167) [-1522.866] (-1523.745) * (-1523.692) (-1523.834) (-1523.586) [-1522.634] -- 0:00:54
      115000 -- (-1524.135) [-1526.161] (-1522.751) (-1523.304) * (-1524.044) [-1522.881] (-1523.293) (-1526.261) -- 0:00:53

      Average standard deviation of split frequencies: 0.025805

      115500 -- (-1525.143) (-1525.938) [-1522.635] (-1523.304) * (-1531.694) (-1522.631) [-1523.617] (-1527.045) -- 0:01:01
      116000 -- (-1524.593) (-1523.761) (-1522.633) [-1522.998] * (-1527.379) (-1523.749) (-1525.033) [-1523.728] -- 0:01:00
      116500 -- [-1523.531] (-1525.446) (-1528.416) (-1523.229) * (-1527.719) [-1523.537] (-1525.051) (-1525.154) -- 0:01:00
      117000 -- [-1526.991] (-1523.782) (-1530.807) (-1524.499) * (-1525.288) (-1523.741) (-1523.210) [-1524.275] -- 0:01:00
      117500 -- (-1525.080) (-1525.046) [-1524.559] (-1524.403) * [-1525.867] (-1523.005) (-1525.696) (-1524.549) -- 0:01:00
      118000 -- (-1524.855) (-1523.432) [-1528.607] (-1523.747) * (-1528.375) [-1524.652] (-1524.404) (-1524.391) -- 0:00:59
      118500 -- (-1525.707) (-1522.819) [-1523.436] (-1523.824) * (-1526.762) (-1525.988) (-1525.179) [-1522.995] -- 0:00:59
      119000 -- [-1523.342] (-1523.164) (-1524.222) (-1528.309) * (-1524.740) (-1523.598) (-1524.688) [-1523.953] -- 0:00:59
      119500 -- [-1523.157] (-1524.622) (-1523.407) (-1524.583) * (-1524.744) (-1525.846) [-1525.869] (-1524.042) -- 0:00:58
      120000 -- (-1523.735) (-1523.794) [-1523.097] (-1524.564) * (-1524.186) (-1524.699) (-1522.726) [-1522.778] -- 0:00:58

      Average standard deviation of split frequencies: 0.022206

      120500 -- [-1524.112] (-1524.784) (-1528.930) (-1523.743) * [-1524.153] (-1524.122) (-1523.359) (-1523.136) -- 0:00:58
      121000 -- (-1523.266) (-1527.421) (-1524.577) [-1523.702] * (-1526.127) [-1522.918] (-1524.905) (-1522.693) -- 0:00:58
      121500 -- (-1522.794) (-1525.177) [-1523.498] (-1523.548) * [-1524.415] (-1523.668) (-1524.467) (-1523.438) -- 0:00:57
      122000 -- (-1523.994) [-1525.800] (-1526.816) (-1525.183) * [-1524.065] (-1524.618) (-1523.922) (-1522.775) -- 0:00:57
      122500 -- (-1524.636) [-1524.913] (-1528.031) (-1532.651) * [-1522.677] (-1525.315) (-1524.462) (-1526.304) -- 0:00:57
      123000 -- (-1524.667) (-1523.824) (-1528.617) [-1524.717] * [-1522.901] (-1524.995) (-1524.514) (-1523.950) -- 0:00:57
      123500 -- [-1524.781] (-1523.125) (-1523.263) (-1526.268) * (-1524.095) [-1523.498] (-1526.909) (-1524.493) -- 0:00:56
      124000 -- (-1526.038) (-1523.567) (-1523.365) [-1525.810] * (-1523.820) (-1525.786) (-1532.784) [-1523.488] -- 0:00:56
      124500 -- (-1524.002) [-1524.054] (-1524.139) (-1526.996) * [-1524.576] (-1525.506) (-1527.918) (-1525.412) -- 0:00:56
      125000 -- (-1524.220) (-1525.477) [-1523.475] (-1524.467) * [-1522.740] (-1525.020) (-1524.513) (-1533.970) -- 0:00:56

      Average standard deviation of split frequencies: 0.023009

      125500 -- [-1524.214] (-1524.918) (-1525.699) (-1523.818) * (-1524.484) [-1524.181] (-1525.194) (-1529.880) -- 0:00:55
      126000 -- (-1524.226) (-1529.594) (-1524.341) [-1523.778] * (-1524.127) [-1524.879] (-1526.267) (-1531.287) -- 0:00:55
      126500 -- [-1523.763] (-1525.543) (-1524.332) (-1530.147) * (-1523.208) [-1525.759] (-1524.936) (-1525.492) -- 0:00:55
      127000 -- (-1529.984) (-1522.471) (-1524.303) [-1525.219] * (-1524.979) (-1525.978) (-1523.717) [-1527.842] -- 0:00:54
      127500 -- [-1526.520] (-1525.766) (-1522.789) (-1524.186) * (-1522.964) (-1525.753) [-1524.731] (-1523.648) -- 0:00:54
      128000 -- (-1524.142) [-1523.716] (-1522.427) (-1524.509) * (-1524.868) [-1524.030] (-1522.718) (-1523.867) -- 0:00:54
      128500 -- (-1523.779) [-1523.733] (-1522.619) (-1523.527) * (-1525.096) (-1523.875) [-1522.717] (-1522.235) -- 0:00:54
      129000 -- (-1524.250) (-1525.215) (-1522.619) [-1528.472] * [-1524.978] (-1527.316) (-1522.594) (-1522.267) -- 0:00:54
      129500 -- (-1525.087) [-1526.315] (-1528.790) (-1524.026) * [-1525.978] (-1524.582) (-1526.491) (-1523.576) -- 0:00:53
      130000 -- (-1525.210) [-1525.634] (-1529.474) (-1523.888) * (-1526.732) (-1524.273) (-1525.826) [-1523.760] -- 0:00:53

      Average standard deviation of split frequencies: 0.020383

      130500 -- [-1525.110] (-1523.693) (-1526.837) (-1526.422) * (-1523.172) (-1524.817) [-1528.580] (-1525.979) -- 0:00:53
      131000 -- [-1524.277] (-1524.450) (-1526.737) (-1525.309) * (-1523.984) (-1527.915) [-1525.417] (-1525.145) -- 0:00:59
      131500 -- (-1524.899) (-1523.560) [-1527.678] (-1524.725) * (-1523.953) (-1526.436) (-1527.955) [-1525.570] -- 0:00:59
      132000 -- (-1527.182) [-1523.231] (-1526.484) (-1522.880) * (-1527.154) (-1524.296) (-1524.050) [-1524.737] -- 0:00:59
      132500 -- (-1527.395) [-1523.672] (-1523.424) (-1524.821) * [-1526.205] (-1524.586) (-1523.860) (-1526.786) -- 0:00:58
      133000 -- (-1526.403) (-1526.280) (-1523.448) [-1522.749] * (-1525.287) [-1522.361] (-1524.267) (-1523.698) -- 0:00:58
      133500 -- (-1525.104) (-1524.235) [-1525.177] (-1526.090) * [-1524.201] (-1531.063) (-1526.242) (-1524.332) -- 0:00:58
      134000 -- (-1524.568) [-1524.355] (-1522.816) (-1525.698) * (-1524.400) (-1526.274) [-1524.226] (-1524.763) -- 0:00:58
      134500 -- (-1524.831) [-1527.522] (-1523.943) (-1526.891) * (-1524.426) [-1525.339] (-1525.550) (-1528.210) -- 0:00:57
      135000 -- (-1523.835) (-1523.293) [-1523.572] (-1526.455) * (-1523.543) (-1525.497) [-1526.127] (-1524.438) -- 0:00:57

      Average standard deviation of split frequencies: 0.022877

      135500 -- [-1523.940] (-1522.884) (-1522.717) (-1524.638) * (-1524.191) (-1524.762) (-1523.211) [-1524.168] -- 0:00:57
      136000 -- (-1522.879) [-1525.062] (-1526.826) (-1526.262) * [-1529.056] (-1523.906) (-1524.316) (-1529.076) -- 0:00:57
      136500 -- [-1522.966] (-1526.625) (-1523.309) (-1526.292) * (-1525.207) [-1524.146] (-1524.491) (-1529.598) -- 0:00:56
      137000 -- (-1522.966) (-1524.201) [-1524.205] (-1523.747) * (-1523.141) [-1524.404] (-1524.494) (-1528.027) -- 0:00:56
      137500 -- (-1522.883) [-1524.469] (-1523.591) (-1524.193) * (-1522.720) (-1523.493) (-1522.802) [-1525.398] -- 0:00:56
      138000 -- (-1522.883) (-1526.483) [-1524.891] (-1524.237) * (-1524.398) (-1524.334) (-1528.443) [-1525.278] -- 0:00:56
      138500 -- [-1523.051] (-1524.593) (-1524.432) (-1524.215) * (-1526.003) (-1524.008) (-1527.436) [-1526.744] -- 0:00:55
      139000 -- (-1523.342) (-1524.593) [-1523.263] (-1523.330) * (-1524.032) (-1530.082) (-1528.864) [-1527.517] -- 0:00:55
      139500 -- (-1523.126) (-1527.325) [-1529.678] (-1523.164) * (-1526.489) [-1524.590] (-1523.223) (-1523.514) -- 0:00:55
      140000 -- (-1523.244) (-1525.527) (-1530.639) [-1522.456] * (-1524.996) [-1522.798] (-1527.115) (-1523.383) -- 0:00:55

      Average standard deviation of split frequencies: 0.021950

      140500 -- [-1524.221] (-1523.727) (-1523.690) (-1522.968) * (-1526.871) (-1526.588) [-1522.500] (-1526.857) -- 0:00:55
      141000 -- (-1523.918) [-1528.258] (-1526.068) (-1522.551) * (-1526.738) (-1526.936) [-1522.585] (-1527.678) -- 0:00:54
      141500 -- (-1523.498) (-1528.816) [-1522.732] (-1524.595) * (-1530.342) (-1530.162) [-1526.315] (-1526.224) -- 0:00:54
      142000 -- (-1523.303) (-1524.800) (-1523.219) [-1524.371] * (-1530.275) [-1524.148] (-1526.291) (-1525.187) -- 0:00:54
      142500 -- (-1525.548) (-1523.975) (-1525.174) [-1522.465] * (-1522.552) [-1523.470] (-1524.257) (-1525.490) -- 0:00:54
      143000 -- (-1525.491) [-1525.130] (-1523.096) (-1522.689) * [-1523.766] (-1526.426) (-1523.732) (-1525.248) -- 0:00:53
      143500 -- (-1525.590) (-1526.171) (-1524.586) [-1525.088] * (-1523.681) [-1522.707] (-1523.272) (-1524.788) -- 0:00:53
      144000 -- (-1523.977) (-1526.405) (-1524.479) [-1523.864] * (-1524.087) (-1523.225) [-1523.440] (-1523.652) -- 0:00:53
      144500 -- (-1525.316) (-1526.111) [-1522.532] (-1524.803) * (-1525.174) [-1523.872] (-1527.247) (-1523.328) -- 0:00:53
      145000 -- (-1524.331) (-1524.335) [-1523.199] (-1523.532) * [-1524.169] (-1524.980) (-1527.752) (-1523.353) -- 0:00:53

      Average standard deviation of split frequencies: 0.019696

      145500 -- (-1522.307) (-1526.783) (-1522.981) [-1525.399] * (-1523.406) (-1524.630) (-1530.991) [-1522.369] -- 0:00:52
      146000 -- [-1522.952] (-1527.514) (-1523.749) (-1523.128) * [-1524.406] (-1524.098) (-1526.268) (-1525.922) -- 0:00:52
      146500 -- (-1524.121) (-1527.611) [-1527.628] (-1525.135) * (-1524.128) (-1525.019) [-1523.440] (-1523.386) -- 0:00:52
      147000 -- (-1523.965) [-1527.655] (-1522.994) (-1522.439) * [-1522.666] (-1524.392) (-1523.440) (-1523.186) -- 0:00:58
      147500 -- [-1523.116] (-1527.824) (-1522.636) (-1523.094) * (-1528.534) (-1523.928) [-1523.214] (-1527.618) -- 0:00:57
      148000 -- (-1522.953) (-1523.796) (-1524.565) [-1523.932] * (-1522.789) [-1523.408] (-1523.223) (-1529.411) -- 0:00:57
      148500 -- (-1523.261) [-1523.068] (-1528.044) (-1527.164) * (-1523.931) (-1524.439) [-1523.324] (-1529.991) -- 0:00:57
      149000 -- [-1522.952] (-1523.707) (-1526.258) (-1528.236) * (-1523.116) (-1523.733) [-1523.098] (-1524.829) -- 0:00:57
      149500 -- (-1524.396) (-1523.052) [-1531.859] (-1523.996) * (-1527.184) (-1523.695) [-1522.902] (-1525.038) -- 0:00:56
      150000 -- (-1523.222) [-1522.870] (-1529.080) (-1524.863) * [-1526.266] (-1526.695) (-1524.598) (-1524.150) -- 0:00:56

      Average standard deviation of split frequencies: 0.021432

      150500 -- (-1524.343) (-1522.844) [-1527.865] (-1522.709) * (-1523.413) (-1525.874) [-1523.904] (-1523.337) -- 0:00:56
      151000 -- (-1524.726) (-1523.133) (-1534.249) [-1522.709] * (-1525.931) (-1525.557) (-1522.917) [-1524.470] -- 0:00:56
      151500 -- (-1524.544) [-1522.403] (-1525.584) (-1524.476) * (-1523.861) (-1526.354) [-1523.351] (-1525.806) -- 0:00:56
      152000 -- (-1523.871) [-1522.993] (-1526.287) (-1526.747) * (-1522.820) [-1522.734] (-1526.450) (-1525.692) -- 0:00:55
      152500 -- (-1522.751) [-1523.287] (-1525.194) (-1523.570) * (-1523.554) (-1523.673) [-1526.825] (-1526.856) -- 0:00:55
      153000 -- (-1523.989) (-1523.292) (-1524.571) [-1523.405] * [-1527.272] (-1522.726) (-1526.842) (-1529.723) -- 0:00:55
      153500 -- (-1523.768) [-1525.886] (-1525.086) (-1523.181) * (-1523.842) [-1525.897] (-1526.475) (-1522.592) -- 0:00:55
      154000 -- (-1525.146) (-1523.235) [-1523.025] (-1522.628) * (-1523.315) (-1525.607) [-1528.520] (-1524.777) -- 0:00:54
      154500 -- [-1522.292] (-1523.153) (-1523.714) (-1523.985) * [-1525.874] (-1526.343) (-1527.715) (-1525.545) -- 0:00:54
      155000 -- (-1522.771) (-1530.490) (-1523.710) [-1523.540] * (-1523.615) [-1525.668] (-1531.758) (-1524.329) -- 0:00:54

      Average standard deviation of split frequencies: 0.021153

      155500 -- (-1522.910) [-1523.894] (-1522.773) (-1523.540) * [-1523.541] (-1522.770) (-1526.846) (-1524.228) -- 0:00:54
      156000 -- (-1523.372) (-1523.606) (-1526.292) [-1527.757] * (-1526.607) (-1523.610) (-1526.616) [-1522.858] -- 0:00:54
      156500 -- [-1523.064] (-1523.356) (-1523.221) (-1529.528) * (-1524.784) (-1525.213) [-1525.378] (-1522.866) -- 0:00:53
      157000 -- (-1522.993) [-1522.680] (-1524.660) (-1524.557) * (-1522.966) (-1523.509) [-1523.256] (-1523.181) -- 0:00:53
      157500 -- [-1523.359] (-1522.365) (-1522.269) (-1523.903) * (-1523.079) [-1524.090] (-1524.336) (-1526.952) -- 0:00:53
      158000 -- [-1522.413] (-1522.365) (-1523.260) (-1524.506) * (-1523.146) (-1524.173) (-1524.512) [-1526.284] -- 0:00:53
      158500 -- [-1523.123] (-1523.343) (-1523.797) (-1524.111) * [-1522.733] (-1525.993) (-1525.010) (-1526.370) -- 0:00:53
      159000 -- (-1523.485) (-1524.691) (-1523.407) [-1523.084] * (-1523.290) (-1523.892) (-1525.929) [-1523.416] -- 0:00:52
      159500 -- (-1525.214) (-1522.818) (-1525.650) [-1524.055] * [-1523.986] (-1526.150) (-1523.217) (-1523.940) -- 0:00:52
      160000 -- (-1524.644) (-1523.274) (-1522.461) [-1524.273] * (-1527.122) (-1523.384) [-1523.689] (-1524.435) -- 0:00:52

      Average standard deviation of split frequencies: 0.019612

      160500 -- (-1522.374) [-1525.095] (-1530.663) (-1525.942) * (-1526.564) [-1523.135] (-1523.014) (-1523.943) -- 0:00:52
      161000 -- (-1524.864) (-1526.875) [-1527.237] (-1526.434) * (-1525.597) (-1523.969) [-1522.968] (-1523.770) -- 0:00:52
      161500 -- (-1527.751) (-1526.742) (-1527.822) [-1526.081] * (-1523.328) (-1524.864) [-1523.851] (-1524.072) -- 0:00:51
      162000 -- (-1530.729) [-1527.120] (-1528.336) (-1527.054) * [-1523.934] (-1524.211) (-1523.403) (-1527.047) -- 0:00:51
      162500 -- (-1526.070) (-1524.475) [-1525.589] (-1523.933) * (-1523.851) [-1525.362] (-1524.186) (-1526.266) -- 0:00:56
      163000 -- [-1523.306] (-1525.379) (-1525.197) (-1527.393) * (-1522.578) (-1523.610) [-1524.984] (-1526.068) -- 0:00:56
      163500 -- (-1523.413) [-1525.766] (-1523.413) (-1526.542) * [-1522.900] (-1524.262) (-1527.637) (-1525.238) -- 0:00:56
      164000 -- (-1523.776) (-1525.724) (-1523.597) [-1526.575] * (-1523.834) (-1526.453) (-1526.346) [-1524.135] -- 0:00:56
      164500 -- (-1524.906) (-1525.134) (-1523.515) [-1522.597] * (-1524.579) (-1525.660) (-1524.483) [-1527.800] -- 0:00:55
      165000 -- (-1523.748) [-1525.027] (-1522.742) (-1522.983) * (-1523.705) (-1523.768) (-1524.401) [-1526.746] -- 0:00:55

      Average standard deviation of split frequencies: 0.016889

      165500 -- (-1524.907) (-1524.999) [-1524.079] (-1523.671) * (-1524.155) (-1523.373) [-1526.341] (-1526.366) -- 0:00:55
      166000 -- (-1523.427) (-1525.616) [-1523.784] (-1525.309) * (-1523.978) (-1523.037) [-1523.736] (-1525.050) -- 0:00:55
      166500 -- (-1524.417) (-1524.413) [-1523.639] (-1524.143) * (-1526.009) (-1527.280) (-1525.840) [-1523.322] -- 0:00:55
      167000 -- (-1524.087) [-1525.369] (-1523.425) (-1528.844) * (-1526.341) (-1527.478) [-1524.475] (-1522.978) -- 0:00:54
      167500 -- (-1526.195) (-1523.392) [-1528.531] (-1525.322) * (-1523.268) (-1528.400) (-1526.378) [-1522.887] -- 0:00:54
      168000 -- [-1525.231] (-1523.507) (-1525.830) (-1525.259) * (-1523.267) [-1526.353] (-1528.055) (-1522.925) -- 0:00:54
      168500 -- (-1525.927) (-1523.501) [-1527.244] (-1526.932) * [-1523.141] (-1528.979) (-1526.184) (-1523.211) -- 0:00:54
      169000 -- (-1524.450) (-1522.673) (-1527.088) [-1523.937] * (-1524.003) [-1525.348] (-1523.783) (-1522.465) -- 0:00:54
      169500 -- (-1522.710) [-1524.173] (-1527.623) (-1523.575) * [-1525.146] (-1526.602) (-1523.633) (-1523.392) -- 0:00:53
      170000 -- (-1522.501) [-1524.829] (-1524.569) (-1523.332) * (-1523.435) [-1525.959] (-1524.488) (-1524.206) -- 0:00:53

      Average standard deviation of split frequencies: 0.016718

      170500 -- (-1523.587) [-1526.985] (-1527.906) (-1523.339) * (-1523.191) [-1522.340] (-1528.130) (-1524.559) -- 0:00:53
      171000 -- (-1525.003) (-1524.337) [-1523.716] (-1524.546) * (-1524.194) (-1522.377) (-1524.837) [-1524.542] -- 0:00:53
      171500 -- (-1524.850) (-1523.639) (-1524.698) [-1525.946] * (-1524.051) (-1523.299) (-1523.395) [-1526.442] -- 0:00:53
      172000 -- (-1525.221) (-1524.293) [-1526.979] (-1525.785) * (-1524.642) (-1522.833) [-1524.743] (-1525.812) -- 0:00:52
      172500 -- (-1523.846) (-1523.224) (-1523.010) [-1522.691] * (-1522.664) [-1522.973] (-1522.670) (-1523.683) -- 0:00:52
      173000 -- (-1525.276) (-1523.199) [-1523.953] (-1525.182) * (-1522.632) (-1523.053) [-1522.663] (-1523.683) -- 0:00:52
      173500 -- (-1523.586) [-1523.540] (-1523.328) (-1525.159) * (-1522.644) (-1522.690) (-1522.507) [-1522.817] -- 0:00:52
      174000 -- [-1522.317] (-1524.692) (-1524.737) (-1525.291) * [-1522.589] (-1523.312) (-1522.497) (-1523.232) -- 0:00:52
      174500 -- (-1524.186) (-1523.850) (-1526.165) [-1524.782] * (-1522.910) (-1522.478) [-1523.491] (-1523.215) -- 0:00:52
      175000 -- (-1525.334) (-1526.514) (-1528.165) [-1523.474] * [-1524.143] (-1524.320) (-1524.373) (-1523.809) -- 0:00:51

      Average standard deviation of split frequencies: 0.017339

      175500 -- (-1524.543) [-1524.104] (-1529.149) (-1523.860) * (-1524.263) (-1523.245) [-1523.691] (-1524.552) -- 0:00:51
      176000 -- [-1527.412] (-1524.905) (-1526.819) (-1524.085) * [-1523.278] (-1525.638) (-1528.118) (-1523.907) -- 0:00:51
      176500 -- (-1529.730) [-1527.672] (-1527.854) (-1524.852) * (-1522.861) (-1527.777) [-1525.267] (-1523.200) -- 0:00:51
      177000 -- (-1524.550) (-1527.710) (-1529.667) [-1527.102] * (-1523.479) (-1526.805) [-1527.855] (-1523.178) -- 0:00:51
      177500 -- [-1524.015] (-1525.585) (-1527.223) (-1525.498) * [-1522.743] (-1527.971) (-1525.146) (-1524.082) -- 0:00:50
      178000 -- [-1524.270] (-1525.491) (-1524.128) (-1525.382) * (-1523.427) (-1526.660) [-1524.529] (-1524.535) -- 0:00:55
      178500 -- (-1527.740) [-1523.092] (-1525.733) (-1525.979) * (-1522.746) [-1524.110] (-1525.236) (-1524.984) -- 0:00:55
      179000 -- (-1523.580) (-1529.436) (-1524.228) [-1524.098] * (-1523.694) (-1522.946) (-1526.141) [-1525.033] -- 0:00:55
      179500 -- (-1524.253) [-1522.919] (-1522.730) (-1530.715) * (-1525.249) (-1525.066) (-1524.133) [-1527.554] -- 0:00:54
      180000 -- (-1524.275) (-1523.999) [-1523.538] (-1531.541) * (-1527.012) (-1522.972) (-1525.610) [-1526.882] -- 0:00:54

      Average standard deviation of split frequencies: 0.015381

      180500 -- (-1523.062) (-1524.389) (-1523.696) [-1526.435] * [-1525.138] (-1525.031) (-1525.608) (-1524.972) -- 0:00:54
      181000 -- [-1523.143] (-1523.736) (-1527.953) (-1527.428) * (-1523.545) (-1524.590) [-1524.276] (-1523.547) -- 0:00:54
      181500 -- [-1523.403] (-1526.071) (-1526.026) (-1524.429) * (-1523.763) (-1523.949) (-1522.712) [-1523.619] -- 0:00:54
      182000 -- (-1527.272) [-1526.168] (-1525.337) (-1524.212) * (-1523.250) (-1523.349) [-1523.682] (-1523.815) -- 0:00:53
      182500 -- (-1529.034) [-1523.953] (-1526.777) (-1523.710) * (-1523.174) (-1525.963) [-1523.732] (-1523.713) -- 0:00:53
      183000 -- (-1526.387) [-1523.912] (-1523.331) (-1524.228) * [-1522.384] (-1523.781) (-1525.509) (-1530.254) -- 0:00:53
      183500 -- (-1531.670) (-1524.038) (-1524.136) [-1523.694] * [-1522.476] (-1529.518) (-1523.729) (-1524.698) -- 0:00:53
      184000 -- (-1525.225) (-1525.078) [-1526.463] (-1527.475) * (-1522.477) (-1527.876) [-1524.197] (-1525.882) -- 0:00:53
      184500 -- (-1524.437) [-1525.836] (-1524.201) (-1525.338) * (-1526.125) (-1523.540) (-1524.066) [-1524.021] -- 0:00:53
      185000 -- [-1523.658] (-1524.344) (-1524.582) (-1525.504) * (-1526.988) (-1523.355) (-1526.123) [-1524.156] -- 0:00:52

      Average standard deviation of split frequencies: 0.013873

      185500 -- [-1523.567] (-1522.997) (-1524.805) (-1529.481) * (-1525.774) [-1523.335] (-1523.713) (-1524.130) -- 0:00:52
      186000 -- (-1527.933) [-1522.621] (-1527.962) (-1523.675) * (-1525.202) [-1525.165] (-1524.388) (-1527.577) -- 0:00:52
      186500 -- (-1526.790) (-1522.318) [-1523.961] (-1523.538) * (-1525.195) [-1523.427] (-1524.388) (-1525.121) -- 0:00:52
      187000 -- [-1522.898] (-1526.364) (-1525.704) (-1525.825) * (-1526.654) (-1523.458) [-1524.876] (-1523.740) -- 0:00:52
      187500 -- [-1523.920] (-1526.567) (-1523.502) (-1524.841) * (-1524.604) [-1526.947] (-1523.347) (-1523.765) -- 0:00:52
      188000 -- (-1523.186) (-1529.300) [-1522.089] (-1523.091) * [-1525.201] (-1525.842) (-1527.424) (-1522.835) -- 0:00:51
      188500 -- [-1525.123] (-1527.543) (-1522.089) (-1525.664) * (-1526.666) [-1523.816] (-1530.025) (-1522.612) -- 0:00:51
      189000 -- [-1525.412] (-1524.399) (-1522.081) (-1524.031) * (-1526.080) (-1525.438) [-1526.939] (-1524.357) -- 0:00:51
      189500 -- [-1522.267] (-1523.107) (-1522.074) (-1525.493) * (-1526.523) (-1524.231) [-1525.927] (-1522.955) -- 0:00:51
      190000 -- (-1525.659) (-1523.344) [-1522.357] (-1524.021) * [-1523.798] (-1525.988) (-1527.882) (-1526.492) -- 0:00:51

      Average standard deviation of split frequencies: 0.013671

      190500 -- (-1526.120) (-1523.492) [-1522.570] (-1526.369) * (-1523.404) (-1525.960) [-1527.536] (-1523.593) -- 0:00:50
      191000 -- (-1527.612) (-1525.225) [-1522.793] (-1525.454) * (-1522.780) [-1525.253] (-1526.969) (-1523.226) -- 0:00:50
      191500 -- (-1528.870) (-1523.823) [-1523.736] (-1529.342) * (-1525.209) (-1528.426) (-1529.781) [-1523.459] -- 0:00:50
      192000 -- [-1523.176] (-1527.785) (-1523.817) (-1525.191) * (-1523.057) (-1523.050) [-1527.792] (-1523.460) -- 0:00:50
      192500 -- (-1525.493) (-1525.355) [-1523.299] (-1526.938) * (-1524.712) (-1524.301) [-1526.379] (-1524.946) -- 0:00:50
      193000 -- (-1527.112) (-1526.736) (-1523.120) [-1527.664] * (-1524.812) (-1528.051) (-1522.988) [-1523.176] -- 0:00:50
      193500 -- [-1524.508] (-1524.573) (-1522.183) (-1523.679) * (-1525.367) (-1525.461) [-1522.620] (-1523.843) -- 0:00:50
      194000 -- (-1528.050) (-1524.998) (-1524.713) [-1524.090] * (-1524.618) [-1523.721] (-1523.275) (-1523.963) -- 0:00:54
      194500 -- (-1524.428) (-1522.593) [-1523.991] (-1524.948) * (-1526.280) [-1522.907] (-1523.009) (-1524.425) -- 0:00:53
      195000 -- (-1527.180) (-1524.763) (-1524.089) [-1525.752] * (-1528.186) (-1522.871) (-1527.242) [-1525.027] -- 0:00:53

      Average standard deviation of split frequencies: 0.014855

      195500 -- [-1525.147] (-1525.348) (-1523.261) (-1523.690) * [-1528.934] (-1522.975) (-1523.571) (-1522.513) -- 0:00:53
      196000 -- (-1524.620) (-1528.915) (-1522.690) [-1524.720] * (-1523.784) [-1523.288] (-1522.819) (-1524.640) -- 0:00:53
      196500 -- (-1528.670) (-1528.317) (-1522.283) [-1524.886] * (-1523.721) [-1523.698] (-1524.833) (-1523.400) -- 0:00:53
      197000 -- (-1522.860) (-1524.527) [-1522.689] (-1523.781) * (-1523.419) (-1523.329) (-1524.162) [-1524.793] -- 0:00:52
      197500 -- [-1524.038] (-1526.230) (-1525.652) (-1524.408) * [-1524.820] (-1523.258) (-1526.801) (-1523.876) -- 0:00:52
      198000 -- (-1524.911) [-1526.193] (-1525.640) (-1524.015) * (-1527.403) (-1523.134) [-1525.013] (-1523.490) -- 0:00:52
      198500 -- (-1524.513) (-1528.259) (-1524.527) [-1523.523] * (-1528.683) (-1522.671) [-1523.488] (-1523.963) -- 0:00:52
      199000 -- (-1525.048) (-1525.758) [-1524.650] (-1523.711) * (-1526.396) (-1524.884) [-1522.759] (-1523.296) -- 0:00:52
      199500 -- (-1523.395) (-1527.322) [-1527.075] (-1523.371) * [-1524.581] (-1525.970) (-1522.450) (-1526.584) -- 0:00:52
      200000 -- [-1524.837] (-1525.532) (-1524.577) (-1523.271) * [-1525.062] (-1525.729) (-1522.647) (-1524.131) -- 0:00:51

      Average standard deviation of split frequencies: 0.014372

      200500 -- (-1524.040) [-1527.989] (-1528.129) (-1522.910) * (-1524.552) (-1523.441) (-1523.175) [-1524.873] -- 0:00:51
      201000 -- (-1523.333) [-1525.517] (-1524.694) (-1523.312) * (-1526.440) [-1523.288] (-1523.691) (-1525.696) -- 0:00:51
      201500 -- [-1524.979] (-1528.313) (-1526.725) (-1523.227) * [-1524.903] (-1523.787) (-1525.226) (-1523.805) -- 0:00:51
      202000 -- (-1527.760) (-1529.727) (-1525.915) [-1523.010] * (-1523.385) [-1523.556] (-1525.990) (-1525.351) -- 0:00:51
      202500 -- (-1526.245) [-1525.615] (-1524.941) (-1524.830) * [-1523.337] (-1525.187) (-1525.393) (-1522.613) -- 0:00:51
      203000 -- (-1524.320) (-1525.724) [-1522.907] (-1524.207) * [-1524.109] (-1527.593) (-1529.649) (-1523.687) -- 0:00:51
      203500 -- (-1523.031) [-1524.616] (-1523.828) (-1524.310) * [-1523.847] (-1529.863) (-1528.902) (-1522.538) -- 0:00:50
      204000 -- [-1523.039] (-1525.433) (-1524.466) (-1525.778) * (-1527.160) [-1527.286] (-1523.255) (-1523.328) -- 0:00:50
      204500 -- (-1524.929) (-1525.693) [-1525.202] (-1522.622) * (-1531.345) [-1524.649] (-1523.032) (-1522.704) -- 0:00:50
      205000 -- (-1523.033) [-1522.284] (-1524.759) (-1522.715) * (-1523.912) (-1524.997) [-1523.141] (-1526.468) -- 0:00:50

      Average standard deviation of split frequencies: 0.014588

      205500 -- [-1524.995] (-1523.255) (-1527.071) (-1525.038) * (-1523.322) [-1524.627] (-1522.902) (-1526.142) -- 0:00:50
      206000 -- (-1527.249) (-1528.110) [-1526.934] (-1522.237) * (-1525.378) (-1524.735) [-1523.870] (-1524.717) -- 0:00:50
      206500 -- [-1523.174] (-1522.892) (-1526.164) (-1522.275) * (-1523.360) [-1523.815] (-1523.428) (-1524.587) -- 0:00:49
      207000 -- (-1523.187) (-1523.327) (-1532.427) [-1526.918] * [-1523.689] (-1523.055) (-1524.872) (-1524.233) -- 0:00:49
      207500 -- (-1523.135) [-1523.291] (-1525.297) (-1529.709) * [-1522.765] (-1525.346) (-1524.728) (-1524.304) -- 0:00:49
      208000 -- [-1522.809] (-1523.583) (-1529.401) (-1524.314) * (-1522.459) (-1528.548) [-1524.846] (-1526.815) -- 0:00:49
      208500 -- (-1523.203) [-1523.387] (-1524.250) (-1522.886) * [-1522.459] (-1524.824) (-1529.296) (-1530.090) -- 0:00:49
      209000 -- (-1524.795) (-1523.929) (-1523.821) [-1522.625] * [-1523.502] (-1526.022) (-1524.749) (-1524.264) -- 0:00:49
      209500 -- [-1524.787] (-1528.686) (-1522.971) (-1523.219) * (-1523.074) (-1526.652) (-1524.999) [-1524.153] -- 0:00:52
      210000 -- (-1527.777) (-1526.772) (-1525.713) [-1527.402] * (-1524.738) (-1526.325) [-1524.741] (-1528.500) -- 0:00:52

      Average standard deviation of split frequencies: 0.014084

      210500 -- (-1522.789) [-1523.253] (-1524.355) (-1526.412) * (-1524.471) [-1525.023] (-1526.393) (-1527.596) -- 0:00:52
      211000 -- (-1522.789) [-1524.395] (-1523.209) (-1527.384) * (-1523.803) (-1527.793) [-1524.966] (-1526.684) -- 0:00:52
      211500 -- (-1522.789) (-1524.439) (-1523.210) [-1522.786] * (-1523.183) (-1528.374) [-1522.557] (-1531.939) -- 0:00:52
      212000 -- (-1522.789) (-1525.890) (-1523.181) [-1522.706] * [-1522.692] (-1527.032) (-1522.954) (-1526.912) -- 0:00:52
      212500 -- (-1523.516) (-1528.992) (-1522.299) [-1523.202] * [-1524.191] (-1527.982) (-1525.792) (-1525.398) -- 0:00:51
      213000 -- (-1526.544) (-1524.997) (-1522.298) [-1523.732] * [-1522.165] (-1531.337) (-1525.732) (-1524.207) -- 0:00:51
      213500 -- (-1526.773) [-1523.917] (-1522.262) (-1523.864) * (-1524.210) (-1531.753) (-1523.066) [-1523.924] -- 0:00:51
      214000 -- (-1525.903) [-1523.825] (-1522.746) (-1523.605) * (-1523.936) [-1527.074] (-1523.304) (-1525.238) -- 0:00:51
      214500 -- (-1523.748) (-1523.131) [-1522.357] (-1525.417) * [-1523.317] (-1529.057) (-1524.187) (-1522.863) -- 0:00:51
      215000 -- (-1526.053) [-1524.625] (-1522.375) (-1523.816) * [-1527.559] (-1528.911) (-1524.273) (-1522.948) -- 0:00:51

      Average standard deviation of split frequencies: 0.013367

      215500 -- (-1525.539) [-1525.401] (-1523.920) (-1530.440) * [-1522.831] (-1526.808) (-1524.047) (-1524.333) -- 0:00:50
      216000 -- (-1528.891) (-1526.078) [-1528.139] (-1523.311) * (-1522.764) (-1526.972) (-1525.652) [-1523.801] -- 0:00:50
      216500 -- (-1527.412) [-1526.105] (-1524.689) (-1522.495) * [-1525.413] (-1527.271) (-1522.647) (-1523.783) -- 0:00:50
      217000 -- (-1523.975) (-1523.557) [-1524.685] (-1522.684) * (-1523.084) [-1525.092] (-1525.801) (-1523.230) -- 0:00:50
      217500 -- (-1524.541) [-1522.553] (-1523.535) (-1523.317) * [-1525.660] (-1523.299) (-1525.013) (-1525.167) -- 0:00:50
      218000 -- (-1524.042) (-1522.552) (-1523.214) [-1523.952] * (-1523.136) (-1524.279) (-1525.933) [-1524.958] -- 0:00:50
      218500 -- (-1523.110) [-1523.924] (-1524.066) (-1528.154) * (-1525.771) [-1523.481] (-1526.577) (-1528.195) -- 0:00:50
      219000 -- (-1523.677) (-1522.824) [-1524.561] (-1527.470) * [-1526.298] (-1524.212) (-1525.594) (-1524.425) -- 0:00:49
      219500 -- (-1525.373) (-1523.818) [-1524.445] (-1524.040) * (-1527.293) (-1524.285) (-1528.504) [-1524.070] -- 0:00:49
      220000 -- (-1524.424) (-1524.947) (-1525.659) [-1524.152] * (-1525.405) (-1523.252) (-1523.772) [-1524.700] -- 0:00:49

      Average standard deviation of split frequencies: 0.012684

      220500 -- (-1525.171) [-1522.713] (-1523.251) (-1522.042) * (-1523.945) (-1523.445) [-1523.293] (-1532.025) -- 0:00:49
      221000 -- (-1523.019) [-1522.727] (-1527.039) (-1522.530) * (-1528.536) (-1524.170) [-1524.207] (-1525.869) -- 0:00:49
      221500 -- (-1533.809) (-1524.067) [-1524.812] (-1522.409) * (-1525.943) (-1527.900) [-1523.551] (-1524.413) -- 0:00:49
      222000 -- (-1525.944) (-1523.012) [-1525.228] (-1522.977) * (-1527.123) (-1524.216) [-1523.773] (-1523.848) -- 0:00:49
      222500 -- (-1527.274) (-1523.035) [-1524.859] (-1522.832) * (-1531.175) (-1523.198) (-1523.133) [-1525.234] -- 0:00:48
      223000 -- (-1523.775) (-1525.857) (-1527.280) [-1525.139] * (-1522.891) (-1523.458) [-1523.772] (-1523.756) -- 0:00:48
      223500 -- (-1523.369) [-1523.154] (-1527.279) (-1524.433) * (-1523.528) (-1522.872) (-1524.760) [-1525.290] -- 0:00:48
      224000 -- [-1523.576] (-1526.100) (-1527.973) (-1526.437) * (-1525.280) (-1525.169) [-1523.948] (-1524.666) -- 0:00:48
      224500 -- (-1523.954) (-1523.453) (-1524.334) [-1524.397] * (-1524.869) (-1525.191) (-1523.489) [-1524.273] -- 0:00:48
      225000 -- (-1529.739) (-1525.122) [-1522.473] (-1526.071) * (-1524.924) (-1524.441) [-1523.026] (-1523.890) -- 0:00:51

      Average standard deviation of split frequencies: 0.012515

      225500 -- (-1523.693) [-1524.513] (-1525.481) (-1524.244) * (-1526.704) (-1525.510) (-1522.800) [-1524.692] -- 0:00:51
      226000 -- (-1524.067) (-1523.166) [-1524.866] (-1523.984) * (-1523.068) (-1522.875) [-1522.930] (-1526.608) -- 0:00:51
      226500 -- (-1522.668) [-1523.475] (-1523.469) (-1524.983) * [-1524.194] (-1523.142) (-1524.989) (-1524.884) -- 0:00:51
      227000 -- (-1522.088) (-1525.246) (-1522.612) [-1527.282] * (-1528.889) [-1523.074] (-1524.824) (-1524.003) -- 0:00:51
      227500 -- (-1525.729) (-1525.665) [-1524.425] (-1526.597) * (-1529.082) (-1522.652) (-1523.317) [-1522.750] -- 0:00:50
      228000 -- [-1524.526] (-1523.136) (-1523.021) (-1527.499) * (-1532.294) (-1523.189) (-1524.312) [-1522.603] -- 0:00:50
      228500 -- [-1524.729] (-1523.496) (-1523.003) (-1526.068) * (-1531.975) (-1525.500) (-1524.486) [-1525.930] -- 0:00:50
      229000 -- (-1526.467) (-1525.577) [-1523.634] (-1524.743) * [-1532.402] (-1523.090) (-1524.767) (-1526.260) -- 0:00:50
      229500 -- (-1524.995) (-1525.655) [-1523.129] (-1524.619) * (-1526.903) [-1524.431] (-1528.191) (-1525.143) -- 0:00:50
      230000 -- [-1526.767] (-1524.960) (-1525.529) (-1524.916) * (-1528.031) [-1524.406] (-1526.746) (-1527.137) -- 0:00:50

      Average standard deviation of split frequencies: 0.012382

      230500 -- (-1524.167) (-1522.954) (-1525.190) [-1527.097] * (-1527.933) [-1525.199] (-1528.298) (-1526.137) -- 0:00:50
      231000 -- [-1525.849] (-1524.340) (-1526.231) (-1528.004) * [-1527.345] (-1523.877) (-1523.237) (-1527.845) -- 0:00:49
      231500 -- (-1526.904) [-1526.667] (-1523.960) (-1530.336) * [-1528.155] (-1523.808) (-1524.975) (-1525.630) -- 0:00:49
      232000 -- (-1524.490) (-1524.026) [-1525.971] (-1531.108) * (-1525.810) (-1523.078) (-1524.811) [-1524.868] -- 0:00:49
      232500 -- (-1523.967) (-1523.434) (-1523.828) [-1526.789] * (-1523.047) (-1527.163) (-1526.336) [-1525.319] -- 0:00:49
      233000 -- (-1533.169) (-1523.814) [-1525.091] (-1523.424) * [-1522.290] (-1523.411) (-1524.672) (-1525.494) -- 0:00:49
      233500 -- (-1531.078) (-1524.549) [-1523.356] (-1525.741) * (-1526.227) [-1523.301] (-1525.163) (-1526.339) -- 0:00:49
      234000 -- (-1528.536) (-1524.590) [-1523.145] (-1527.794) * (-1525.303) (-1522.722) (-1527.585) [-1524.964] -- 0:00:49
      234500 -- (-1530.536) (-1524.847) (-1537.353) [-1527.287] * (-1523.682) [-1522.182] (-1526.520) (-1525.401) -- 0:00:48
      235000 -- [-1525.481] (-1526.376) (-1526.047) (-1526.213) * [-1522.426] (-1524.621) (-1525.323) (-1522.955) -- 0:00:48

      Average standard deviation of split frequencies: 0.012651

      235500 -- [-1522.704] (-1526.261) (-1526.300) (-1526.265) * [-1522.818] (-1523.837) (-1523.881) (-1526.989) -- 0:00:48
      236000 -- [-1522.639] (-1526.253) (-1525.457) (-1525.541) * (-1522.992) [-1525.554] (-1529.190) (-1524.333) -- 0:00:48
      236500 -- [-1524.506] (-1526.000) (-1522.670) (-1528.886) * [-1522.742] (-1524.322) (-1525.958) (-1526.050) -- 0:00:48
      237000 -- [-1522.161] (-1526.243) (-1523.040) (-1525.225) * (-1523.631) [-1523.627] (-1528.370) (-1526.342) -- 0:00:48
      237500 -- (-1525.007) (-1526.109) [-1523.416] (-1524.647) * (-1526.645) (-1522.664) (-1524.180) [-1525.101] -- 0:00:48
      238000 -- (-1524.425) [-1524.756] (-1522.741) (-1525.272) * (-1522.525) (-1523.378) [-1524.248] (-1523.203) -- 0:00:48
      238500 -- (-1524.649) (-1523.920) [-1524.079] (-1525.990) * (-1524.743) [-1523.603] (-1523.559) (-1522.921) -- 0:00:47
      239000 -- (-1523.575) (-1525.508) [-1526.715] (-1523.383) * (-1524.021) (-1523.540) [-1523.192] (-1525.826) -- 0:00:47
      239500 -- [-1525.050] (-1524.000) (-1526.580) (-1523.386) * (-1522.656) (-1525.553) (-1525.260) [-1523.579] -- 0:00:47
      240000 -- (-1523.540) [-1523.023] (-1526.065) (-1523.109) * (-1524.228) (-1525.864) (-1524.344) [-1525.028] -- 0:00:47

      Average standard deviation of split frequencies: 0.012559

      240500 -- (-1523.360) (-1526.041) (-1528.244) [-1524.461] * (-1529.737) [-1528.253] (-1524.088) (-1525.612) -- 0:00:50
      241000 -- (-1523.433) [-1529.366] (-1525.285) (-1526.101) * [-1528.079] (-1525.829) (-1523.439) (-1523.959) -- 0:00:50
      241500 -- (-1523.530) [-1524.089] (-1527.276) (-1522.252) * [-1524.172] (-1525.657) (-1522.678) (-1525.230) -- 0:00:50
      242000 -- (-1522.911) (-1526.963) (-1523.513) [-1522.766] * [-1522.978] (-1524.539) (-1522.910) (-1526.763) -- 0:00:50
      242500 -- (-1522.678) (-1525.584) [-1524.549] (-1522.649) * (-1523.028) (-1525.431) [-1524.182] (-1526.935) -- 0:00:49
      243000 -- (-1526.420) [-1525.322] (-1525.115) (-1522.646) * (-1523.712) (-1523.857) (-1524.842) [-1524.906] -- 0:00:49
      243500 -- [-1529.906] (-1523.147) (-1526.401) (-1522.641) * [-1522.772] (-1525.716) (-1528.877) (-1528.596) -- 0:00:49
      244000 -- (-1529.264) (-1522.895) (-1526.004) [-1524.348] * [-1524.043] (-1524.870) (-1526.717) (-1531.453) -- 0:00:49
      244500 -- [-1525.606] (-1523.060) (-1526.647) (-1522.796) * (-1524.112) (-1522.930) (-1523.786) [-1525.154] -- 0:00:49
      245000 -- (-1525.888) [-1523.328] (-1526.438) (-1526.318) * (-1526.235) (-1522.883) (-1524.672) [-1523.549] -- 0:00:49

      Average standard deviation of split frequencies: 0.012669

      245500 -- [-1523.480] (-1523.753) (-1526.260) (-1525.076) * (-1526.882) (-1526.015) (-1524.191) [-1523.062] -- 0:00:49
      246000 -- (-1523.855) (-1526.946) [-1527.588] (-1527.072) * (-1523.859) (-1525.035) [-1522.614] (-1524.716) -- 0:00:49
      246500 -- (-1523.988) [-1523.633] (-1528.510) (-1529.115) * (-1523.709) (-1525.796) (-1524.604) [-1523.966] -- 0:00:48
      247000 -- (-1523.629) (-1523.422) (-1528.980) [-1525.254] * (-1523.662) (-1523.841) [-1527.854] (-1526.425) -- 0:00:48
      247500 -- (-1523.766) (-1525.803) (-1527.509) [-1524.092] * (-1523.647) (-1525.487) [-1523.775] (-1526.425) -- 0:00:48
      248000 -- (-1522.917) [-1528.865] (-1529.110) (-1524.579) * (-1523.647) (-1522.865) (-1522.411) [-1525.641] -- 0:00:48
      248500 -- [-1523.691] (-1524.697) (-1525.714) (-1528.705) * (-1526.873) [-1524.924] (-1524.990) (-1525.095) -- 0:00:48
      249000 -- [-1524.037] (-1524.956) (-1529.892) (-1526.233) * (-1525.580) [-1523.611] (-1524.713) (-1522.883) -- 0:00:48
      249500 -- [-1526.275] (-1525.793) (-1530.438) (-1524.673) * (-1524.812) (-1525.679) (-1523.899) [-1522.768] -- 0:00:48
      250000 -- (-1528.640) [-1524.519] (-1529.530) (-1526.327) * (-1522.669) (-1525.857) [-1522.735] (-1522.641) -- 0:00:48

      Average standard deviation of split frequencies: 0.012279

      250500 -- (-1526.659) [-1522.861] (-1527.241) (-1525.071) * [-1522.660] (-1525.072) (-1523.121) (-1522.642) -- 0:00:47
      251000 -- (-1525.618) (-1523.779) [-1524.000] (-1522.367) * (-1522.654) [-1525.191] (-1523.691) (-1522.826) -- 0:00:47
      251500 -- (-1525.677) [-1523.247] (-1523.588) (-1523.108) * (-1524.827) (-1526.963) (-1523.691) [-1523.875] -- 0:00:47
      252000 -- (-1523.294) [-1523.584] (-1523.364) (-1523.856) * (-1524.874) (-1524.881) (-1523.607) [-1524.126] -- 0:00:47
      252500 -- (-1523.960) (-1523.532) (-1523.656) [-1523.909] * [-1524.169] (-1525.238) (-1524.918) (-1525.280) -- 0:00:47
      253000 -- [-1524.405] (-1525.449) (-1525.415) (-1526.827) * [-1528.432] (-1523.337) (-1523.992) (-1528.007) -- 0:00:47
      253500 -- (-1525.335) [-1527.461] (-1523.393) (-1523.029) * (-1530.627) [-1522.569] (-1526.223) (-1529.039) -- 0:00:47
      254000 -- (-1524.501) (-1529.392) (-1524.110) [-1523.867] * (-1528.123) (-1522.900) (-1526.226) [-1525.180] -- 0:00:46
      254500 -- (-1523.265) (-1525.591) [-1524.140] (-1524.559) * (-1530.750) (-1524.911) (-1523.877) [-1524.413] -- 0:00:46
      255000 -- (-1527.185) (-1525.358) [-1525.608] (-1524.966) * (-1530.796) (-1524.820) (-1523.805) [-1524.344] -- 0:00:46

      Average standard deviation of split frequencies: 0.011698

      255500 -- (-1526.742) (-1524.697) [-1527.376] (-1527.008) * [-1526.742] (-1525.352) (-1523.418) (-1526.858) -- 0:00:46
      256000 -- (-1526.132) (-1524.695) [-1524.962] (-1523.540) * (-1524.673) (-1524.550) (-1524.124) [-1522.437] -- 0:00:46
      256500 -- [-1522.996] (-1523.670) (-1523.882) (-1526.763) * (-1525.474) [-1526.398] (-1525.908) (-1522.458) -- 0:00:49
      257000 -- (-1523.960) (-1525.337) (-1523.176) [-1524.922] * (-1524.755) (-1527.004) (-1524.825) [-1523.559] -- 0:00:49
      257500 -- [-1524.104] (-1529.362) (-1524.386) (-1525.682) * [-1522.478] (-1524.727) (-1526.343) (-1523.380) -- 0:00:49
      258000 -- (-1524.415) (-1524.425) (-1524.656) [-1525.449] * (-1523.772) (-1523.869) [-1525.013] (-1523.167) -- 0:00:48
      258500 -- (-1524.348) (-1526.273) [-1523.763] (-1523.737) * (-1522.783) (-1523.181) (-1528.598) [-1524.172] -- 0:00:48
      259000 -- (-1529.098) (-1525.869) [-1522.930] (-1522.998) * (-1528.783) (-1524.175) (-1528.598) [-1525.569] -- 0:00:48
      259500 -- (-1527.307) (-1524.794) (-1524.311) [-1523.590] * (-1528.007) (-1525.197) [-1525.786] (-1525.826) -- 0:00:48
      260000 -- (-1528.243) (-1523.827) (-1524.568) [-1523.943] * (-1533.419) [-1522.780] (-1526.451) (-1525.120) -- 0:00:48

      Average standard deviation of split frequencies: 0.011915

      260500 -- (-1524.296) (-1523.300) (-1525.564) [-1524.556] * (-1523.758) (-1523.640) [-1528.906] (-1526.423) -- 0:00:48
      261000 -- (-1525.716) (-1523.144) [-1524.973] (-1523.407) * [-1524.400] (-1523.474) (-1525.409) (-1524.361) -- 0:00:48
      261500 -- (-1523.570) (-1524.562) (-1524.618) [-1525.286] * (-1525.176) [-1523.358] (-1523.326) (-1523.561) -- 0:00:48
      262000 -- (-1524.259) (-1527.351) (-1524.384) [-1527.456] * (-1525.654) (-1528.314) [-1522.672] (-1524.853) -- 0:00:47
      262500 -- [-1523.407] (-1523.237) (-1524.003) (-1525.701) * (-1526.417) (-1523.813) (-1522.756) [-1525.307] -- 0:00:47
      263000 -- (-1522.852) (-1526.146) (-1527.301) [-1526.106] * (-1526.487) [-1524.509] (-1526.196) (-1525.424) -- 0:00:47
      263500 -- (-1527.674) (-1525.522) (-1523.491) [-1525.158] * (-1524.500) (-1524.694) [-1524.042] (-1525.522) -- 0:00:47
      264000 -- [-1523.897] (-1526.828) (-1523.599) (-1523.801) * (-1525.767) (-1525.341) [-1523.229] (-1523.987) -- 0:00:47
      264500 -- (-1523.047) [-1523.480] (-1525.983) (-1526.748) * [-1524.347] (-1524.223) (-1524.078) (-1530.135) -- 0:00:47
      265000 -- (-1523.360) (-1524.278) [-1523.896] (-1526.451) * (-1522.993) (-1524.252) (-1525.216) [-1525.134] -- 0:00:47

      Average standard deviation of split frequencies: 0.011363

      265500 -- (-1527.488) (-1524.888) [-1526.544] (-1522.859) * (-1526.024) (-1522.363) (-1527.761) [-1523.069] -- 0:00:47
      266000 -- (-1528.193) [-1528.146] (-1525.766) (-1525.297) * (-1524.070) (-1525.085) (-1525.389) [-1522.974] -- 0:00:46
      266500 -- (-1525.208) (-1524.609) [-1527.133] (-1526.184) * (-1527.049) [-1525.866] (-1524.551) (-1524.927) -- 0:00:46
      267000 -- [-1526.493] (-1524.229) (-1528.537) (-1525.244) * (-1526.147) (-1528.563) (-1525.607) [-1524.784] -- 0:00:46
      267500 -- (-1524.503) (-1525.867) (-1524.596) [-1523.040] * [-1524.418] (-1525.668) (-1525.815) (-1523.055) -- 0:00:46
      268000 -- (-1525.934) (-1524.959) [-1526.423] (-1522.913) * (-1526.183) (-1522.453) [-1524.397] (-1523.058) -- 0:00:46
      268500 -- (-1526.485) (-1523.362) [-1527.029] (-1523.671) * (-1524.102) (-1522.586) (-1523.873) [-1523.619] -- 0:00:46
      269000 -- [-1523.411] (-1522.418) (-1524.964) (-1524.853) * [-1524.621] (-1522.985) (-1528.298) (-1523.901) -- 0:00:46
      269500 -- (-1523.277) [-1523.977] (-1524.049) (-1524.662) * (-1525.579) [-1527.057] (-1527.233) (-1523.911) -- 0:00:46
      270000 -- [-1523.490] (-1523.475) (-1524.007) (-1526.080) * [-1523.348] (-1524.756) (-1524.453) (-1522.971) -- 0:00:45

      Average standard deviation of split frequencies: 0.010655

      270500 -- (-1523.528) (-1525.567) [-1522.019] (-1526.135) * [-1523.662] (-1527.068) (-1524.077) (-1523.859) -- 0:00:45
      271000 -- (-1523.778) [-1525.040] (-1522.133) (-1524.563) * [-1525.313] (-1526.890) (-1522.653) (-1523.440) -- 0:00:45
      271500 -- [-1524.350] (-1527.037) (-1527.006) (-1522.934) * [-1522.927] (-1528.953) (-1524.321) (-1522.513) -- 0:00:45
      272000 -- (-1524.749) (-1524.159) [-1523.799] (-1523.204) * [-1522.910] (-1525.203) (-1525.657) (-1524.891) -- 0:00:48
      272500 -- (-1531.483) [-1522.408] (-1524.499) (-1528.710) * (-1522.410) (-1526.059) (-1525.706) [-1523.771] -- 0:00:48
      273000 -- (-1524.191) [-1522.450] (-1523.003) (-1524.690) * (-1525.882) (-1523.580) (-1522.877) [-1522.914] -- 0:00:47
      273500 -- (-1523.702) [-1522.497] (-1524.898) (-1524.690) * (-1522.198) (-1522.880) [-1524.030] (-1522.740) -- 0:00:47
      274000 -- (-1523.432) (-1524.221) (-1525.412) [-1524.099] * (-1523.057) (-1525.892) (-1523.299) [-1527.663] -- 0:00:47
      274500 -- [-1522.926] (-1524.779) (-1526.015) (-1522.864) * (-1523.211) [-1527.183] (-1522.543) (-1527.003) -- 0:00:47
      275000 -- [-1522.951] (-1526.328) (-1523.944) (-1522.825) * (-1524.160) (-1531.958) (-1528.695) [-1524.132] -- 0:00:47

      Average standard deviation of split frequencies: 0.010147

      275500 -- [-1522.860] (-1524.784) (-1526.947) (-1524.786) * (-1526.019) (-1528.627) (-1524.338) [-1523.990] -- 0:00:47
      276000 -- (-1523.457) (-1522.742) (-1530.824) [-1524.346] * (-1527.715) (-1528.058) (-1523.185) [-1523.972] -- 0:00:47
      276500 -- (-1523.533) [-1522.785] (-1525.910) (-1524.473) * (-1526.727) (-1524.076) (-1522.892) [-1525.055] -- 0:00:47
      277000 -- (-1524.040) (-1522.490) [-1524.043] (-1523.651) * [-1525.927] (-1525.960) (-1522.937) (-1524.700) -- 0:00:46
      277500 -- (-1527.437) (-1526.335) (-1523.741) [-1522.653] * (-1527.321) (-1526.112) [-1522.860] (-1529.445) -- 0:00:46
      278000 -- (-1524.373) (-1525.394) (-1525.457) [-1522.653] * (-1525.004) (-1523.225) (-1523.516) [-1523.753] -- 0:00:46
      278500 -- (-1523.819) (-1523.321) (-1525.082) [-1522.605] * (-1524.910) (-1529.420) [-1523.224] (-1524.175) -- 0:00:46
      279000 -- (-1522.822) (-1522.880) [-1524.917] (-1522.606) * (-1524.355) [-1524.603] (-1525.849) (-1522.676) -- 0:00:46
      279500 -- [-1523.220] (-1528.450) (-1524.484) (-1526.679) * (-1523.502) (-1523.330) (-1529.903) [-1522.339] -- 0:00:46
      280000 -- [-1523.442] (-1531.274) (-1524.102) (-1525.449) * [-1523.719] (-1524.050) (-1531.064) (-1523.114) -- 0:00:46

      Average standard deviation of split frequencies: 0.012037

      280500 -- (-1524.752) (-1526.433) (-1523.836) [-1523.971] * (-1523.050) [-1523.651] (-1526.375) (-1523.822) -- 0:00:46
      281000 -- (-1526.560) (-1525.744) (-1524.597) [-1524.774] * [-1522.404] (-1524.964) (-1525.234) (-1525.016) -- 0:00:46
      281500 -- (-1529.402) (-1528.144) [-1523.239] (-1523.638) * (-1527.286) (-1523.581) (-1524.071) [-1522.319] -- 0:00:45
      282000 -- [-1529.947] (-1524.414) (-1523.809) (-1525.496) * (-1530.938) [-1525.650] (-1525.326) (-1522.665) -- 0:00:45
      282500 -- (-1527.704) [-1523.245] (-1524.831) (-1524.771) * (-1523.333) [-1522.645] (-1525.143) (-1524.675) -- 0:00:45
      283000 -- (-1526.686) (-1522.723) (-1525.489) [-1525.927] * (-1522.563) [-1522.720] (-1522.873) (-1526.383) -- 0:00:45
      283500 -- (-1524.015) [-1527.239] (-1525.415) (-1526.388) * (-1523.540) (-1525.587) [-1524.321] (-1524.212) -- 0:00:45
      284000 -- (-1529.445) (-1526.405) (-1523.294) [-1524.723] * [-1523.728] (-1525.983) (-1525.294) (-1523.759) -- 0:00:45
      284500 -- (-1528.473) [-1524.885] (-1523.311) (-1523.067) * (-1523.209) (-1524.330) (-1522.531) [-1523.586] -- 0:00:45
      285000 -- (-1528.100) (-1525.648) [-1523.914] (-1525.571) * (-1522.393) [-1525.276] (-1522.531) (-1524.033) -- 0:00:45

      Average standard deviation of split frequencies: 0.012637

      285500 -- (-1530.550) [-1522.313] (-1525.235) (-1524.647) * (-1526.054) (-1524.312) (-1523.022) [-1524.697] -- 0:00:45
      286000 -- (-1528.870) [-1523.389] (-1525.496) (-1524.750) * (-1524.145) (-1523.637) [-1524.912] (-1523.322) -- 0:00:44
      286500 -- (-1527.820) (-1523.754) [-1522.962] (-1524.970) * (-1524.593) (-1525.891) [-1523.904] (-1525.535) -- 0:00:44
      287000 -- (-1526.003) (-1524.947) (-1522.335) [-1525.699] * (-1524.547) (-1529.308) (-1527.418) [-1523.857] -- 0:00:44
      287500 -- (-1524.358) [-1523.576] (-1523.834) (-1525.634) * [-1526.015] (-1525.612) (-1523.400) (-1525.647) -- 0:00:44
      288000 -- [-1523.307] (-1527.738) (-1523.849) (-1526.759) * (-1524.882) (-1525.233) (-1524.101) [-1525.819] -- 0:00:46
      288500 -- [-1522.857] (-1523.859) (-1523.850) (-1524.692) * (-1525.923) (-1522.871) [-1522.752] (-1524.346) -- 0:00:46
      289000 -- (-1522.260) (-1522.631) (-1523.847) [-1522.819] * [-1522.917] (-1527.452) (-1522.395) (-1525.177) -- 0:00:46
      289500 -- (-1522.691) (-1522.979) (-1526.134) [-1523.620] * [-1522.938] (-1524.350) (-1526.840) (-1526.530) -- 0:00:46
      290000 -- (-1529.056) (-1523.655) [-1524.730] (-1523.712) * [-1524.162] (-1522.212) (-1523.046) (-1524.634) -- 0:00:46

      Average standard deviation of split frequencies: 0.012794

      290500 -- (-1525.461) [-1522.585] (-1522.222) (-1526.672) * (-1524.858) (-1522.117) (-1524.203) [-1522.983] -- 0:00:46
      291000 -- (-1527.066) [-1523.280] (-1522.254) (-1526.596) * (-1524.925) (-1522.684) (-1524.644) [-1526.332] -- 0:00:46
      291500 -- [-1523.568] (-1523.649) (-1522.254) (-1527.463) * (-1523.625) (-1522.783) (-1527.471) [-1524.663] -- 0:00:46
      292000 -- (-1523.847) [-1523.728] (-1522.933) (-1526.732) * (-1524.616) [-1522.562] (-1523.468) (-1526.336) -- 0:00:46
      292500 -- (-1525.857) (-1526.162) (-1524.214) [-1526.186] * (-1525.990) [-1522.689] (-1523.410) (-1524.642) -- 0:00:45
      293000 -- (-1524.029) (-1524.398) (-1522.035) [-1524.452] * (-1523.112) [-1524.088] (-1524.124) (-1523.784) -- 0:00:45
      293500 -- [-1524.241] (-1525.117) (-1522.504) (-1523.578) * [-1522.546] (-1524.778) (-1524.880) (-1526.273) -- 0:00:45
      294000 -- (-1527.021) (-1525.892) [-1523.212] (-1523.607) * [-1523.747] (-1527.678) (-1522.776) (-1525.585) -- 0:00:45
      294500 -- (-1526.049) [-1523.527] (-1523.251) (-1523.658) * (-1523.923) (-1525.490) (-1523.237) [-1524.834] -- 0:00:45
      295000 -- (-1531.617) [-1524.270] (-1525.086) (-1522.413) * (-1524.321) [-1523.682] (-1523.054) (-1527.035) -- 0:00:45

      Average standard deviation of split frequencies: 0.012918

      295500 -- [-1525.412] (-1523.424) (-1523.713) (-1523.178) * [-1524.529] (-1523.630) (-1530.822) (-1523.953) -- 0:00:45
      296000 -- (-1525.584) (-1527.099) [-1523.843] (-1523.173) * [-1526.729] (-1524.116) (-1528.742) (-1523.555) -- 0:00:45
      296500 -- (-1526.553) (-1528.140) [-1523.229] (-1523.595) * (-1526.788) (-1523.814) (-1524.618) [-1522.478] -- 0:00:45
      297000 -- (-1526.955) (-1526.668) (-1522.565) [-1522.392] * [-1528.174] (-1523.449) (-1525.684) (-1523.331) -- 0:00:44
      297500 -- (-1525.710) (-1524.109) [-1522.305] (-1523.625) * (-1528.400) [-1526.288] (-1528.297) (-1523.816) -- 0:00:44
      298000 -- (-1523.201) (-1523.761) [-1522.307] (-1522.836) * [-1523.009] (-1523.425) (-1523.818) (-1525.999) -- 0:00:44
      298500 -- (-1523.421) (-1523.746) [-1523.047] (-1526.085) * [-1523.673] (-1526.326) (-1524.488) (-1523.483) -- 0:00:44
      299000 -- (-1526.801) (-1522.839) (-1524.444) [-1522.537] * (-1528.404) [-1523.603] (-1524.164) (-1524.102) -- 0:00:44
      299500 -- [-1524.569] (-1528.274) (-1525.965) (-1523.390) * [-1528.800] (-1526.612) (-1524.258) (-1525.086) -- 0:00:44
      300000 -- (-1524.485) (-1523.047) [-1525.754] (-1525.644) * (-1525.984) (-1523.627) [-1523.178] (-1526.901) -- 0:00:44

      Average standard deviation of split frequencies: 0.013327

      300500 -- (-1526.272) [-1523.047] (-1525.188) (-1523.507) * [-1525.571] (-1523.725) (-1523.115) (-1524.904) -- 0:00:44
      301000 -- (-1527.027) (-1523.581) (-1527.230) [-1523.571] * (-1526.686) [-1526.050] (-1522.626) (-1523.534) -- 0:00:44
      301500 -- [-1523.175] (-1529.435) (-1525.466) (-1523.834) * [-1523.997] (-1523.559) (-1524.688) (-1523.786) -- 0:00:44
      302000 -- (-1522.904) (-1526.282) [-1524.367] (-1525.286) * (-1524.669) [-1523.515] (-1524.444) (-1527.889) -- 0:00:43
      302500 -- (-1524.056) (-1526.502) (-1528.624) [-1524.731] * (-1524.495) (-1524.189) (-1527.626) [-1524.254] -- 0:00:43
      303000 -- (-1523.839) [-1527.822] (-1525.031) (-1524.090) * (-1525.655) [-1525.776] (-1525.257) (-1523.164) -- 0:00:43
      303500 -- (-1524.524) (-1525.229) (-1525.945) [-1524.292] * (-1523.658) [-1526.188] (-1524.670) (-1523.919) -- 0:00:45
      304000 -- (-1525.430) [-1524.390] (-1524.858) (-1524.969) * (-1522.951) (-1524.834) (-1525.658) [-1522.868] -- 0:00:45
      304500 -- [-1527.296] (-1529.777) (-1522.049) (-1523.775) * [-1524.201] (-1524.105) (-1526.191) (-1522.644) -- 0:00:45
      305000 -- (-1523.239) (-1527.176) (-1522.049) [-1523.973] * [-1526.837] (-1524.113) (-1523.495) (-1522.941) -- 0:00:45

      Average standard deviation of split frequencies: 0.012752

      305500 -- [-1523.568] (-1524.857) (-1527.013) (-1529.638) * (-1525.709) (-1524.913) [-1524.231] (-1522.977) -- 0:00:45
      306000 -- (-1524.478) (-1526.513) [-1523.299] (-1527.067) * (-1527.180) [-1525.583] (-1525.225) (-1523.147) -- 0:00:45
      306500 -- (-1524.438) (-1533.885) (-1523.063) [-1524.738] * [-1523.774] (-1524.951) (-1529.687) (-1526.051) -- 0:00:45
      307000 -- (-1523.103) (-1529.220) (-1527.662) [-1523.949] * (-1523.955) [-1524.627] (-1524.564) (-1524.996) -- 0:00:45
      307500 -- (-1528.921) (-1523.424) (-1527.142) [-1526.983] * [-1526.131] (-1526.620) (-1524.332) (-1524.183) -- 0:00:45
      308000 -- [-1525.329] (-1528.048) (-1529.653) (-1522.599) * (-1523.697) (-1528.318) (-1531.785) [-1524.518] -- 0:00:44
      308500 -- (-1525.330) (-1527.625) [-1525.745] (-1523.274) * (-1523.091) (-1526.400) (-1524.974) [-1525.192] -- 0:00:44
      309000 -- (-1523.769) (-1531.378) (-1527.166) [-1522.627] * (-1523.392) [-1526.195] (-1522.737) (-1527.290) -- 0:00:44
      309500 -- (-1523.663) (-1527.397) [-1522.421] (-1522.958) * [-1522.913] (-1522.714) (-1524.179) (-1527.402) -- 0:00:44
      310000 -- (-1523.951) (-1524.556) [-1524.566] (-1523.260) * [-1523.253] (-1523.773) (-1523.659) (-1524.933) -- 0:00:44

      Average standard deviation of split frequencies: 0.013404

      310500 -- (-1526.288) (-1524.868) [-1524.401] (-1523.544) * (-1522.433) (-1524.174) [-1526.132] (-1524.777) -- 0:00:44
      311000 -- (-1522.341) (-1526.574) (-1524.009) [-1523.611] * (-1523.507) (-1528.469) (-1525.255) [-1525.913] -- 0:00:44
      311500 -- (-1522.239) (-1525.467) (-1530.292) [-1524.675] * (-1525.306) [-1523.518] (-1527.875) (-1523.294) -- 0:00:44
      312000 -- (-1528.322) (-1526.224) (-1523.182) [-1525.791] * [-1522.998] (-1523.684) (-1525.262) (-1524.300) -- 0:00:44
      312500 -- (-1526.285) (-1526.276) (-1524.446) [-1524.888] * (-1526.320) (-1523.889) [-1525.299] (-1524.790) -- 0:00:44
      313000 -- (-1525.936) (-1525.312) (-1525.656) [-1524.719] * [-1528.700] (-1527.791) (-1524.040) (-1524.049) -- 0:00:43
      313500 -- (-1524.739) [-1522.730] (-1527.531) (-1526.842) * (-1526.370) (-1522.344) (-1523.859) [-1524.294] -- 0:00:43
      314000 -- [-1523.611] (-1525.251) (-1529.164) (-1525.173) * (-1523.200) [-1522.334] (-1527.067) (-1524.149) -- 0:00:43
      314500 -- (-1522.322) (-1523.594) [-1526.146] (-1525.109) * (-1523.817) (-1523.563) (-1523.195) [-1522.757] -- 0:00:43
      315000 -- (-1523.550) [-1524.415] (-1526.694) (-1527.273) * (-1523.127) (-1525.155) (-1530.171) [-1522.526] -- 0:00:43

      Average standard deviation of split frequencies: 0.013583

      315500 -- (-1522.569) (-1522.613) (-1522.756) [-1523.499] * (-1523.267) (-1527.041) [-1527.222] (-1522.725) -- 0:00:43
      316000 -- (-1522.360) (-1523.873) (-1523.209) [-1525.865] * [-1522.568] (-1523.824) (-1528.039) (-1523.020) -- 0:00:43
      316500 -- (-1524.494) (-1522.769) (-1523.458) [-1525.048] * [-1522.647] (-1523.070) (-1525.473) (-1524.149) -- 0:00:43
      317000 -- (-1527.876) (-1523.834) (-1523.189) [-1525.430] * (-1522.647) (-1523.527) [-1522.163] (-1523.782) -- 0:00:43
      317500 -- (-1523.135) (-1524.858) [-1524.020] (-1523.419) * (-1525.194) (-1523.353) [-1523.665] (-1525.675) -- 0:00:42
      318000 -- (-1523.294) [-1523.917] (-1526.309) (-1523.984) * (-1524.762) [-1522.653] (-1523.677) (-1524.154) -- 0:00:42
      318500 -- (-1526.780) (-1528.873) (-1524.891) [-1524.066] * (-1522.625) (-1523.955) (-1527.039) [-1525.372] -- 0:00:42
      319000 -- (-1530.836) (-1526.912) [-1526.585] (-1528.729) * [-1524.208] (-1525.646) (-1523.217) (-1523.759) -- 0:00:42
      319500 -- (-1523.894) (-1523.167) (-1525.307) [-1527.102] * (-1523.672) (-1525.754) (-1522.912) [-1523.549] -- 0:00:44
      320000 -- (-1523.300) (-1524.705) (-1523.047) [-1526.771] * [-1524.486] (-1525.169) (-1524.594) (-1523.400) -- 0:00:44

      Average standard deviation of split frequencies: 0.013149

      320500 -- (-1522.619) (-1524.316) [-1522.424] (-1524.250) * [-1527.411] (-1525.192) (-1527.580) (-1523.095) -- 0:00:44
      321000 -- (-1522.508) [-1524.403] (-1522.384) (-1524.494) * (-1525.254) (-1525.457) (-1526.547) [-1522.793] -- 0:00:44
      321500 -- (-1522.759) [-1524.002] (-1522.575) (-1523.835) * (-1525.015) [-1522.837] (-1522.778) (-1522.888) -- 0:00:44
      322000 -- (-1522.237) (-1524.540) (-1523.244) [-1523.632] * (-1525.557) [-1523.066] (-1523.816) (-1525.950) -- 0:00:44
      322500 -- (-1522.628) (-1527.239) (-1523.186) [-1524.416] * (-1525.620) (-1523.324) [-1524.199] (-1525.482) -- 0:00:44
      323000 -- (-1523.240) (-1524.904) (-1523.318) [-1527.120] * (-1524.423) (-1524.407) [-1522.512] (-1523.511) -- 0:00:44
      323500 -- (-1525.615) (-1527.272) (-1524.892) [-1524.422] * (-1525.005) [-1522.759] (-1525.803) (-1523.575) -- 0:00:43
      324000 -- (-1523.916) (-1523.916) [-1523.397] (-1524.680) * (-1525.122) (-1524.543) (-1524.655) [-1525.928] -- 0:00:43
      324500 -- [-1522.559] (-1522.433) (-1524.856) (-1522.915) * [-1523.896] (-1524.070) (-1523.728) (-1524.907) -- 0:00:43
      325000 -- [-1526.438] (-1526.398) (-1525.440) (-1527.398) * (-1527.302) (-1522.999) (-1524.687) [-1523.993] -- 0:00:43

      Average standard deviation of split frequencies: 0.012532

      325500 -- (-1533.095) (-1524.706) [-1523.952] (-1524.089) * (-1524.805) (-1524.675) (-1526.622) [-1525.386] -- 0:00:43
      326000 -- (-1523.737) [-1526.889] (-1524.783) (-1524.068) * (-1524.991) [-1525.036] (-1525.056) (-1526.512) -- 0:00:43
      326500 -- (-1525.022) [-1528.299] (-1526.721) (-1524.327) * (-1525.314) (-1525.269) [-1525.651] (-1525.241) -- 0:00:43
      327000 -- [-1525.430] (-1524.679) (-1528.955) (-1524.790) * (-1524.858) [-1524.781] (-1525.153) (-1525.968) -- 0:00:43
      327500 -- (-1522.911) (-1523.634) (-1525.578) [-1522.753] * (-1527.220) (-1523.127) [-1525.096] (-1526.249) -- 0:00:43
      328000 -- (-1526.136) (-1523.731) [-1523.297] (-1523.938) * (-1523.745) (-1524.534) [-1525.006] (-1523.131) -- 0:00:43
      328500 -- (-1524.000) (-1526.973) (-1523.442) [-1526.858] * (-1526.844) [-1524.222] (-1527.880) (-1523.028) -- 0:00:42
      329000 -- (-1524.911) (-1528.371) [-1525.546] (-1526.094) * [-1525.832] (-1525.829) (-1523.839) (-1525.171) -- 0:00:42
      329500 -- [-1525.406] (-1524.577) (-1526.404) (-1525.337) * (-1524.911) (-1525.229) (-1526.063) [-1522.806] -- 0:00:42
      330000 -- (-1523.155) (-1527.251) (-1525.248) [-1526.296] * [-1524.746] (-1525.087) (-1524.104) (-1523.521) -- 0:00:42

      Average standard deviation of split frequencies: 0.012579

      330500 -- (-1523.155) [-1524.765] (-1523.683) (-1526.391) * [-1524.980] (-1523.926) (-1524.297) (-1523.350) -- 0:00:42
      331000 -- (-1523.044) (-1524.407) [-1523.720] (-1525.401) * (-1524.433) [-1523.498] (-1523.553) (-1523.469) -- 0:00:42
      331500 -- [-1523.339] (-1523.748) (-1526.850) (-1526.136) * [-1523.086] (-1525.290) (-1525.063) (-1522.656) -- 0:00:42
      332000 -- (-1522.383) (-1522.815) [-1524.848] (-1525.118) * (-1525.316) (-1525.878) [-1525.571] (-1522.116) -- 0:00:42
      332500 -- [-1522.535] (-1524.731) (-1527.806) (-1529.601) * (-1528.127) (-1527.515) [-1525.372] (-1524.830) -- 0:00:42
      333000 -- (-1524.584) [-1528.769] (-1523.945) (-1527.631) * (-1525.740) (-1523.489) (-1524.025) [-1523.853] -- 0:00:42
      333500 -- [-1523.283] (-1527.662) (-1527.393) (-1526.442) * (-1526.148) (-1522.608) (-1522.831) [-1522.395] -- 0:00:41
      334000 -- (-1523.147) (-1523.580) (-1529.113) [-1524.575] * [-1523.974] (-1524.732) (-1525.919) (-1522.560) -- 0:00:41
      334500 -- (-1522.947) (-1527.084) [-1522.591] (-1522.524) * (-1524.325) (-1528.125) [-1523.371] (-1525.865) -- 0:00:41
      335000 -- [-1525.415] (-1527.065) (-1523.536) (-1523.491) * (-1522.065) [-1524.928] (-1522.831) (-1523.615) -- 0:00:43

      Average standard deviation of split frequencies: 0.012003

      335500 -- (-1523.614) (-1524.248) (-1524.868) [-1527.494] * [-1523.719] (-1525.223) (-1523.899) (-1524.908) -- 0:00:43
      336000 -- (-1525.248) (-1523.191) [-1525.737] (-1525.154) * (-1528.683) (-1524.083) [-1524.316] (-1524.255) -- 0:00:43
      336500 -- (-1528.471) (-1529.619) (-1524.791) [-1524.148] * (-1530.707) (-1528.895) [-1523.658] (-1524.568) -- 0:00:43
      337000 -- [-1526.238] (-1526.176) (-1527.665) (-1523.851) * (-1529.479) (-1525.417) (-1524.420) [-1524.632] -- 0:00:43
      337500 -- [-1525.011] (-1523.927) (-1526.991) (-1523.449) * (-1524.542) (-1525.743) [-1522.272] (-1522.572) -- 0:00:43
      338000 -- (-1523.910) (-1522.916) [-1524.771] (-1524.737) * [-1524.037] (-1525.854) (-1522.272) (-1524.597) -- 0:00:43
      338500 -- (-1525.014) (-1525.003) [-1523.664] (-1523.861) * [-1525.411] (-1524.399) (-1523.878) (-1526.483) -- 0:00:42
      339000 -- (-1525.229) [-1529.052] (-1526.240) (-1523.673) * (-1523.459) (-1525.766) (-1525.394) [-1526.418] -- 0:00:42
      339500 -- (-1525.474) [-1527.910] (-1525.308) (-1527.024) * [-1522.832] (-1527.315) (-1524.149) (-1523.644) -- 0:00:42
      340000 -- (-1524.484) (-1524.852) [-1526.609] (-1526.717) * (-1522.493) (-1524.649) (-1529.279) [-1524.016] -- 0:00:42

      Average standard deviation of split frequencies: 0.013492

      340500 -- [-1523.847] (-1523.809) (-1527.004) (-1526.661) * (-1522.631) [-1524.992] (-1526.098) (-1523.640) -- 0:00:42
      341000 -- [-1524.982] (-1526.022) (-1531.894) (-1524.046) * (-1522.562) (-1524.629) [-1527.021] (-1522.579) -- 0:00:42
      341500 -- [-1526.165] (-1525.260) (-1528.384) (-1523.446) * (-1527.563) [-1527.597] (-1523.891) (-1524.249) -- 0:00:42
      342000 -- (-1526.776) [-1522.287] (-1526.318) (-1523.445) * (-1528.006) (-1523.921) [-1524.172] (-1523.210) -- 0:00:42
      342500 -- (-1524.230) [-1523.570] (-1522.316) (-1526.873) * (-1525.441) (-1523.861) [-1524.260] (-1523.253) -- 0:00:42
      343000 -- (-1525.591) [-1523.867] (-1524.429) (-1524.460) * (-1524.647) (-1525.322) (-1524.541) [-1523.843] -- 0:00:42
      343500 -- (-1524.239) (-1526.119) (-1525.095) [-1524.089] * [-1523.587] (-1525.645) (-1523.508) (-1523.139) -- 0:00:42
      344000 -- (-1524.239) (-1525.237) (-1524.914) [-1523.914] * (-1526.358) (-1524.171) [-1522.789] (-1525.286) -- 0:00:41
      344500 -- (-1524.798) (-1524.821) [-1523.500] (-1526.879) * (-1523.681) (-1522.704) [-1525.066] (-1524.214) -- 0:00:41
      345000 -- (-1525.221) (-1524.099) (-1528.113) [-1523.139] * [-1525.113] (-1523.713) (-1522.381) (-1526.581) -- 0:00:41

      Average standard deviation of split frequencies: 0.013473

      345500 -- [-1525.652] (-1525.004) (-1524.589) (-1522.441) * [-1522.857] (-1524.691) (-1523.379) (-1525.300) -- 0:00:41
      346000 -- (-1523.945) (-1525.711) (-1524.107) [-1522.441] * [-1523.611] (-1523.318) (-1529.310) (-1524.443) -- 0:00:41
      346500 -- (-1524.735) (-1526.104) [-1522.749] (-1522.669) * [-1523.854] (-1522.962) (-1524.650) (-1526.112) -- 0:00:41
      347000 -- [-1526.041] (-1527.185) (-1522.606) (-1528.467) * (-1524.279) (-1527.551) [-1523.101] (-1524.226) -- 0:00:41
      347500 -- (-1523.386) (-1525.054) (-1522.388) [-1522.776] * [-1527.058] (-1526.847) (-1526.080) (-1525.222) -- 0:00:41
      348000 -- [-1524.098] (-1523.719) (-1522.314) (-1522.570) * (-1525.037) (-1525.896) [-1525.679] (-1524.439) -- 0:00:41
      348500 -- (-1522.933) (-1523.942) [-1522.827] (-1525.559) * [-1523.984] (-1524.813) (-1525.411) (-1525.789) -- 0:00:41
      349000 -- (-1525.690) (-1524.606) (-1525.604) [-1526.099] * (-1523.645) (-1526.344) [-1523.140] (-1526.168) -- 0:00:41
      349500 -- (-1523.861) (-1524.164) [-1522.961] (-1525.384) * (-1527.597) (-1526.676) (-1525.353) [-1523.386] -- 0:00:40
      350000 -- (-1524.901) (-1524.757) [-1522.735] (-1524.328) * (-1524.643) (-1526.278) [-1523.999] (-1523.370) -- 0:00:40

      Average standard deviation of split frequencies: 0.015534

      350500 -- [-1529.133] (-1524.094) (-1524.190) (-1524.569) * (-1522.644) (-1527.163) (-1522.905) [-1522.331] -- 0:00:40
      351000 -- (-1524.951) (-1526.025) (-1523.314) [-1523.668] * (-1522.581) (-1524.621) [-1522.723] (-1524.751) -- 0:00:42
      351500 -- (-1524.395) (-1526.371) (-1525.292) [-1522.812] * (-1525.674) (-1523.112) [-1524.337] (-1523.579) -- 0:00:42
      352000 -- (-1525.566) (-1525.103) (-1524.792) [-1524.363] * [-1523.217] (-1524.804) (-1525.125) (-1524.107) -- 0:00:42
      352500 -- (-1525.680) (-1526.882) [-1525.938] (-1524.049) * (-1522.703) (-1525.029) (-1525.312) [-1523.157] -- 0:00:42
      353000 -- [-1523.514] (-1526.800) (-1525.245) (-1526.206) * (-1524.175) [-1524.783] (-1524.255) (-1522.361) -- 0:00:42
      353500 -- [-1524.357] (-1525.055) (-1525.854) (-1525.121) * (-1523.694) [-1523.034] (-1522.220) (-1522.334) -- 0:00:42
      354000 -- (-1525.375) (-1524.171) (-1523.605) [-1523.184] * (-1524.043) [-1522.998] (-1524.563) (-1522.527) -- 0:00:41
      354500 -- (-1526.347) [-1523.998] (-1527.360) (-1527.180) * [-1523.174] (-1523.189) (-1525.300) (-1523.493) -- 0:00:41
      355000 -- (-1525.891) (-1525.114) [-1530.026] (-1523.996) * (-1524.013) [-1522.616] (-1532.092) (-1523.499) -- 0:00:41

      Average standard deviation of split frequencies: 0.014566

      355500 -- (-1523.569) [-1526.063] (-1534.908) (-1522.381) * (-1523.048) (-1524.056) (-1524.447) [-1523.137] -- 0:00:41
      356000 -- [-1523.751] (-1523.895) (-1529.325) (-1522.321) * [-1524.005] (-1524.831) (-1522.240) (-1523.677) -- 0:00:41
      356500 -- (-1522.572) (-1525.818) [-1524.648] (-1523.240) * (-1524.007) (-1524.830) [-1527.600] (-1523.914) -- 0:00:41
      357000 -- (-1522.112) (-1528.415) [-1523.632] (-1523.288) * (-1525.339) (-1523.335) (-1526.665) [-1523.375] -- 0:00:41
      357500 -- [-1522.112] (-1523.754) (-1526.122) (-1523.935) * [-1525.869] (-1523.335) (-1526.853) (-1526.560) -- 0:00:41
      358000 -- (-1522.339) [-1525.848] (-1524.518) (-1526.988) * (-1522.804) (-1524.154) (-1526.450) [-1522.830] -- 0:00:41
      358500 -- (-1523.335) [-1526.581] (-1523.894) (-1525.241) * (-1523.120) [-1523.278] (-1523.593) (-1524.225) -- 0:00:41
      359000 -- (-1522.305) (-1525.000) (-1523.065) [-1525.098] * (-1525.206) (-1523.168) (-1526.572) [-1524.421] -- 0:00:41
      359500 -- (-1523.178) (-1523.920) (-1525.560) [-1522.904] * (-1525.114) (-1524.536) [-1523.824] (-1524.248) -- 0:00:40
      360000 -- [-1524.223] (-1523.798) (-1522.516) (-1524.159) * (-1526.984) [-1523.207] (-1524.145) (-1523.034) -- 0:00:40

      Average standard deviation of split frequencies: 0.014668

      360500 -- (-1527.018) (-1523.432) [-1522.598] (-1523.261) * (-1528.757) [-1523.870] (-1529.487) (-1527.343) -- 0:00:40
      361000 -- (-1524.492) (-1523.954) (-1523.296) [-1523.690] * [-1525.218] (-1522.779) (-1525.906) (-1525.203) -- 0:00:40
      361500 -- (-1524.112) (-1526.187) (-1522.882) [-1525.015] * [-1527.746] (-1525.507) (-1524.697) (-1524.181) -- 0:00:40
      362000 -- (-1526.298) (-1529.483) (-1523.112) [-1525.007] * [-1525.669] (-1524.096) (-1527.017) (-1526.592) -- 0:00:40
      362500 -- (-1526.971) (-1526.974) (-1522.413) [-1524.902] * (-1528.270) (-1523.325) (-1524.933) [-1523.473] -- 0:00:40
      363000 -- (-1526.559) [-1526.747] (-1525.293) (-1525.046) * (-1523.359) (-1523.985) (-1525.697) [-1522.565] -- 0:00:40
      363500 -- (-1527.450) [-1524.971] (-1522.728) (-1524.002) * (-1523.861) (-1523.626) [-1525.225] (-1522.598) -- 0:00:40
      364000 -- (-1524.733) [-1522.625] (-1523.224) (-1524.400) * (-1524.355) (-1522.886) [-1527.986] (-1525.738) -- 0:00:40
      364500 -- (-1528.420) [-1522.668] (-1524.350) (-1524.091) * (-1526.897) [-1524.401] (-1523.895) (-1524.842) -- 0:00:40
      365000 -- (-1525.552) [-1522.744] (-1525.916) (-1522.782) * [-1525.265] (-1523.710) (-1523.876) (-1526.141) -- 0:00:40

      Average standard deviation of split frequencies: 0.013953

      365500 -- [-1524.612] (-1525.768) (-1527.955) (-1523.518) * [-1523.533] (-1525.800) (-1522.638) (-1526.223) -- 0:00:39
      366000 -- [-1523.598] (-1522.697) (-1523.050) (-1523.281) * [-1525.225] (-1526.746) (-1522.751) (-1525.250) -- 0:00:39
      366500 -- (-1523.540) (-1522.797) [-1526.435] (-1524.926) * [-1527.108] (-1527.786) (-1525.258) (-1528.322) -- 0:00:41
      367000 -- [-1522.780] (-1528.856) (-1523.664) (-1524.573) * [-1523.544] (-1525.279) (-1526.633) (-1526.475) -- 0:00:41
      367500 -- [-1525.505] (-1523.930) (-1523.584) (-1524.976) * (-1524.238) (-1525.709) (-1523.747) [-1523.440] -- 0:00:41
      368000 -- (-1525.520) [-1522.477] (-1523.193) (-1526.282) * (-1525.981) [-1523.690] (-1524.855) (-1524.189) -- 0:00:41
      368500 -- [-1524.151] (-1522.976) (-1524.870) (-1526.588) * (-1525.270) [-1524.773] (-1528.898) (-1524.527) -- 0:00:41
      369000 -- (-1525.031) (-1523.047) [-1524.960] (-1524.877) * (-1526.006) (-1523.888) (-1522.456) [-1526.640] -- 0:00:41
      369500 -- [-1524.656] (-1526.404) (-1522.170) (-1523.735) * [-1523.032] (-1522.411) (-1522.814) (-1523.524) -- 0:00:40
      370000 -- (-1523.329) (-1523.189) [-1522.218] (-1525.166) * [-1523.093] (-1523.181) (-1522.825) (-1522.856) -- 0:00:40

      Average standard deviation of split frequencies: 0.013990

      370500 -- (-1522.832) (-1523.239) (-1523.045) [-1525.092] * (-1523.841) (-1523.823) [-1526.381] (-1524.777) -- 0:00:40
      371000 -- [-1525.121] (-1522.646) (-1523.936) (-1524.309) * (-1528.002) (-1525.888) [-1524.963] (-1524.601) -- 0:00:40
      371500 -- [-1525.442] (-1522.846) (-1526.727) (-1523.881) * (-1525.387) (-1526.854) [-1523.095] (-1523.808) -- 0:00:40
      372000 -- [-1524.013] (-1524.703) (-1524.655) (-1522.949) * (-1524.288) (-1525.183) [-1523.107] (-1523.143) -- 0:00:40
      372500 -- (-1526.544) [-1524.828] (-1522.482) (-1523.599) * [-1525.429] (-1523.484) (-1523.900) (-1522.882) -- 0:00:40
      373000 -- (-1522.737) (-1524.897) [-1523.595] (-1523.366) * (-1525.315) [-1524.816] (-1523.900) (-1522.332) -- 0:00:40
      373500 -- (-1525.536) (-1525.490) [-1524.649] (-1523.343) * (-1522.570) (-1525.244) [-1523.848] (-1523.284) -- 0:00:40
      374000 -- (-1526.649) (-1524.238) (-1524.823) [-1527.168] * (-1522.446) (-1524.476) (-1523.395) [-1525.313] -- 0:00:40
      374500 -- (-1530.256) (-1524.615) (-1524.685) [-1524.405] * (-1522.671) (-1529.337) [-1526.478] (-1522.597) -- 0:00:40
      375000 -- [-1527.072] (-1526.421) (-1524.363) (-1522.673) * (-1524.999) (-1527.979) (-1524.627) [-1522.772] -- 0:00:40

      Average standard deviation of split frequencies: 0.012906

      375500 -- [-1526.643] (-1529.116) (-1523.127) (-1523.111) * (-1523.007) (-1527.587) [-1524.820] (-1523.635) -- 0:00:39
      376000 -- [-1522.946] (-1524.788) (-1524.506) (-1522.712) * [-1524.231] (-1525.978) (-1525.609) (-1524.403) -- 0:00:39
      376500 -- (-1528.727) (-1527.043) [-1524.421] (-1523.228) * (-1525.178) [-1526.079] (-1523.936) (-1528.197) -- 0:00:39
      377000 -- [-1528.697] (-1524.937) (-1524.183) (-1523.431) * (-1527.767) (-1523.164) (-1526.034) [-1525.613] -- 0:00:39
      377500 -- (-1523.309) (-1527.223) (-1522.829) [-1526.310] * (-1527.768) (-1522.637) (-1523.081) [-1524.353] -- 0:00:39
      378000 -- [-1523.516] (-1525.393) (-1523.494) (-1522.454) * [-1524.010] (-1526.997) (-1523.502) (-1527.038) -- 0:00:39
      378500 -- [-1523.568] (-1524.469) (-1523.752) (-1522.987) * (-1524.538) (-1527.159) (-1524.932) [-1525.693] -- 0:00:39
      379000 -- (-1530.209) (-1524.620) [-1522.721] (-1524.984) * [-1524.827] (-1523.134) (-1523.198) (-1526.134) -- 0:00:39
      379500 -- (-1524.078) (-1524.745) (-1524.331) [-1524.192] * (-1524.826) [-1523.235] (-1524.426) (-1523.946) -- 0:00:39
      380000 -- (-1524.865) (-1524.788) (-1525.796) [-1525.236] * (-1526.794) (-1525.723) [-1523.369] (-1526.532) -- 0:00:39

      Average standard deviation of split frequencies: 0.012894

      380500 -- [-1522.744] (-1526.724) (-1522.576) (-1523.885) * (-1525.077) (-1527.877) (-1523.973) [-1522.405] -- 0:00:39
      381000 -- [-1522.849] (-1524.502) (-1524.195) (-1523.873) * (-1527.860) (-1523.327) [-1523.567] (-1524.873) -- 0:00:38
      381500 -- (-1527.399) [-1525.920] (-1523.365) (-1524.259) * (-1525.250) (-1526.585) (-1528.337) [-1525.149] -- 0:00:38
      382000 -- (-1527.625) (-1527.946) (-1524.246) [-1523.262] * (-1525.390) (-1528.136) [-1524.056] (-1527.264) -- 0:00:38
      382500 -- [-1523.069] (-1523.064) (-1524.725) (-1523.492) * (-1527.867) (-1526.777) [-1524.808] (-1523.081) -- 0:00:40
      383000 -- (-1523.964) (-1524.976) (-1527.206) [-1524.024] * [-1526.898] (-1525.053) (-1524.724) (-1523.846) -- 0:00:40
      383500 -- (-1522.704) (-1524.651) [-1525.834] (-1522.884) * (-1526.002) (-1522.749) (-1523.003) [-1523.623] -- 0:00:40
      384000 -- (-1522.487) (-1523.955) [-1524.110] (-1525.081) * [-1525.543] (-1529.389) (-1523.841) (-1522.832) -- 0:00:40
      384500 -- (-1522.438) [-1526.350] (-1523.107) (-1523.695) * (-1530.150) [-1523.384] (-1524.928) (-1524.976) -- 0:00:40
      385000 -- (-1522.880) (-1526.813) (-1525.505) [-1526.391] * (-1526.088) (-1523.044) (-1523.273) [-1525.882] -- 0:00:39

      Average standard deviation of split frequencies: 0.012791

      385500 -- (-1522.880) [-1522.979] (-1524.733) (-1526.821) * (-1523.781) (-1522.946) (-1524.183) [-1525.729] -- 0:00:39
      386000 -- (-1525.148) (-1524.214) [-1523.441] (-1531.217) * [-1523.397] (-1522.660) (-1524.657) (-1525.087) -- 0:00:39
      386500 -- (-1527.683) (-1524.934) (-1525.229) [-1523.005] * (-1523.928) [-1522.482] (-1524.717) (-1523.123) -- 0:00:39
      387000 -- (-1529.984) (-1523.699) (-1527.167) [-1525.044] * [-1523.504] (-1524.085) (-1522.877) (-1523.589) -- 0:00:39
      387500 -- (-1525.360) (-1523.032) (-1524.323) [-1524.668] * [-1525.460] (-1525.611) (-1524.149) (-1526.006) -- 0:00:39
      388000 -- (-1524.598) (-1527.804) [-1522.573] (-1523.588) * [-1525.304] (-1523.322) (-1525.383) (-1523.603) -- 0:00:39
      388500 -- (-1525.722) [-1529.427] (-1524.524) (-1523.894) * (-1527.312) (-1524.975) [-1527.659] (-1523.904) -- 0:00:39
      389000 -- (-1522.758) (-1525.050) (-1524.878) [-1523.656] * (-1523.678) (-1524.870) (-1524.924) [-1522.224] -- 0:00:39
      389500 -- (-1523.544) (-1529.629) (-1526.776) [-1523.217] * (-1524.337) [-1524.827] (-1523.451) (-1524.773) -- 0:00:39
      390000 -- (-1522.651) (-1525.413) [-1526.536] (-1523.531) * (-1526.605) (-1523.292) [-1523.325] (-1526.765) -- 0:00:39

      Average standard deviation of split frequencies: 0.011933

      390500 -- (-1523.123) (-1526.235) (-1528.158) [-1522.673] * (-1528.750) (-1525.554) [-1524.669] (-1525.694) -- 0:00:39
      391000 -- (-1523.337) (-1530.967) [-1524.609] (-1522.413) * (-1525.051) [-1523.816] (-1525.297) (-1524.499) -- 0:00:38
      391500 -- (-1524.379) (-1527.943) (-1522.922) [-1527.924] * (-1524.810) (-1526.237) [-1525.399] (-1525.531) -- 0:00:38
      392000 -- [-1523.805] (-1525.963) (-1527.782) (-1523.266) * (-1525.176) (-1523.260) (-1524.957) [-1526.834] -- 0:00:38
      392500 -- [-1523.857] (-1525.549) (-1527.056) (-1523.502) * (-1526.935) [-1522.812] (-1524.434) (-1524.815) -- 0:00:38
      393000 -- (-1524.503) (-1527.345) [-1525.525] (-1522.451) * (-1526.998) (-1522.622) (-1528.395) [-1524.675] -- 0:00:38
      393500 -- [-1526.986] (-1527.032) (-1526.752) (-1522.450) * [-1525.282] (-1523.921) (-1526.615) (-1524.261) -- 0:00:38
      394000 -- (-1525.038) [-1524.745] (-1524.467) (-1522.505) * (-1524.029) (-1524.115) [-1528.096] (-1524.014) -- 0:00:38
      394500 -- (-1525.814) (-1523.623) (-1525.632) [-1524.101] * (-1525.113) (-1525.487) (-1529.096) [-1524.724] -- 0:00:38
      395000 -- (-1526.936) (-1525.632) [-1524.358] (-1523.320) * (-1524.820) (-1524.821) [-1527.349] (-1526.819) -- 0:00:38

      Average standard deviation of split frequencies: 0.011970

      395500 -- (-1525.265) (-1525.619) [-1527.183] (-1522.979) * [-1525.718] (-1525.236) (-1523.530) (-1525.479) -- 0:00:38
      396000 -- (-1524.120) (-1525.440) (-1522.963) [-1522.473] * (-1525.855) [-1525.182] (-1524.653) (-1526.150) -- 0:00:38
      396500 -- (-1526.307) (-1524.458) [-1524.298] (-1523.681) * (-1526.895) [-1526.785] (-1525.200) (-1523.532) -- 0:00:38
      397000 -- (-1525.085) [-1526.862] (-1524.244) (-1522.579) * (-1523.913) (-1530.531) [-1523.843] (-1523.848) -- 0:00:37
      397500 -- (-1525.197) (-1524.547) [-1523.368] (-1523.563) * (-1523.599) (-1523.732) [-1522.939] (-1524.120) -- 0:00:37
      398000 -- (-1524.862) [-1525.396] (-1524.744) (-1523.580) * (-1528.022) [-1523.852] (-1524.058) (-1526.250) -- 0:00:39
      398500 -- (-1525.936) [-1523.057] (-1525.306) (-1523.753) * (-1523.069) (-1525.298) [-1523.693] (-1526.008) -- 0:00:39
      399000 -- (-1528.944) [-1525.582] (-1528.259) (-1523.831) * (-1523.961) [-1529.524] (-1523.754) (-1524.130) -- 0:00:39
      399500 -- (-1524.924) [-1526.210] (-1526.509) (-1525.298) * (-1523.970) (-1524.578) [-1523.673] (-1522.302) -- 0:00:39
      400000 -- [-1525.297] (-1523.574) (-1524.005) (-1524.905) * (-1524.666) [-1523.504] (-1529.088) (-1523.768) -- 0:00:39

      Average standard deviation of split frequencies: 0.011896

      400500 -- (-1527.575) [-1524.652] (-1531.353) (-1524.455) * (-1522.257) [-1525.751] (-1528.469) (-1524.376) -- 0:00:38
      401000 -- [-1528.046] (-1524.541) (-1529.047) (-1524.275) * (-1525.457) (-1523.619) [-1525.622] (-1523.409) -- 0:00:38
      401500 -- (-1523.389) [-1528.163] (-1526.712) (-1531.252) * [-1523.300] (-1526.025) (-1525.066) (-1527.122) -- 0:00:38
      402000 -- (-1522.912) [-1525.377] (-1523.413) (-1523.347) * (-1524.602) [-1524.276] (-1524.156) (-1523.863) -- 0:00:38
      402500 -- (-1522.879) [-1523.972] (-1524.586) (-1525.634) * [-1524.757] (-1524.276) (-1525.552) (-1523.704) -- 0:00:38
      403000 -- [-1524.683] (-1523.221) (-1525.615) (-1526.979) * (-1522.684) (-1526.855) [-1523.350] (-1522.512) -- 0:00:38
      403500 -- (-1527.003) (-1526.798) (-1523.599) [-1526.405] * (-1528.558) (-1529.325) (-1524.152) [-1522.347] -- 0:00:38
      404000 -- (-1527.399) (-1524.941) (-1523.908) [-1524.480] * (-1523.426) (-1530.133) [-1526.669] (-1522.628) -- 0:00:38
      404500 -- (-1525.082) (-1525.226) (-1523.815) [-1524.670] * [-1525.159] (-1526.817) (-1522.775) (-1523.258) -- 0:00:38
      405000 -- (-1527.078) (-1524.762) [-1526.589] (-1530.357) * (-1523.654) (-1531.047) (-1525.940) [-1523.535] -- 0:00:38

      Average standard deviation of split frequencies: 0.011933

      405500 -- (-1523.374) (-1523.476) [-1524.902] (-1523.718) * [-1523.658] (-1529.610) (-1522.567) (-1524.326) -- 0:00:38
      406000 -- (-1523.064) (-1523.767) [-1523.497] (-1525.698) * (-1522.368) (-1528.059) (-1530.059) [-1523.316] -- 0:00:38
      406500 -- (-1523.050) (-1523.745) [-1524.327] (-1524.799) * (-1524.785) (-1529.722) [-1524.182] (-1525.054) -- 0:00:37
      407000 -- (-1525.816) (-1522.121) (-1524.490) [-1523.787] * (-1523.360) (-1523.503) [-1522.711] (-1525.111) -- 0:00:37
      407500 -- [-1524.197] (-1523.556) (-1522.784) (-1523.358) * [-1522.989] (-1523.177) (-1523.019) (-1523.564) -- 0:00:37
      408000 -- [-1523.099] (-1526.380) (-1524.903) (-1523.381) * [-1523.635] (-1522.836) (-1523.998) (-1524.051) -- 0:00:37
      408500 -- [-1523.760] (-1523.821) (-1523.999) (-1522.805) * [-1522.800] (-1522.882) (-1524.227) (-1524.684) -- 0:00:37
      409000 -- (-1523.145) [-1523.372] (-1523.948) (-1523.429) * [-1524.054] (-1523.629) (-1527.711) (-1524.433) -- 0:00:37
      409500 -- (-1526.289) (-1523.436) (-1526.127) [-1524.263] * [-1524.475] (-1523.988) (-1526.714) (-1523.906) -- 0:00:37
      410000 -- (-1526.149) (-1523.240) (-1524.874) [-1524.519] * (-1525.625) (-1526.373) [-1523.577] (-1523.544) -- 0:00:37

      Average standard deviation of split frequencies: 0.012627

      410500 -- (-1526.467) [-1523.523] (-1526.207) (-1525.001) * [-1525.785] (-1524.478) (-1530.011) (-1524.986) -- 0:00:37
      411000 -- (-1525.900) [-1522.479] (-1527.834) (-1523.519) * (-1523.902) (-1526.707) (-1526.410) [-1526.489] -- 0:00:37
      411500 -- (-1525.474) (-1523.503) (-1526.357) [-1524.142] * (-1523.270) (-1527.034) [-1525.318] (-1524.356) -- 0:00:37
      412000 -- [-1526.943] (-1525.996) (-1522.346) (-1523.874) * (-1526.712) (-1526.833) (-1524.466) [-1524.338] -- 0:00:37
      412500 -- [-1525.938] (-1527.951) (-1524.191) (-1525.051) * (-1523.316) (-1522.743) (-1525.404) [-1523.276] -- 0:00:37
      413000 -- [-1524.982] (-1525.337) (-1524.168) (-1522.379) * [-1522.946] (-1525.468) (-1527.138) (-1529.073) -- 0:00:38
      413500 -- [-1525.088] (-1525.390) (-1524.683) (-1525.490) * (-1524.695) [-1524.358] (-1524.612) (-1527.345) -- 0:00:38
      414000 -- (-1523.272) (-1526.004) (-1524.705) [-1526.050] * (-1526.360) [-1524.510] (-1525.005) (-1525.046) -- 0:00:38
      414500 -- (-1523.422) (-1526.744) [-1523.559] (-1522.581) * (-1526.938) [-1524.726] (-1524.289) (-1525.059) -- 0:00:38
      415000 -- (-1523.413) [-1524.157] (-1526.087) (-1523.399) * (-1523.007) (-1523.520) (-1530.045) [-1525.572] -- 0:00:38

      Average standard deviation of split frequencies: 0.013472

      415500 -- (-1523.345) (-1526.787) [-1529.102] (-1523.403) * (-1524.958) (-1522.415) [-1525.692] (-1523.948) -- 0:00:37
      416000 -- (-1526.577) (-1526.612) [-1525.503] (-1526.591) * (-1523.696) (-1523.874) [-1523.672] (-1524.487) -- 0:00:37
      416500 -- (-1528.289) (-1528.087) [-1523.380] (-1527.611) * (-1523.801) (-1523.566) [-1523.082] (-1524.719) -- 0:00:37
      417000 -- (-1527.510) [-1522.612] (-1523.406) (-1527.908) * (-1523.263) [-1522.597] (-1523.003) (-1524.389) -- 0:00:37
      417500 -- (-1525.175) (-1522.487) (-1524.470) [-1526.969] * (-1523.193) (-1523.418) (-1523.439) [-1525.523] -- 0:00:37
      418000 -- (-1525.253) (-1522.404) [-1523.885] (-1525.352) * (-1524.582) [-1526.060] (-1524.619) (-1524.417) -- 0:00:37
      418500 -- [-1525.034] (-1523.915) (-1524.158) (-1529.054) * (-1522.956) (-1522.824) (-1528.372) [-1523.222] -- 0:00:37
      419000 -- (-1530.437) (-1523.749) [-1524.065] (-1532.254) * (-1524.038) [-1522.394] (-1524.620) (-1522.175) -- 0:00:37
      419500 -- (-1523.811) (-1523.716) [-1523.425] (-1525.869) * (-1526.470) (-1524.571) [-1522.309] (-1524.296) -- 0:00:37
      420000 -- (-1524.931) (-1523.441) [-1522.592] (-1524.778) * (-1527.074) (-1522.821) [-1524.348] (-1525.242) -- 0:00:37

      Average standard deviation of split frequencies: 0.013883

      420500 -- (-1523.117) (-1522.759) [-1523.257] (-1525.123) * (-1525.612) (-1522.775) [-1522.811] (-1523.704) -- 0:00:37
      421000 -- (-1522.546) (-1522.659) (-1524.500) [-1524.684] * (-1527.549) (-1523.104) (-1523.111) [-1524.210] -- 0:00:37
      421500 -- (-1526.954) (-1524.793) [-1524.425] (-1523.231) * (-1527.588) (-1525.194) (-1524.816) [-1523.780] -- 0:00:37
      422000 -- (-1522.425) (-1524.374) [-1524.707] (-1523.782) * (-1528.789) (-1523.946) [-1525.791] (-1523.126) -- 0:00:36
      422500 -- [-1522.519] (-1525.346) (-1525.185) (-1527.018) * (-1527.263) [-1524.245] (-1525.269) (-1524.627) -- 0:00:36
      423000 -- (-1523.414) (-1523.331) (-1523.339) [-1525.936] * [-1525.031] (-1525.247) (-1525.227) (-1523.554) -- 0:00:36
      423500 -- [-1522.626] (-1523.251) (-1526.393) (-1523.027) * (-1523.632) (-1524.351) (-1526.441) [-1524.617] -- 0:00:36
      424000 -- (-1522.996) (-1523.538) [-1523.226] (-1523.260) * (-1523.953) (-1525.224) [-1525.544] (-1523.107) -- 0:00:36
      424500 -- (-1523.422) [-1523.503] (-1522.459) (-1524.861) * (-1524.230) (-1524.257) (-1526.007) [-1523.723] -- 0:00:36
      425000 -- (-1525.300) [-1524.315] (-1522.857) (-1525.064) * (-1523.376) (-1524.347) (-1523.748) [-1523.492] -- 0:00:36

      Average standard deviation of split frequencies: 0.014017

      425500 -- (-1529.394) (-1530.493) (-1523.728) [-1523.295] * (-1524.177) [-1524.740] (-1524.634) (-1526.758) -- 0:00:36
      426000 -- [-1524.656] (-1527.551) (-1523.728) (-1527.199) * (-1525.993) (-1524.020) [-1522.711] (-1522.436) -- 0:00:36
      426500 -- (-1523.279) (-1526.387) [-1525.596] (-1523.203) * (-1524.935) (-1525.289) [-1524.687] (-1524.101) -- 0:00:37
      427000 -- (-1523.008) (-1522.790) [-1525.642] (-1523.890) * (-1527.635) [-1523.252] (-1524.064) (-1524.113) -- 0:00:37
      427500 -- (-1525.423) [-1523.991] (-1524.818) (-1529.361) * (-1531.729) (-1526.921) [-1523.193] (-1525.177) -- 0:00:37
      428000 -- (-1526.333) [-1522.888] (-1523.312) (-1528.308) * (-1529.679) [-1522.277] (-1524.740) (-1524.156) -- 0:00:37
      428500 -- (-1529.793) (-1525.120) (-1525.080) [-1527.945] * (-1524.242) (-1525.322) [-1525.459] (-1524.418) -- 0:00:37
      429000 -- [-1524.898] (-1528.180) (-1523.981) (-1525.511) * (-1527.537) (-1525.704) (-1523.141) [-1522.688] -- 0:00:37
      429500 -- (-1522.664) (-1529.956) [-1524.687] (-1523.866) * (-1524.276) (-1527.329) (-1523.141) [-1525.569] -- 0:00:37
      430000 -- (-1523.881) (-1528.542) [-1524.452] (-1527.377) * [-1523.455] (-1524.576) (-1523.451) (-1527.894) -- 0:00:37

      Average standard deviation of split frequencies: 0.013986

      430500 -- (-1524.000) (-1527.082) [-1525.034] (-1523.938) * (-1522.711) [-1526.929] (-1523.887) (-1529.680) -- 0:00:37
      431000 -- (-1523.520) (-1523.866) [-1523.950] (-1525.087) * (-1524.316) (-1524.403) [-1523.037] (-1527.012) -- 0:00:36
      431500 -- (-1526.209) (-1523.789) (-1523.568) [-1523.365] * (-1524.089) (-1525.320) (-1523.973) [-1525.398] -- 0:00:36
      432000 -- (-1525.396) [-1523.871] (-1524.532) (-1522.265) * (-1524.666) [-1524.585] (-1524.599) (-1529.875) -- 0:00:36
      432500 -- [-1522.657] (-1530.462) (-1525.929) (-1522.042) * (-1524.893) (-1522.253) [-1522.795] (-1523.876) -- 0:00:36
      433000 -- (-1522.580) (-1532.068) (-1523.770) [-1522.772] * (-1527.585) (-1522.974) (-1522.779) [-1524.431] -- 0:00:36
      433500 -- [-1523.817] (-1526.510) (-1523.356) (-1529.528) * (-1525.303) (-1522.399) (-1524.359) [-1523.035] -- 0:00:36
      434000 -- [-1523.690] (-1525.531) (-1523.650) (-1527.755) * (-1524.083) (-1525.531) (-1522.907) [-1528.646] -- 0:00:36
      434500 -- (-1523.652) (-1528.698) [-1522.256] (-1525.144) * (-1523.166) [-1524.133] (-1529.803) (-1522.650) -- 0:00:36
      435000 -- [-1523.804] (-1524.338) (-1522.499) (-1527.051) * (-1524.582) (-1526.012) (-1526.745) [-1525.396] -- 0:00:36

      Average standard deviation of split frequencies: 0.013275

      435500 -- (-1526.791) (-1525.616) [-1523.313] (-1525.656) * (-1525.382) [-1525.937] (-1523.267) (-1523.930) -- 0:00:36
      436000 -- (-1524.578) (-1524.029) (-1523.316) [-1523.972] * (-1525.394) [-1526.712] (-1523.296) (-1525.747) -- 0:00:36
      436500 -- (-1524.239) (-1524.742) [-1522.545] (-1524.165) * (-1525.355) [-1525.909] (-1524.156) (-1526.339) -- 0:00:36
      437000 -- (-1524.325) (-1525.767) [-1523.932] (-1525.587) * (-1523.669) [-1523.830] (-1526.244) (-1523.450) -- 0:00:36
      437500 -- (-1522.382) (-1524.250) [-1523.950] (-1524.032) * (-1524.423) (-1524.000) [-1525.707] (-1524.019) -- 0:00:36
      438000 -- (-1524.503) (-1526.550) (-1524.139) [-1522.492] * (-1524.311) (-1523.887) [-1523.951] (-1524.750) -- 0:00:35
      438500 -- (-1522.602) (-1530.643) [-1525.280] (-1523.435) * (-1523.522) (-1523.043) [-1526.810] (-1524.788) -- 0:00:35
      439000 -- [-1523.042] (-1526.508) (-1526.196) (-1523.302) * (-1523.637) [-1524.042] (-1525.204) (-1525.862) -- 0:00:35
      439500 -- (-1523.054) (-1523.869) [-1524.126] (-1525.517) * (-1524.328) (-1526.141) [-1528.602] (-1528.141) -- 0:00:35
      440000 -- (-1524.500) [-1524.782] (-1525.921) (-1523.386) * (-1525.147) [-1523.575] (-1526.471) (-1523.950) -- 0:00:35

      Average standard deviation of split frequencies: 0.012778

      440500 -- (-1523.525) (-1523.766) [-1530.318] (-1523.037) * [-1525.334] (-1525.652) (-1524.762) (-1524.931) -- 0:00:35
      441000 -- (-1523.738) [-1523.241] (-1529.547) (-1525.757) * [-1524.530] (-1524.756) (-1527.473) (-1522.602) -- 0:00:35
      441500 -- (-1523.353) [-1523.243] (-1529.880) (-1523.645) * (-1523.452) (-1523.360) [-1526.027] (-1525.957) -- 0:00:35
      442000 -- (-1524.062) (-1525.102) (-1531.185) [-1524.421] * [-1523.238] (-1524.024) (-1523.823) (-1527.224) -- 0:00:35
      442500 -- (-1526.319) (-1524.299) (-1525.695) [-1524.664] * (-1523.490) (-1525.909) (-1523.001) [-1526.866] -- 0:00:36
      443000 -- (-1524.359) [-1526.651] (-1525.033) (-1524.606) * [-1522.827] (-1524.366) (-1523.521) (-1528.726) -- 0:00:36
      443500 -- (-1526.452) (-1524.114) (-1525.719) [-1525.013] * (-1524.999) (-1523.798) (-1523.706) [-1525.485] -- 0:00:36
      444000 -- [-1522.728] (-1524.388) (-1525.777) (-1523.722) * [-1525.975] (-1525.556) (-1525.311) (-1524.514) -- 0:00:36
      444500 -- (-1524.928) [-1522.253] (-1524.203) (-1523.034) * [-1524.143] (-1524.406) (-1530.573) (-1525.166) -- 0:00:36
      445000 -- (-1528.009) (-1523.196) [-1524.388] (-1523.542) * (-1527.055) (-1523.622) (-1527.353) [-1523.600] -- 0:00:36

      Average standard deviation of split frequencies: 0.012742

      445500 -- (-1528.459) (-1522.959) [-1526.305] (-1530.081) * (-1525.377) [-1523.894] (-1524.441) (-1525.009) -- 0:00:36
      446000 -- (-1527.457) [-1522.820] (-1527.094) (-1527.633) * (-1523.644) (-1523.802) (-1527.446) [-1525.050] -- 0:00:36
      446500 -- (-1524.127) [-1523.520] (-1524.295) (-1527.489) * [-1523.637] (-1524.152) (-1530.916) (-1526.550) -- 0:00:35
      447000 -- (-1524.352) (-1524.208) [-1524.406] (-1524.357) * (-1523.376) [-1524.799] (-1526.369) (-1524.537) -- 0:00:35
      447500 -- (-1523.812) (-1524.355) (-1523.315) [-1525.226] * (-1523.488) (-1525.982) [-1522.717] (-1522.996) -- 0:00:35
      448000 -- (-1529.838) (-1524.040) [-1523.423] (-1523.972) * (-1526.749) (-1525.290) [-1522.543] (-1527.611) -- 0:00:35
      448500 -- (-1524.626) (-1522.874) [-1523.587] (-1526.378) * [-1523.730] (-1526.495) (-1524.544) (-1524.497) -- 0:00:35
      449000 -- [-1525.046] (-1524.525) (-1524.888) (-1526.527) * (-1522.992) [-1525.973] (-1523.938) (-1527.291) -- 0:00:35
      449500 -- (-1525.811) (-1525.322) [-1525.445] (-1523.866) * (-1523.024) [-1524.366] (-1524.461) (-1530.419) -- 0:00:35
      450000 -- [-1523.889] (-1523.810) (-1523.757) (-1528.234) * (-1525.935) [-1527.251] (-1530.782) (-1526.873) -- 0:00:35

      Average standard deviation of split frequencies: 0.011622

      450500 -- (-1523.826) (-1524.281) [-1523.953] (-1525.914) * (-1524.341) [-1524.499] (-1530.221) (-1523.422) -- 0:00:35
      451000 -- (-1522.996) [-1527.257] (-1525.100) (-1525.210) * [-1523.847] (-1523.446) (-1528.802) (-1523.496) -- 0:00:35
      451500 -- (-1523.245) (-1526.707) [-1523.165] (-1529.082) * [-1529.002] (-1526.783) (-1522.870) (-1523.914) -- 0:00:35
      452000 -- [-1526.421] (-1524.890) (-1524.123) (-1527.669) * (-1526.924) (-1527.629) [-1523.828] (-1526.022) -- 0:00:35
      452500 -- [-1524.724] (-1526.048) (-1522.484) (-1526.032) * (-1523.585) (-1525.501) (-1526.699) [-1523.365] -- 0:00:35
      453000 -- [-1524.000] (-1523.154) (-1522.785) (-1523.019) * (-1523.251) (-1525.613) (-1524.508) [-1522.720] -- 0:00:35
      453500 -- (-1526.549) [-1525.541] (-1522.858) (-1523.670) * (-1523.760) [-1525.192] (-1527.812) (-1526.044) -- 0:00:34
      454000 -- [-1522.866] (-1524.816) (-1530.988) (-1523.994) * [-1526.392] (-1526.704) (-1528.792) (-1523.980) -- 0:00:34
      454500 -- (-1524.307) [-1524.436] (-1524.162) (-1523.826) * (-1523.483) (-1527.949) [-1527.409] (-1523.761) -- 0:00:34
      455000 -- (-1522.808) (-1525.359) (-1525.532) [-1525.023] * (-1523.178) (-1525.955) [-1524.862] (-1525.345) -- 0:00:34

      Average standard deviation of split frequencies: 0.011486

      455500 -- (-1526.092) (-1524.098) [-1523.169] (-1524.555) * (-1524.377) (-1526.662) [-1524.743] (-1523.158) -- 0:00:34
      456000 -- (-1525.266) (-1523.659) [-1524.447] (-1529.095) * (-1526.073) (-1526.740) [-1524.909] (-1523.108) -- 0:00:34
      456500 -- (-1524.886) (-1524.238) [-1524.549] (-1525.164) * (-1524.880) (-1525.817) [-1523.872] (-1526.269) -- 0:00:34
      457000 -- (-1524.720) (-1526.183) (-1526.822) [-1525.095] * (-1524.712) [-1522.985] (-1525.644) (-1526.370) -- 0:00:34
      457500 -- (-1524.137) (-1523.235) [-1525.262] (-1523.539) * [-1523.613] (-1524.499) (-1523.757) (-1525.100) -- 0:00:34
      458000 -- (-1526.497) (-1522.664) (-1523.467) [-1523.617] * (-1522.928) (-1523.512) [-1523.420] (-1525.214) -- 0:00:35
      458500 -- (-1524.828) (-1526.699) (-1523.663) [-1524.618] * (-1523.612) [-1523.163] (-1529.861) (-1528.813) -- 0:00:35
      459000 -- (-1523.306) (-1532.014) (-1524.462) [-1523.677] * (-1524.344) (-1526.559) [-1524.412] (-1524.878) -- 0:00:35
      459500 -- (-1523.641) (-1527.354) (-1524.880) [-1524.426] * (-1523.594) (-1526.307) (-1524.959) [-1523.247] -- 0:00:35
      460000 -- (-1522.904) [-1523.605] (-1522.711) (-1524.463) * (-1524.961) (-1529.044) (-1525.376) [-1522.356] -- 0:00:35

      Average standard deviation of split frequencies: 0.011768

      460500 -- (-1525.841) (-1524.324) (-1523.779) [-1523.172] * (-1527.034) [-1523.991] (-1528.140) (-1522.582) -- 0:00:35
      461000 -- (-1523.105) (-1526.181) (-1522.576) [-1524.601] * (-1524.018) (-1523.178) [-1523.059] (-1526.597) -- 0:00:35
      461500 -- (-1523.166) (-1522.475) (-1523.290) [-1523.342] * (-1526.015) (-1523.204) (-1523.166) [-1522.984] -- 0:00:35
      462000 -- (-1526.512) [-1523.476] (-1524.728) (-1524.336) * (-1523.561) (-1523.124) (-1523.478) [-1523.173] -- 0:00:34
      462500 -- (-1525.473) [-1525.163] (-1523.922) (-1523.456) * (-1524.168) (-1524.331) (-1525.171) [-1524.932] -- 0:00:34
      463000 -- (-1525.660) [-1522.535] (-1523.789) (-1522.533) * (-1528.311) (-1522.929) (-1524.233) [-1527.479] -- 0:00:34
      463500 -- [-1527.057] (-1526.376) (-1527.862) (-1525.795) * [-1527.349] (-1522.730) (-1524.258) (-1523.603) -- 0:00:34
      464000 -- (-1527.202) (-1527.967) [-1525.427] (-1529.729) * [-1522.267] (-1522.704) (-1524.436) (-1524.647) -- 0:00:34
      464500 -- (-1526.176) (-1525.034) [-1526.153] (-1529.501) * (-1522.492) (-1524.620) [-1523.066] (-1523.684) -- 0:00:34
      465000 -- (-1522.803) [-1526.577] (-1526.294) (-1524.389) * (-1523.131) [-1523.058] (-1525.156) (-1524.477) -- 0:00:34

      Average standard deviation of split frequencies: 0.011914

      465500 -- (-1525.400) (-1526.514) (-1526.275) [-1523.268] * (-1523.617) [-1523.325] (-1525.039) (-1527.014) -- 0:00:34
      466000 -- [-1528.345] (-1524.416) (-1523.916) (-1523.180) * (-1524.351) (-1523.722) (-1526.791) [-1524.343] -- 0:00:34
      466500 -- (-1528.621) (-1524.206) (-1524.968) [-1528.766] * (-1522.882) [-1524.270] (-1526.922) (-1523.615) -- 0:00:34
      467000 -- [-1524.899] (-1525.747) (-1523.592) (-1526.782) * (-1525.457) [-1523.936] (-1528.188) (-1526.515) -- 0:00:34
      467500 -- (-1530.048) (-1525.069) [-1523.905] (-1523.533) * [-1525.052] (-1522.925) (-1524.414) (-1524.455) -- 0:00:34
      468000 -- (-1526.063) [-1523.984] (-1530.487) (-1522.442) * [-1525.154] (-1522.032) (-1524.173) (-1523.871) -- 0:00:34
      468500 -- (-1524.810) [-1524.029] (-1526.560) (-1523.813) * (-1526.677) (-1523.982) [-1524.740] (-1526.388) -- 0:00:34
      469000 -- (-1523.853) (-1525.099) [-1524.158] (-1527.443) * (-1526.081) (-1523.910) (-1526.311) [-1523.095] -- 0:00:33
      469500 -- (-1523.687) [-1526.114] (-1523.675) (-1529.909) * [-1526.395] (-1525.810) (-1524.528) (-1526.842) -- 0:00:33
      470000 -- [-1524.376] (-1526.896) (-1524.363) (-1526.337) * (-1527.114) (-1523.737) (-1523.805) [-1524.076] -- 0:00:33

      Average standard deviation of split frequencies: 0.011963

      470500 -- [-1524.123] (-1528.765) (-1524.759) (-1527.400) * (-1526.579) (-1526.009) (-1526.256) [-1523.665] -- 0:00:33
      471000 -- (-1523.925) (-1526.501) [-1527.601] (-1526.746) * [-1526.589] (-1524.046) (-1523.972) (-1523.968) -- 0:00:33
      471500 -- (-1524.020) (-1523.976) [-1522.610] (-1526.305) * (-1523.709) (-1524.045) [-1523.730] (-1522.357) -- 0:00:33
      472000 -- (-1522.999) (-1524.804) (-1522.835) [-1527.864] * (-1523.716) (-1525.734) (-1523.136) [-1522.758] -- 0:00:33
      472500 -- (-1523.472) [-1524.328] (-1523.830) (-1529.205) * [-1523.826] (-1524.379) (-1522.863) (-1522.378) -- 0:00:33
      473000 -- [-1527.310] (-1525.503) (-1525.211) (-1528.413) * (-1527.024) (-1526.537) (-1523.221) [-1522.705] -- 0:00:33
      473500 -- (-1524.483) (-1525.122) (-1528.505) [-1524.092] * [-1524.792] (-1527.494) (-1525.183) (-1523.513) -- 0:00:34
      474000 -- [-1524.999] (-1525.195) (-1526.428) (-1523.690) * (-1524.520) [-1526.392] (-1529.146) (-1526.582) -- 0:00:34
      474500 -- (-1526.485) (-1529.691) [-1527.376] (-1523.878) * (-1524.592) [-1526.707] (-1525.067) (-1524.347) -- 0:00:34
      475000 -- (-1525.699) (-1525.059) [-1524.108] (-1526.048) * (-1522.910) (-1524.093) [-1524.410] (-1527.879) -- 0:00:34

      Average standard deviation of split frequencies: 0.011279

      475500 -- [-1522.295] (-1524.738) (-1523.802) (-1523.708) * [-1524.352] (-1524.670) (-1524.366) (-1527.329) -- 0:00:34
      476000 -- (-1524.054) (-1526.597) (-1525.743) [-1523.193] * (-1524.756) (-1524.669) [-1524.180] (-1528.926) -- 0:00:34
      476500 -- (-1525.499) (-1526.274) [-1524.663] (-1523.862) * [-1525.504] (-1524.583) (-1524.897) (-1529.239) -- 0:00:34
      477000 -- [-1529.024] (-1523.544) (-1523.321) (-1524.451) * (-1524.989) (-1526.918) [-1522.938] (-1524.468) -- 0:00:33
      477500 -- (-1527.656) (-1524.240) (-1522.920) [-1523.578] * (-1523.899) (-1526.585) (-1522.928) [-1526.247] -- 0:00:33
      478000 -- (-1524.836) (-1524.617) [-1524.826] (-1524.188) * (-1523.508) (-1528.337) (-1523.054) [-1523.445] -- 0:00:33
      478500 -- [-1525.750] (-1526.629) (-1523.865) (-1525