>C1
VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
DIIRSRHLRTVTLNDVFLTTS
>C2
VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
DIIRSRHLRTVTLNDVFLTTS
>C3
VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
DIIRSRHLRTVTLNDVFLTTS
>C4
VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
DIIRSRHLRTVTLNDVFLTTS
>C5
VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
DIIRSRHLRTVTLNDVFLTTS
>C6
VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
DIIRSRHLRTVTLNDVFLTTS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=271
C1 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
C2 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
C3 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
C4 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
C5 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
C6 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
**************************************************
C1 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
C2 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
C3 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
C4 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
C5 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
C6 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
**************************************************
C1 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
C2 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
C3 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
C4 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
C5 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
C6 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
**************************************************
C1 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
C2 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
C3 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
C4 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
C5 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
C6 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
**************************************************
C1 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
C2 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
C3 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
C4 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
C5 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
C6 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
**************************************************
C1 DIIRSRHLRTVTLNDVFLTTS
C2 DIIRSRHLRTVTLNDVFLTTS
C3 DIIRSRHLRTVTLNDVFLTTS
C4 DIIRSRHLRTVTLNDVFLTTS
C5 DIIRSRHLRTVTLNDVFLTTS
C6 DIIRSRHLRTVTLNDVFLTTS
*********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8130]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8130]--->[8130]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.499 Mb, Max= 30.827 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
C2 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
C3 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
C4 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
C5 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
C6 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
**************************************************
C1 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
C2 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
C3 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
C4 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
C5 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
C6 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
**************************************************
C1 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
C2 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
C3 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
C4 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
C5 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
C6 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
**************************************************
C1 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
C2 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
C3 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
C4 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
C5 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
C6 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
**************************************************
C1 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
C2 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
C3 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
C4 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
C5 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
C6 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
**************************************************
C1 DIIRSRHLRTVTLNDVFLTTS
C2 DIIRSRHLRTVTLNDVFLTTS
C3 DIIRSRHLRTVTLNDVFLTTS
C4 DIIRSRHLRTVTLNDVFLTTS
C5 DIIRSRHLRTVTLNDVFLTTS
C6 DIIRSRHLRTVTLNDVFLTTS
*********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC
C2 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC
C3 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC
C4 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC
C5 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC
C6 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC
**************************************************
C1 TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA
C2 TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA
C3 TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA
C4 TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA
C5 TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA
C6 TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA
**************************************************
C1 CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC
C2 CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC
C3 CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC
C4 CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC
C5 CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC
C6 CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC
**************************************************
C1 GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG
C2 GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG
C3 GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG
C4 GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG
C5 GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG
C6 GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG
**************************************************
C1 CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA
C2 CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA
C3 CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA
C4 CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA
C5 CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA
C6 CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA
**************************************************
C1 CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT
C2 CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT
C3 CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT
C4 CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT
C5 CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT
C6 CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT
**************************************************
C1 GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA
C2 GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA
C3 GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA
C4 GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA
C5 GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA
C6 GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA
**************************************************
C1 CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC
C2 CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC
C3 CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC
C4 CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC
C5 CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC
C6 CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC
**************************************************
C1 AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG
C2 AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG
C3 AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG
C4 AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG
C5 AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG
C6 AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG
**************************************************
C1 ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA
C2 ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA
C3 ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA
C4 ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA
C5 ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA
C6 ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA
**************************************************
C1 GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA
C2 GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA
C3 GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA
C4 GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA
C5 GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA
C6 GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA
**************************************************
C1 AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT
C2 AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT
C3 AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT
C4 AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT
C5 AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT
C6 AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT
**************************************************
C1 CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA
C2 CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA
C3 CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA
C4 CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA
C5 CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA
C6 CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA
**************************************************
C1 TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA
C2 TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA
C3 TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA
C4 TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA
C5 TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA
C6 TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA
**************************************************
C1 TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC
C2 TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC
C3 TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC
C4 TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC
C5 TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC
C6 TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC
**************************************************
C1 GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT
C2 GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT
C3 GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT
C4 GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT
C5 GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT
C6 GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT
**************************************************
C1 CCTTACAACCTCA
C2 CCTTACAACCTCA
C3 CCTTACAACCTCA
C4 CCTTACAACCTCA
C5 CCTTACAACCTCA
C6 CCTTACAACCTCA
*************
>C1
GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC
TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA
CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC
GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG
CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA
CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT
GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA
CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC
AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG
ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA
GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA
AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT
CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA
TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA
TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC
GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT
CCTTACAACCTCA
>C2
GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC
TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA
CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC
GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG
CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA
CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT
GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA
CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC
AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG
ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA
GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA
AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT
CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA
TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA
TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC
GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT
CCTTACAACCTCA
>C3
GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC
TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA
CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC
GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG
CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA
CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT
GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA
CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC
AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG
ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA
GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA
AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT
CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA
TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA
TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC
GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT
CCTTACAACCTCA
>C4
GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC
TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA
CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC
GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG
CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA
CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT
GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA
CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC
AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG
ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA
GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA
AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT
CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA
TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA
TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC
GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT
CCTTACAACCTCA
>C5
GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC
TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA
CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC
GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG
CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA
CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT
GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA
CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC
AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG
ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA
GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA
AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT
CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA
TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA
TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC
GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT
CCTTACAACCTCA
>C6
GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC
TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA
CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC
GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG
CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA
CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT
GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA
CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC
AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG
ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA
GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA
AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT
CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA
TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA
TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC
GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT
CCTTACAACCTCA
>C1
VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
DIIRSRHLRTVTLNDVFLTTS
>C2
VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
DIIRSRHLRTVTLNDVFLTTS
>C3
VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
DIIRSRHLRTVTLNDVFLTTS
>C4
VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
DIIRSRHLRTVTLNDVFLTTS
>C5
VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
DIIRSRHLRTVTLNDVFLTTS
>C6
VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA
AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF
VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM
TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV
PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI
DIIRSRHLRTVTLNDVFLTTS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 813 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859780
Setting output file names to "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1856861295
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5005490229
Seed = 944052553
Swapseed = 1579859780
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1819.532980 -- -24.965149
Chain 2 -- -1819.532876 -- -24.965149
Chain 3 -- -1819.532980 -- -24.965149
Chain 4 -- -1819.532980 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1819.532980 -- -24.965149
Chain 2 -- -1819.532980 -- -24.965149
Chain 3 -- -1819.532876 -- -24.965149
Chain 4 -- -1819.532980 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1819.533] (-1819.533) (-1819.533) (-1819.533) * [-1819.533] (-1819.533) (-1819.533) (-1819.533)
500 -- [-1129.136] (-1127.362) (-1127.701) (-1135.979) * [-1125.176] (-1137.879) (-1129.305) (-1133.846) -- 0:00:00
1000 -- [-1126.075] (-1137.934) (-1125.654) (-1127.806) * (-1128.454) (-1129.651) [-1120.309] (-1129.123) -- 0:00:00
1500 -- (-1133.688) [-1124.296] (-1125.181) (-1126.860) * (-1133.935) (-1140.483) [-1131.909] (-1130.232) -- 0:00:00
2000 -- (-1125.808) [-1129.543] (-1129.808) (-1126.267) * (-1128.638) (-1131.211) [-1128.209] (-1125.787) -- 0:00:00
2500 -- (-1123.341) (-1130.177) (-1132.891) [-1127.358] * [-1126.195] (-1129.909) (-1128.730) (-1131.170) -- 0:00:00
3000 -- (-1137.727) (-1129.357) (-1129.645) [-1127.957] * [-1123.143] (-1125.783) (-1126.449) (-1122.480) -- 0:00:00
3500 -- (-1124.006) (-1130.333) (-1129.109) [-1127.842] * (-1129.881) (-1132.205) (-1129.478) [-1125.832] -- 0:00:00
4000 -- (-1127.227) (-1133.724) (-1128.814) [-1129.192] * [-1128.781] (-1126.543) (-1130.006) (-1131.653) -- 0:00:00
4500 -- [-1126.394] (-1130.080) (-1128.335) (-1123.294) * (-1128.542) [-1122.971] (-1129.289) (-1134.977) -- 0:00:00
5000 -- (-1123.909) (-1127.740) (-1129.450) [-1120.067] * (-1129.163) (-1128.385) [-1124.197] (-1125.176) -- 0:00:00
Average standard deviation of split frequencies: 0.102138
5500 -- (-1125.123) (-1125.872) [-1126.447] (-1133.193) * (-1127.886) [-1125.261] (-1124.459) (-1131.882) -- 0:00:00
6000 -- [-1128.524] (-1128.693) (-1133.305) (-1127.200) * (-1132.460) (-1133.687) (-1127.918) [-1123.578] -- 0:00:00
6500 -- [-1124.635] (-1123.412) (-1124.618) (-1134.920) * (-1130.918) [-1123.682] (-1124.387) (-1128.499) -- 0:00:00
7000 -- (-1124.125) (-1139.744) [-1126.543] (-1139.417) * (-1131.294) (-1130.191) (-1131.834) [-1121.943] -- 0:00:00
7500 -- (-1125.034) (-1125.890) (-1131.611) [-1121.947] * (-1126.943) [-1123.464] (-1125.656) (-1138.660) -- 0:00:00
8000 -- [-1124.997] (-1124.209) (-1132.398) (-1139.074) * (-1130.949) [-1125.107] (-1128.801) (-1135.000) -- 0:00:00
8500 -- (-1127.961) (-1128.514) [-1127.685] (-1132.168) * (-1126.408) (-1130.780) [-1124.447] (-1129.897) -- 0:00:00
9000 -- [-1126.154] (-1125.992) (-1145.983) (-1123.154) * (-1131.888) [-1131.706] (-1131.995) (-1127.204) -- 0:00:00
9500 -- (-1128.954) (-1127.869) (-1129.673) [-1130.751] * (-1131.926) [-1130.457] (-1130.575) (-1124.886) -- 0:00:00
10000 -- [-1124.831] (-1126.194) (-1138.180) (-1126.340) * (-1123.750) (-1130.813) [-1132.020] (-1129.538) -- 0:00:00
Average standard deviation of split frequencies: 0.088388
10500 -- [-1126.477] (-1123.388) (-1130.591) (-1125.162) * (-1123.891) (-1127.538) (-1131.374) [-1124.131] -- 0:00:00
11000 -- [-1129.572] (-1125.361) (-1126.405) (-1128.293) * [-1123.892] (-1123.351) (-1130.214) (-1128.392) -- 0:00:00
11500 -- (-1131.995) [-1124.675] (-1128.787) (-1130.710) * [-1124.874] (-1126.417) (-1128.479) (-1127.666) -- 0:00:00
12000 -- (-1141.178) [-1125.829] (-1117.658) (-1127.107) * (-1133.959) (-1133.091) (-1133.072) [-1127.071] -- 0:00:00
12500 -- (-1128.559) (-1128.145) (-1118.286) [-1132.672] * (-1127.401) [-1132.983] (-1128.498) (-1126.737) -- 0:00:00
13000 -- (-1132.261) (-1131.674) [-1116.405] (-1130.395) * (-1131.341) (-1138.856) (-1128.613) [-1124.613] -- 0:00:00
13500 -- [-1126.333] (-1125.863) (-1120.806) (-1129.080) * (-1122.504) (-1125.475) (-1126.672) [-1129.854] -- 0:00:00
14000 -- [-1123.686] (-1132.879) (-1119.495) (-1125.893) * (-1126.480) (-1123.249) [-1122.045] (-1138.965) -- 0:00:00
14500 -- (-1123.059) (-1132.336) (-1118.200) [-1128.079] * [-1128.334] (-1133.724) (-1128.800) (-1130.538) -- 0:00:00
15000 -- (-1126.670) (-1124.170) (-1118.599) [-1122.125] * (-1130.344) (-1131.208) (-1131.685) [-1129.840] -- 0:00:00
Average standard deviation of split frequencies: 0.062027
15500 -- (-1128.294) [-1123.296] (-1117.527) (-1130.671) * (-1124.148) (-1124.269) (-1127.232) [-1127.825] -- 0:00:00
16000 -- [-1125.435] (-1133.850) (-1116.717) (-1132.413) * (-1124.860) (-1131.019) [-1124.581] (-1126.217) -- 0:01:01
16500 -- [-1126.847] (-1132.134) (-1119.804) (-1135.077) * (-1130.894) [-1127.842] (-1121.169) (-1127.748) -- 0:00:59
17000 -- [-1126.966] (-1128.076) (-1121.123) (-1127.472) * (-1125.070) [-1123.801] (-1117.487) (-1127.152) -- 0:00:57
17500 -- (-1127.070) [-1120.262] (-1118.686) (-1137.421) * (-1125.573) (-1121.305) (-1118.937) [-1123.513] -- 0:00:56
18000 -- (-1130.059) [-1125.840] (-1116.732) (-1131.837) * [-1126.122] (-1122.130) (-1117.851) (-1128.180) -- 0:00:54
18500 -- (-1126.312) (-1128.380) [-1117.844] (-1128.718) * (-1128.816) [-1119.826] (-1117.740) (-1126.949) -- 0:00:53
19000 -- (-1129.735) [-1122.396] (-1117.163) (-1127.067) * [-1122.049] (-1119.332) (-1118.063) (-1131.412) -- 0:00:51
19500 -- (-1126.129) (-1120.592) (-1119.106) [-1133.243] * (-1131.202) [-1119.990] (-1117.590) (-1127.637) -- 0:00:50
20000 -- (-1129.325) (-1128.032) (-1117.626) [-1126.084] * (-1129.850) (-1120.014) [-1119.477] (-1132.847) -- 0:00:49
Average standard deviation of split frequencies: 0.048303
20500 -- (-1133.664) (-1125.506) [-1116.917] (-1126.247) * (-1123.951) (-1118.384) (-1117.363) [-1126.563] -- 0:00:47
21000 -- (-1135.361) [-1123.009] (-1117.477) (-1125.957) * (-1126.047) (-1119.322) [-1117.194] (-1127.639) -- 0:00:46
21500 -- (-1126.812) (-1128.883) (-1118.504) [-1123.620] * (-1136.198) (-1117.543) (-1117.891) [-1121.935] -- 0:00:45
22000 -- (-1124.965) (-1129.951) (-1117.222) [-1129.725] * (-1137.875) (-1119.980) [-1118.063] (-1126.810) -- 0:00:44
22500 -- (-1130.301) [-1121.409] (-1119.155) (-1125.841) * (-1134.279) (-1122.345) [-1118.196] (-1131.928) -- 0:00:43
23000 -- (-1134.645) [-1130.599] (-1117.665) (-1128.585) * [-1128.899] (-1119.795) (-1120.099) (-1130.334) -- 0:00:42
23500 -- (-1124.139) (-1123.195) (-1117.937) [-1125.339] * (-1137.000) (-1118.125) (-1119.967) [-1130.327] -- 0:00:41
24000 -- [-1127.306] (-1132.532) (-1118.487) (-1123.810) * [-1126.955] (-1118.864) (-1118.153) (-1121.356) -- 0:00:40
24500 -- [-1127.070] (-1130.771) (-1119.580) (-1132.230) * (-1136.377) (-1119.323) [-1117.483] (-1117.487) -- 0:00:39
25000 -- (-1136.575) (-1124.911) [-1117.147] (-1134.620) * (-1128.802) [-1119.145] (-1131.268) (-1117.347) -- 0:00:39
Average standard deviation of split frequencies: 0.043896
25500 -- (-1132.359) (-1126.952) (-1116.858) [-1120.528] * (-1133.434) (-1119.532) [-1121.891] (-1116.526) -- 0:00:38
26000 -- (-1128.843) [-1131.186] (-1120.460) (-1132.179) * (-1127.882) [-1118.937] (-1118.238) (-1117.998) -- 0:00:37
26500 -- (-1125.131) (-1130.132) [-1117.164] (-1128.847) * (-1122.189) [-1117.351] (-1120.277) (-1118.578) -- 0:00:36
27000 -- (-1133.966) (-1126.670) (-1119.938) [-1129.598] * [-1123.116] (-1119.402) (-1119.426) (-1117.558) -- 0:00:36
27500 -- (-1132.623) [-1126.748] (-1118.291) (-1123.317) * (-1121.904) [-1119.804] (-1121.466) (-1118.044) -- 0:00:35
28000 -- (-1128.866) [-1126.347] (-1117.760) (-1120.424) * [-1136.291] (-1120.613) (-1118.479) (-1117.978) -- 0:00:34
28500 -- (-1127.410) [-1121.153] (-1117.592) (-1136.453) * (-1123.868) (-1120.862) (-1117.667) [-1117.088] -- 0:00:34
29000 -- [-1122.035] (-1131.236) (-1119.405) (-1125.281) * (-1129.011) (-1120.662) (-1117.294) [-1117.109] -- 0:00:33
29500 -- (-1131.955) (-1130.058) [-1119.967] (-1123.526) * (-1133.136) (-1121.162) (-1119.042) [-1118.194] -- 0:00:32
30000 -- (-1126.584) (-1123.431) [-1119.433] (-1135.075) * (-1129.729) (-1119.304) [-1120.058] (-1119.830) -- 0:00:32
Average standard deviation of split frequencies: 0.047734
30500 -- (-1130.537) (-1131.281) (-1125.961) [-1125.346] * [-1127.288] (-1119.005) (-1121.748) (-1118.272) -- 0:00:31
31000 -- (-1126.527) [-1124.737] (-1121.615) (-1132.970) * [-1126.755] (-1123.357) (-1124.494) (-1117.116) -- 0:00:31
31500 -- (-1124.995) (-1124.599) [-1119.834] (-1134.785) * [-1127.279] (-1119.747) (-1124.755) (-1117.221) -- 0:00:30
32000 -- (-1127.591) (-1121.702) [-1116.945] (-1127.278) * [-1125.465] (-1116.556) (-1121.886) (-1116.632) -- 0:00:30
32500 -- (-1130.700) (-1125.459) [-1117.453] (-1127.446) * (-1131.470) (-1123.053) [-1119.653] (-1117.981) -- 0:00:59
33000 -- [-1128.062] (-1126.053) (-1120.460) (-1134.633) * (-1133.572) [-1118.586] (-1121.165) (-1118.258) -- 0:00:58
33500 -- (-1128.711) (-1120.974) (-1118.690) [-1129.876] * (-1129.440) [-1117.764] (-1124.399) (-1121.326) -- 0:00:57
34000 -- (-1127.876) (-1134.027) (-1116.491) [-1126.609] * (-1131.621) (-1117.415) (-1117.413) [-1122.980] -- 0:00:56
34500 -- [-1126.573] (-1128.996) (-1118.683) (-1134.033) * [-1129.443] (-1117.324) (-1116.596) (-1121.970) -- 0:00:55
35000 -- (-1140.415) (-1129.880) [-1116.322] (-1127.065) * [-1124.522] (-1120.033) (-1117.245) (-1119.691) -- 0:00:55
Average standard deviation of split frequencies: 0.047286
35500 -- [-1122.550] (-1132.235) (-1116.458) (-1125.847) * [-1122.026] (-1118.592) (-1117.654) (-1117.882) -- 0:00:54
36000 -- (-1126.719) (-1123.875) (-1116.901) [-1126.692] * (-1131.868) (-1116.428) [-1116.550] (-1118.477) -- 0:00:53
36500 -- [-1127.034] (-1132.106) (-1117.953) (-1123.989) * [-1127.155] (-1116.438) (-1119.620) (-1118.957) -- 0:00:52
37000 -- [-1120.543] (-1131.527) (-1117.177) (-1129.852) * (-1131.810) [-1116.931] (-1116.654) (-1117.754) -- 0:00:52
37500 -- (-1129.183) (-1137.316) [-1117.739] (-1133.356) * (-1132.190) [-1117.484] (-1119.805) (-1117.936) -- 0:00:51
38000 -- (-1128.535) [-1125.471] (-1119.481) (-1131.877) * (-1126.256) (-1117.511) (-1117.002) [-1123.520] -- 0:00:50
38500 -- (-1124.456) (-1135.440) [-1117.957] (-1128.851) * (-1127.198) [-1116.664] (-1117.687) (-1121.950) -- 0:00:49
39000 -- (-1126.962) (-1123.927) [-1118.784] (-1118.428) * (-1130.691) (-1124.812) [-1116.814] (-1121.141) -- 0:00:49
39500 -- [-1123.914] (-1125.345) (-1118.423) (-1118.510) * (-1130.819) (-1119.012) [-1117.659] (-1121.471) -- 0:00:48
40000 -- (-1130.980) [-1126.067] (-1121.119) (-1120.629) * (-1127.315) [-1117.167] (-1119.505) (-1121.896) -- 0:00:48
Average standard deviation of split frequencies: 0.043148
40500 -- (-1125.124) [-1125.648] (-1120.159) (-1118.315) * [-1128.982] (-1117.172) (-1120.860) (-1121.566) -- 0:00:47
41000 -- (-1127.643) (-1132.495) (-1121.793) [-1116.208] * (-1133.322) (-1117.407) [-1118.104] (-1118.329) -- 0:00:46
41500 -- (-1130.411) [-1125.413] (-1117.027) (-1116.379) * (-1130.067) (-1119.057) (-1117.647) [-1116.614] -- 0:00:46
42000 -- [-1119.917] (-1128.272) (-1116.684) (-1117.392) * (-1131.905) (-1120.216) [-1117.879] (-1119.406) -- 0:00:45
42500 -- (-1124.575) [-1127.847] (-1116.935) (-1117.761) * (-1132.816) (-1122.463) (-1116.518) [-1119.808] -- 0:00:45
43000 -- [-1129.053] (-1134.566) (-1118.256) (-1116.729) * (-1127.888) (-1118.181) [-1118.788] (-1125.091) -- 0:00:44
43500 -- (-1126.022) (-1131.437) [-1122.282] (-1117.192) * (-1129.761) [-1116.873] (-1117.662) (-1125.404) -- 0:00:43
44000 -- [-1125.432] (-1128.695) (-1116.762) (-1117.482) * (-1134.019) [-1117.431] (-1118.301) (-1123.861) -- 0:00:43
44500 -- (-1126.988) [-1124.947] (-1118.265) (-1119.656) * (-1131.233) [-1116.680] (-1121.167) (-1117.809) -- 0:00:42
45000 -- (-1127.821) [-1125.289] (-1117.479) (-1118.507) * [-1126.313] (-1117.729) (-1116.530) (-1120.959) -- 0:00:42
Average standard deviation of split frequencies: 0.032696
45500 -- [-1127.957] (-1124.428) (-1121.717) (-1117.211) * [-1121.826] (-1117.478) (-1118.390) (-1116.385) -- 0:00:41
46000 -- (-1136.930) (-1127.147) (-1120.507) [-1119.192] * (-1127.853) [-1118.143] (-1118.129) (-1119.748) -- 0:00:41
46500 -- (-1127.765) [-1118.041] (-1126.234) (-1118.422) * (-1131.633) (-1117.613) [-1116.875] (-1116.682) -- 0:00:41
47000 -- (-1129.703) [-1117.514] (-1122.197) (-1118.099) * (-1129.486) (-1117.788) [-1117.071] (-1117.537) -- 0:00:40
47500 -- (-1126.876) (-1120.002) [-1119.443] (-1118.303) * (-1126.906) [-1117.788] (-1117.536) (-1116.520) -- 0:00:40
48000 -- (-1133.408) [-1117.345] (-1119.360) (-1119.795) * (-1141.612) (-1118.529) [-1119.441] (-1116.879) -- 0:00:39
48500 -- (-1127.672) [-1117.632] (-1117.314) (-1119.151) * (-1128.442) [-1117.944] (-1117.266) (-1116.729) -- 0:00:39
49000 -- [-1124.021] (-1118.690) (-1120.689) (-1117.291) * (-1136.939) (-1118.899) (-1119.477) [-1117.458] -- 0:00:58
49500 -- (-1134.038) [-1117.260] (-1121.894) (-1116.747) * [-1121.090] (-1119.683) (-1117.782) (-1119.734) -- 0:00:57
50000 -- (-1135.405) [-1120.085] (-1119.695) (-1119.019) * (-1117.527) (-1117.017) [-1117.480] (-1121.772) -- 0:00:57
Average standard deviation of split frequencies: 0.026982
50500 -- [-1125.111] (-1123.031) (-1119.966) (-1117.480) * [-1118.869] (-1119.069) (-1116.489) (-1121.177) -- 0:00:56
51000 -- (-1125.787) (-1121.522) [-1119.528] (-1118.587) * (-1120.174) (-1116.783) [-1119.000] (-1120.416) -- 0:00:55
51500 -- (-1125.152) (-1117.815) (-1121.725) [-1116.830] * (-1119.691) [-1116.598] (-1118.296) (-1121.517) -- 0:00:55
52000 -- (-1123.110) (-1119.043) (-1117.347) [-1116.442] * (-1119.143) [-1117.188] (-1118.986) (-1121.436) -- 0:00:54
52500 -- [-1133.346] (-1117.398) (-1118.784) (-1116.797) * (-1119.450) [-1116.546] (-1118.359) (-1121.019) -- 0:00:54
53000 -- (-1131.295) (-1117.443) (-1121.395) [-1116.798] * (-1121.575) [-1117.794] (-1118.534) (-1120.619) -- 0:00:53
53500 -- (-1138.351) [-1117.461] (-1117.672) (-1118.452) * (-1118.179) (-1118.861) (-1117.207) [-1117.576] -- 0:00:53
54000 -- [-1129.423] (-1118.522) (-1120.863) (-1120.188) * (-1119.159) (-1118.391) [-1120.120] (-1119.870) -- 0:00:52
54500 -- (-1136.480) (-1121.135) [-1121.110] (-1117.143) * (-1118.391) [-1117.176] (-1118.364) (-1121.048) -- 0:00:52
55000 -- (-1123.181) [-1120.500] (-1120.136) (-1117.515) * (-1117.480) (-1117.544) (-1118.845) [-1118.076] -- 0:00:51
Average standard deviation of split frequencies: 0.034115
55500 -- (-1123.220) (-1119.745) [-1119.067] (-1118.467) * (-1119.718) (-1118.743) [-1117.481] (-1117.032) -- 0:00:51
56000 -- (-1122.786) (-1118.454) [-1117.217] (-1118.506) * (-1123.702) (-1121.786) [-1117.612] (-1118.097) -- 0:00:50
56500 -- (-1117.993) [-1118.299] (-1119.910) (-1119.795) * (-1121.068) [-1118.475] (-1120.840) (-1118.682) -- 0:00:50
57000 -- (-1118.541) [-1117.777] (-1118.694) (-1120.066) * (-1121.117) (-1116.999) (-1117.758) [-1117.123] -- 0:00:49
57500 -- (-1123.768) [-1117.987] (-1119.525) (-1117.407) * (-1121.821) (-1119.953) [-1117.760] (-1118.123) -- 0:00:49
58000 -- (-1120.591) (-1117.390) [-1117.549] (-1117.808) * (-1118.018) (-1118.922) [-1116.140] (-1118.542) -- 0:00:48
58500 -- (-1117.488) (-1121.625) (-1119.097) [-1116.760] * (-1121.328) (-1117.164) (-1116.140) [-1117.584] -- 0:00:48
59000 -- [-1116.345] (-1118.202) (-1119.171) (-1117.065) * (-1122.996) (-1119.340) [-1117.777] (-1122.186) -- 0:00:47
59500 -- (-1116.278) (-1116.776) (-1125.338) [-1118.889] * (-1123.128) [-1116.941] (-1118.639) (-1119.927) -- 0:00:47
60000 -- (-1118.239) (-1118.770) (-1118.066) [-1117.235] * (-1122.818) (-1117.973) (-1116.904) [-1117.012] -- 0:00:47
Average standard deviation of split frequencies: 0.026333
60500 -- (-1116.657) [-1118.443] (-1117.428) (-1119.849) * (-1117.489) [-1119.785] (-1116.821) (-1119.174) -- 0:00:46
61000 -- (-1117.952) (-1117.535) [-1119.157] (-1117.876) * (-1117.091) [-1119.198] (-1116.134) (-1117.928) -- 0:00:46
61500 -- (-1118.283) (-1117.397) (-1118.217) [-1119.932] * (-1117.003) (-1116.684) [-1117.747] (-1118.129) -- 0:00:45
62000 -- (-1120.384) (-1118.243) [-1117.434] (-1118.855) * [-1117.997] (-1117.123) (-1117.234) (-1116.292) -- 0:00:45
62500 -- (-1120.433) (-1117.828) [-1117.648] (-1117.009) * [-1118.802] (-1118.453) (-1121.030) (-1116.509) -- 0:00:45
63000 -- (-1118.893) (-1123.225) [-1119.611] (-1118.238) * (-1119.777) (-1118.928) (-1117.584) [-1116.504] -- 0:00:44
63500 -- [-1120.660] (-1117.034) (-1118.338) (-1117.065) * (-1117.217) [-1118.719] (-1117.820) (-1116.934) -- 0:00:44
64000 -- (-1119.864) (-1119.878) [-1123.549] (-1116.763) * (-1117.657) (-1120.876) [-1117.345] (-1117.433) -- 0:00:58
64500 -- [-1118.825] (-1117.723) (-1118.926) (-1119.325) * (-1116.928) (-1117.708) [-1117.875] (-1117.657) -- 0:00:58
65000 -- [-1118.024] (-1118.390) (-1118.731) (-1119.585) * [-1116.372] (-1118.677) (-1116.973) (-1118.787) -- 0:00:57
Average standard deviation of split frequencies: 0.023683
65500 -- (-1117.614) (-1117.525) [-1118.363] (-1116.791) * (-1118.150) [-1120.607] (-1116.270) (-1117.263) -- 0:00:57
66000 -- (-1120.994) (-1117.919) (-1119.851) [-1118.145] * [-1117.589] (-1122.022) (-1116.895) (-1119.224) -- 0:00:56
66500 -- (-1117.538) [-1117.139] (-1118.760) (-1120.611) * [-1117.897] (-1118.637) (-1117.184) (-1120.173) -- 0:00:56
67000 -- (-1118.611) (-1122.943) (-1120.341) [-1120.154] * (-1116.649) [-1120.648] (-1117.275) (-1119.751) -- 0:00:55
67500 -- (-1117.485) (-1119.062) [-1119.174] (-1119.194) * (-1120.472) (-1119.101) (-1117.919) [-1118.127] -- 0:00:55
68000 -- (-1123.271) [-1119.601] (-1120.649) (-1117.740) * (-1119.353) (-1119.159) (-1117.530) [-1119.057] -- 0:00:54
68500 -- (-1121.899) [-1116.886] (-1121.654) (-1117.505) * (-1117.521) (-1118.005) [-1116.270] (-1118.119) -- 0:00:54
69000 -- [-1117.499] (-1118.483) (-1118.494) (-1116.815) * (-1117.716) (-1119.849) (-1116.647) [-1119.494] -- 0:00:53
69500 -- (-1122.148) [-1118.651] (-1125.092) (-1118.793) * (-1121.038) (-1121.198) [-1116.807] (-1119.221) -- 0:00:53
70000 -- (-1120.254) [-1117.002] (-1118.004) (-1119.858) * (-1121.645) [-1125.134] (-1119.203) (-1120.003) -- 0:00:53
Average standard deviation of split frequencies: 0.021347
70500 -- (-1118.062) (-1118.029) (-1119.706) [-1119.555] * (-1121.825) (-1118.555) (-1117.796) [-1119.577] -- 0:00:52
71000 -- (-1119.982) [-1117.425] (-1120.199) (-1116.730) * (-1116.917) (-1119.617) (-1119.121) [-1117.153] -- 0:00:52
71500 -- (-1119.115) [-1117.353] (-1120.543) (-1116.869) * (-1122.031) (-1119.991) (-1119.593) [-1118.163] -- 0:00:51
72000 -- (-1117.960) (-1117.951) (-1118.386) [-1117.674] * (-1122.842) (-1122.305) (-1117.803) [-1118.077] -- 0:00:51
72500 -- (-1118.888) [-1117.476] (-1117.921) (-1118.438) * (-1119.559) (-1122.454) [-1117.778] (-1118.998) -- 0:00:51
73000 -- [-1116.866] (-1117.202) (-1118.714) (-1118.313) * (-1122.023) (-1118.517) [-1117.243] (-1119.534) -- 0:00:50
73500 -- (-1116.466) (-1116.947) [-1117.410] (-1118.735) * (-1122.765) [-1119.503] (-1118.118) (-1125.269) -- 0:00:50
74000 -- (-1116.849) [-1117.043] (-1117.371) (-1117.517) * [-1117.764] (-1119.417) (-1117.951) (-1121.204) -- 0:00:50
74500 -- [-1117.716] (-1117.799) (-1118.622) (-1120.847) * [-1116.995] (-1119.936) (-1121.416) (-1121.857) -- 0:00:49
75000 -- (-1120.615) (-1119.019) (-1118.387) [-1118.684] * (-1116.728) (-1120.770) [-1117.868] (-1121.628) -- 0:00:49
Average standard deviation of split frequencies: 0.019538
75500 -- (-1121.411) (-1120.160) (-1119.118) [-1117.908] * (-1120.793) (-1117.115) (-1117.444) [-1120.924] -- 0:00:48
76000 -- (-1120.304) (-1118.541) [-1117.400] (-1117.347) * (-1117.886) (-1117.488) [-1119.315] (-1117.281) -- 0:00:48
76500 -- (-1118.957) [-1118.938] (-1116.665) (-1117.309) * [-1118.719] (-1117.617) (-1119.367) (-1117.308) -- 0:00:48
77000 -- (-1118.181) [-1117.661] (-1116.570) (-1118.471) * (-1118.801) (-1117.851) (-1119.399) [-1118.845] -- 0:00:47
77500 -- (-1122.589) (-1117.946) [-1117.719] (-1119.262) * (-1118.331) [-1116.355] (-1118.271) (-1121.439) -- 0:00:47
78000 -- [-1118.157] (-1118.476) (-1121.834) (-1118.063) * [-1118.644] (-1117.952) (-1116.852) (-1120.416) -- 0:00:47
78500 -- (-1121.937) [-1116.670] (-1122.040) (-1117.698) * (-1119.197) [-1119.823] (-1119.083) (-1121.154) -- 0:00:46
79000 -- (-1120.559) [-1116.951] (-1118.210) (-1119.238) * [-1118.098] (-1119.901) (-1116.950) (-1121.217) -- 0:00:46
79500 -- (-1120.193) [-1116.922] (-1117.972) (-1116.947) * [-1117.920] (-1119.512) (-1119.184) (-1119.764) -- 0:00:57
80000 -- (-1120.375) (-1117.743) (-1122.986) [-1117.000] * [-1118.891] (-1119.531) (-1116.689) (-1119.098) -- 0:00:57
Average standard deviation of split frequencies: 0.017856
80500 -- (-1120.475) (-1116.809) [-1116.979] (-1118.756) * (-1118.513) (-1117.946) [-1117.367] (-1119.444) -- 0:00:57
81000 -- (-1119.426) [-1116.845] (-1116.435) (-1120.628) * [-1117.320] (-1118.544) (-1121.742) (-1119.176) -- 0:00:56
81500 -- (-1118.738) [-1117.188] (-1117.331) (-1118.397) * (-1119.940) [-1117.939] (-1121.351) (-1119.226) -- 0:00:56
82000 -- [-1117.918] (-1117.253) (-1116.688) (-1118.148) * (-1119.028) (-1117.402) [-1119.847] (-1119.866) -- 0:00:55
82500 -- (-1118.938) [-1116.459] (-1118.642) (-1116.553) * [-1118.307] (-1117.406) (-1118.476) (-1120.003) -- 0:00:55
83000 -- [-1118.798] (-1116.978) (-1117.799) (-1118.228) * [-1118.366] (-1118.931) (-1119.908) (-1118.109) -- 0:00:55
83500 -- (-1118.453) (-1116.947) [-1118.912] (-1118.398) * (-1123.488) (-1117.512) [-1116.852] (-1120.231) -- 0:00:54
84000 -- [-1120.310] (-1118.449) (-1118.060) (-1124.736) * (-1118.296) (-1120.113) [-1117.633] (-1118.474) -- 0:00:54
84500 -- (-1120.857) (-1121.054) [-1117.861] (-1118.952) * (-1118.267) (-1117.774) (-1118.477) [-1117.973] -- 0:00:54
85000 -- (-1118.188) (-1117.386) [-1116.815] (-1117.380) * (-1119.197) [-1120.122] (-1117.888) (-1118.958) -- 0:00:53
Average standard deviation of split frequencies: 0.018363
85500 -- (-1116.863) [-1117.429] (-1118.520) (-1119.686) * [-1118.835] (-1117.707) (-1117.966) (-1118.255) -- 0:00:53
86000 -- (-1119.781) (-1118.127) [-1118.802] (-1120.190) * (-1122.221) [-1124.019] (-1120.141) (-1119.477) -- 0:00:53
86500 -- (-1118.941) (-1120.547) (-1117.936) [-1116.571] * [-1117.674] (-1124.104) (-1117.140) (-1117.358) -- 0:00:52
87000 -- [-1117.520] (-1123.767) (-1118.601) (-1116.574) * (-1117.438) (-1118.597) (-1118.765) [-1118.979] -- 0:00:52
87500 -- (-1119.465) (-1123.703) [-1119.836] (-1120.361) * (-1118.614) [-1119.525] (-1119.877) (-1124.389) -- 0:00:52
88000 -- (-1121.388) (-1118.670) (-1117.817) [-1119.861] * (-1118.875) [-1119.142] (-1118.415) (-1118.983) -- 0:00:51
88500 -- (-1122.239) [-1117.466] (-1116.894) (-1117.907) * [-1116.369] (-1117.410) (-1120.961) (-1122.632) -- 0:00:51
89000 -- [-1122.216] (-1116.340) (-1117.567) (-1117.210) * (-1119.182) (-1117.231) (-1118.234) [-1119.117] -- 0:00:51
89500 -- [-1120.282] (-1116.296) (-1117.955) (-1117.932) * [-1120.570] (-1118.045) (-1118.460) (-1116.774) -- 0:00:50
90000 -- (-1120.329) [-1116.102] (-1117.112) (-1116.940) * (-1121.379) (-1120.312) (-1120.627) [-1116.632] -- 0:00:50
Average standard deviation of split frequencies: 0.016145
90500 -- (-1123.651) [-1117.066] (-1116.367) (-1121.522) * (-1118.272) (-1119.088) (-1121.048) [-1117.417] -- 0:00:50
91000 -- (-1120.234) [-1118.177] (-1116.705) (-1117.610) * (-1120.400) (-1119.073) (-1117.464) [-1117.262] -- 0:00:49
91500 -- (-1119.783) (-1120.640) (-1116.646) [-1118.033] * [-1120.448] (-1117.402) (-1119.207) (-1117.907) -- 0:00:49
92000 -- (-1117.291) (-1119.733) [-1116.849] (-1118.116) * (-1121.166) (-1119.532) [-1118.556] (-1118.004) -- 0:00:49
92500 -- [-1118.312] (-1117.709) (-1118.200) (-1122.866) * [-1120.000] (-1117.187) (-1123.361) (-1118.407) -- 0:00:49
93000 -- (-1119.763) (-1119.586) (-1118.857) [-1120.937] * (-1117.880) (-1118.240) (-1118.244) [-1117.617] -- 0:00:48
93500 -- (-1118.279) (-1119.032) (-1117.437) [-1118.154] * (-1118.971) (-1118.542) [-1118.878] (-1117.939) -- 0:00:48
94000 -- [-1118.306] (-1121.272) (-1119.075) (-1119.741) * (-1117.418) (-1119.837) [-1119.462] (-1118.349) -- 0:00:48
94500 -- [-1119.698] (-1117.102) (-1118.647) (-1117.459) * (-1117.397) [-1120.593] (-1121.366) (-1119.702) -- 0:00:47
95000 -- [-1125.939] (-1117.110) (-1116.814) (-1119.078) * (-1116.833) (-1121.329) [-1121.726] (-1119.418) -- 0:00:47
Average standard deviation of split frequencies: 0.017732
95500 -- (-1122.452) (-1117.080) (-1118.084) [-1119.779] * (-1118.721) (-1117.790) [-1121.497] (-1120.446) -- 0:00:56
96000 -- (-1123.346) [-1118.318] (-1117.317) (-1118.500) * (-1123.991) (-1118.743) (-1118.642) [-1124.236] -- 0:00:56
96500 -- (-1122.582) (-1120.799) (-1120.821) [-1121.524] * [-1118.858] (-1118.735) (-1117.537) (-1122.376) -- 0:00:56
97000 -- (-1119.732) (-1117.718) (-1120.180) [-1121.531] * (-1121.543) (-1119.152) [-1120.205] (-1119.766) -- 0:00:55
97500 -- (-1117.523) (-1117.915) (-1117.293) [-1118.482] * (-1119.694) (-1119.187) (-1118.421) [-1117.548] -- 0:00:55
98000 -- (-1121.505) (-1116.739) [-1118.848] (-1119.758) * (-1118.154) (-1119.713) (-1117.878) [-1120.244] -- 0:00:55
98500 -- (-1121.532) (-1116.759) (-1118.492) [-1121.671] * (-1121.693) [-1117.060] (-1118.336) (-1117.386) -- 0:00:54
99000 -- (-1117.847) (-1118.311) (-1120.879) [-1120.771] * (-1116.688) (-1120.199) [-1119.599] (-1120.902) -- 0:00:54
99500 -- [-1116.979] (-1117.308) (-1117.401) (-1123.587) * (-1117.646) [-1117.461] (-1124.441) (-1121.980) -- 0:00:54
100000 -- (-1116.958) [-1116.729] (-1122.813) (-1117.710) * (-1120.609) (-1117.013) [-1117.664] (-1124.579) -- 0:00:54
Average standard deviation of split frequencies: 0.017431
100500 -- (-1116.400) (-1117.484) (-1116.771) [-1117.043] * [-1118.492] (-1117.671) (-1117.480) (-1121.294) -- 0:00:53
101000 -- (-1118.914) [-1117.811] (-1120.158) (-1118.198) * (-1120.586) [-1117.920] (-1117.058) (-1119.992) -- 0:00:53
101500 -- (-1118.310) [-1117.897] (-1120.752) (-1118.725) * (-1118.632) (-1119.831) [-1120.543] (-1117.217) -- 0:00:53
102000 -- [-1119.113] (-1118.450) (-1118.176) (-1120.532) * (-1118.581) [-1118.442] (-1120.623) (-1120.439) -- 0:00:52
102500 -- (-1120.452) (-1118.637) (-1119.133) [-1118.495] * (-1118.781) (-1119.250) [-1119.556] (-1122.115) -- 0:00:52
103000 -- [-1116.818] (-1117.617) (-1117.107) (-1121.870) * (-1122.762) (-1116.952) (-1117.847) [-1121.537] -- 0:00:52
103500 -- [-1116.825] (-1116.982) (-1116.795) (-1122.068) * (-1121.800) [-1118.109] (-1117.667) (-1120.965) -- 0:00:51
104000 -- (-1117.676) (-1117.460) [-1116.560] (-1120.603) * (-1118.917) (-1120.248) (-1118.709) [-1121.514] -- 0:00:51
104500 -- (-1116.805) [-1117.367] (-1117.071) (-1122.297) * [-1119.487] (-1116.931) (-1120.089) (-1121.581) -- 0:00:51
105000 -- (-1117.035) [-1116.958] (-1116.762) (-1117.466) * [-1118.260] (-1119.366) (-1119.946) (-1120.787) -- 0:00:51
Average standard deviation of split frequencies: 0.020235
105500 -- [-1117.915] (-1117.138) (-1117.240) (-1116.732) * [-1116.951] (-1117.649) (-1120.706) (-1124.014) -- 0:00:50
106000 -- (-1118.196) [-1118.981] (-1121.023) (-1118.667) * (-1118.347) [-1122.509] (-1122.006) (-1120.864) -- 0:00:50
106500 -- (-1121.595) (-1118.274) (-1120.823) [-1117.786] * (-1117.344) (-1120.844) [-1117.668] (-1119.664) -- 0:00:50
107000 -- (-1117.012) [-1120.027] (-1118.965) (-1118.518) * (-1116.945) (-1118.270) [-1120.079] (-1122.089) -- 0:00:50
107500 -- [-1119.301] (-1117.396) (-1116.970) (-1121.487) * (-1118.609) [-1118.248] (-1122.129) (-1119.210) -- 0:00:49
108000 -- [-1117.130] (-1117.964) (-1119.715) (-1118.191) * (-1118.097) [-1116.977] (-1121.127) (-1116.577) -- 0:00:49
108500 -- (-1116.963) (-1120.104) (-1116.867) [-1118.112] * (-1119.063) [-1117.693] (-1119.871) (-1118.450) -- 0:00:49
109000 -- [-1119.036] (-1117.409) (-1118.287) (-1118.207) * (-1127.310) (-1116.801) (-1122.833) [-1118.503] -- 0:00:49
109500 -- (-1116.465) (-1121.044) (-1120.448) [-1120.760] * (-1119.475) (-1117.823) [-1118.715] (-1122.282) -- 0:00:48
110000 -- [-1119.977] (-1116.911) (-1119.184) (-1120.676) * [-1119.356] (-1117.734) (-1117.968) (-1121.568) -- 0:00:48
Average standard deviation of split frequencies: 0.022955
110500 -- (-1120.557) (-1117.930) [-1117.217] (-1118.630) * [-1117.377] (-1122.204) (-1118.146) (-1121.197) -- 0:00:48
111000 -- (-1118.626) [-1117.221] (-1116.821) (-1121.513) * (-1118.506) [-1117.691] (-1117.902) (-1119.599) -- 0:00:48
111500 -- (-1121.934) (-1117.580) (-1119.978) [-1120.677] * (-1122.409) [-1117.959] (-1116.635) (-1120.728) -- 0:00:55
112000 -- (-1119.841) (-1117.122) (-1117.461) [-1121.631] * (-1121.262) [-1117.430] (-1118.236) (-1121.788) -- 0:00:55
112500 -- [-1117.525] (-1119.113) (-1117.115) (-1117.193) * (-1116.833) (-1120.153) (-1119.038) [-1117.897] -- 0:00:55
113000 -- (-1121.408) [-1121.538] (-1118.849) (-1118.215) * (-1119.535) (-1118.238) (-1117.289) [-1118.608] -- 0:00:54
113500 -- [-1117.576] (-1120.097) (-1121.600) (-1120.104) * (-1119.207) (-1120.114) [-1117.341] (-1117.561) -- 0:00:54
114000 -- [-1118.024] (-1117.697) (-1119.266) (-1116.671) * [-1120.375] (-1118.815) (-1116.580) (-1117.749) -- 0:00:54
114500 -- (-1119.683) [-1116.594] (-1117.976) (-1118.077) * (-1119.422) (-1120.111) (-1116.336) [-1117.445] -- 0:00:54
115000 -- (-1122.584) (-1118.616) [-1118.608] (-1117.633) * (-1118.817) (-1118.660) (-1116.667) [-1117.639] -- 0:00:53
Average standard deviation of split frequencies: 0.021602
115500 -- (-1120.310) (-1118.537) (-1119.775) [-1118.542] * (-1119.360) [-1120.245] (-1116.925) (-1118.797) -- 0:00:53
116000 -- (-1119.634) [-1116.367] (-1119.175) (-1117.695) * (-1117.957) [-1117.310] (-1117.378) (-1118.200) -- 0:00:53
116500 -- (-1119.646) (-1116.384) (-1117.818) [-1117.691] * (-1117.317) (-1120.054) (-1116.738) [-1118.101] -- 0:00:53
117000 -- (-1118.568) (-1116.875) [-1118.034] (-1130.161) * (-1119.153) (-1117.596) [-1119.538] (-1118.427) -- 0:00:52
117500 -- (-1120.341) (-1117.943) [-1116.852] (-1123.294) * (-1119.377) (-1120.041) [-1117.755] (-1118.439) -- 0:00:52
118000 -- (-1119.889) [-1116.738] (-1118.362) (-1120.399) * (-1118.366) [-1117.230] (-1117.060) (-1119.775) -- 0:00:52
118500 -- [-1119.005] (-1117.789) (-1118.341) (-1118.036) * [-1119.890] (-1120.298) (-1120.511) (-1122.680) -- 0:00:52
119000 -- (-1118.888) (-1117.441) (-1119.854) [-1118.215] * (-1122.332) (-1117.902) (-1118.056) [-1117.937] -- 0:00:51
119500 -- [-1117.999] (-1118.750) (-1120.278) (-1120.069) * (-1118.992) (-1118.159) [-1119.180] (-1119.223) -- 0:00:51
120000 -- (-1118.551) (-1118.807) (-1126.017) [-1117.670] * [-1117.891] (-1119.837) (-1126.149) (-1118.684) -- 0:00:51
Average standard deviation of split frequencies: 0.023029
120500 -- (-1116.286) (-1117.745) (-1120.429) [-1119.703] * [-1117.591] (-1122.124) (-1119.652) (-1122.075) -- 0:00:51
121000 -- (-1116.286) (-1118.197) [-1120.819] (-1117.562) * (-1118.985) (-1116.863) [-1118.126] (-1118.713) -- 0:00:50
121500 -- (-1118.944) (-1118.905) [-1122.951] (-1116.675) * (-1118.134) (-1117.341) [-1117.738] (-1116.534) -- 0:00:50
122000 -- [-1117.642] (-1118.565) (-1120.022) (-1119.033) * (-1117.605) (-1118.823) [-1118.298] (-1118.216) -- 0:00:50
122500 -- (-1117.933) [-1121.168] (-1119.305) (-1119.274) * [-1116.978] (-1118.510) (-1121.394) (-1119.640) -- 0:00:50
123000 -- (-1117.067) (-1122.982) (-1118.461) [-1119.104] * (-1119.059) [-1119.818] (-1118.306) (-1117.588) -- 0:00:49
123500 -- (-1118.176) (-1119.417) [-1119.145] (-1123.053) * (-1120.850) [-1118.918] (-1118.775) (-1119.356) -- 0:00:49
124000 -- (-1119.056) [-1120.346] (-1119.420) (-1119.006) * (-1118.485) [-1119.613] (-1120.719) (-1117.759) -- 0:00:49
124500 -- (-1118.348) [-1117.335] (-1116.859) (-1118.339) * (-1117.368) [-1121.270] (-1117.516) (-1118.735) -- 0:00:49
125000 -- (-1118.296) [-1120.180] (-1119.609) (-1120.164) * (-1116.339) (-1118.016) (-1117.410) [-1120.227] -- 0:00:49
Average standard deviation of split frequencies: 0.023196
125500 -- (-1121.111) (-1116.370) (-1118.900) [-1118.401] * (-1118.411) [-1119.634] (-1117.526) (-1118.138) -- 0:00:48
126000 -- (-1120.518) (-1116.406) (-1117.124) [-1118.291] * (-1118.167) [-1117.742] (-1118.335) (-1118.010) -- 0:00:48
126500 -- [-1119.164] (-1116.777) (-1118.557) (-1116.249) * [-1116.911] (-1118.742) (-1119.228) (-1121.381) -- 0:00:48
127000 -- [-1117.182] (-1118.969) (-1120.469) (-1116.893) * (-1116.779) (-1123.285) [-1120.132] (-1121.263) -- 0:00:48
127500 -- [-1117.356] (-1119.067) (-1118.581) (-1118.468) * (-1116.653) (-1125.279) (-1117.890) [-1118.597] -- 0:00:47
128000 -- (-1118.183) (-1123.336) (-1118.067) [-1117.450] * (-1117.986) [-1120.593] (-1118.056) (-1118.267) -- 0:00:54
128500 -- (-1117.152) [-1119.505] (-1118.527) (-1121.473) * (-1117.113) (-1116.989) [-1118.870] (-1116.746) -- 0:00:54
129000 -- (-1117.158) [-1117.095] (-1119.858) (-1120.142) * [-1117.629] (-1124.628) (-1117.048) (-1118.552) -- 0:00:54
129500 -- [-1117.075] (-1118.038) (-1119.805) (-1117.591) * [-1118.738] (-1122.502) (-1118.112) (-1117.623) -- 0:00:53
130000 -- (-1120.808) (-1118.036) (-1121.831) [-1117.164] * [-1116.839] (-1124.413) (-1120.906) (-1119.221) -- 0:00:53
Average standard deviation of split frequencies: 0.024115
130500 -- (-1123.550) [-1118.116] (-1117.072) (-1119.232) * (-1118.244) (-1118.465) [-1121.111] (-1118.542) -- 0:00:53
131000 -- (-1117.497) (-1119.371) [-1116.886] (-1118.112) * (-1119.935) (-1119.178) (-1121.064) [-1121.028] -- 0:00:53
131500 -- (-1116.297) (-1120.701) [-1116.348] (-1117.441) * (-1119.177) [-1120.820] (-1122.590) (-1120.959) -- 0:00:52
132000 -- [-1116.279] (-1118.850) (-1117.407) (-1117.710) * [-1118.933] (-1131.752) (-1118.085) (-1120.823) -- 0:00:52
132500 -- [-1118.381] (-1117.275) (-1116.753) (-1117.843) * (-1118.804) [-1122.728] (-1118.188) (-1117.459) -- 0:00:52
133000 -- (-1117.846) (-1117.659) (-1118.331) [-1117.744] * [-1118.820] (-1119.810) (-1119.368) (-1118.947) -- 0:00:52
133500 -- (-1120.496) (-1117.307) [-1120.456] (-1117.709) * (-1116.858) [-1118.638] (-1120.549) (-1118.692) -- 0:00:51
134000 -- (-1121.015) (-1117.747) (-1119.785) [-1118.746] * (-1118.224) [-1117.139] (-1119.927) (-1116.912) -- 0:00:51
134500 -- (-1121.660) (-1116.687) [-1118.038] (-1118.796) * (-1119.433) [-1117.197] (-1121.474) (-1120.242) -- 0:00:51
135000 -- (-1119.819) (-1117.644) (-1117.913) [-1119.398] * [-1117.385] (-1122.991) (-1119.541) (-1120.154) -- 0:00:51
Average standard deviation of split frequencies: 0.025034
135500 -- (-1119.433) [-1116.598] (-1117.353) (-1118.509) * (-1116.510) (-1118.636) [-1119.790] (-1117.877) -- 0:00:51
136000 -- (-1117.061) [-1119.674] (-1120.297) (-1117.402) * (-1117.744) [-1118.220] (-1117.164) (-1117.798) -- 0:00:50
136500 -- (-1117.128) [-1118.973] (-1120.025) (-1118.076) * (-1117.064) (-1116.620) [-1118.470] (-1119.562) -- 0:00:50
137000 -- (-1119.267) (-1121.011) [-1118.384] (-1117.969) * (-1119.139) [-1119.444] (-1117.223) (-1118.183) -- 0:00:50
137500 -- (-1116.881) (-1119.454) (-1117.303) [-1118.328] * [-1117.206] (-1117.403) (-1119.104) (-1122.738) -- 0:00:50
138000 -- (-1117.005) (-1118.224) (-1116.982) [-1118.116] * (-1117.674) [-1120.713] (-1117.744) (-1116.965) -- 0:00:49
138500 -- (-1120.226) (-1120.741) [-1117.712] (-1120.159) * [-1120.391] (-1121.400) (-1117.274) (-1118.957) -- 0:00:49
139000 -- [-1119.098] (-1119.179) (-1116.754) (-1118.150) * (-1121.343) [-1119.544] (-1116.642) (-1118.771) -- 0:00:49
139500 -- (-1121.555) (-1119.023) [-1118.513] (-1119.875) * (-1123.150) (-1117.746) (-1117.383) [-1118.879] -- 0:00:49
140000 -- (-1120.028) [-1119.338] (-1116.890) (-1119.091) * (-1124.384) (-1118.667) (-1116.602) [-1118.878] -- 0:00:49
Average standard deviation of split frequencies: 0.023811
140500 -- (-1121.443) [-1116.592] (-1116.241) (-1117.995) * (-1120.709) (-1120.280) (-1116.643) [-1117.543] -- 0:00:48
141000 -- (-1120.125) (-1117.735) [-1119.668] (-1117.444) * [-1119.133] (-1120.655) (-1116.697) (-1117.326) -- 0:00:48
141500 -- (-1118.390) (-1116.583) (-1118.582) [-1117.512] * (-1118.018) (-1119.826) [-1120.579] (-1118.938) -- 0:00:48
142000 -- (-1116.989) [-1116.428] (-1119.241) (-1117.749) * (-1118.328) [-1117.330] (-1118.337) (-1119.539) -- 0:00:48
142500 -- [-1116.292] (-1117.158) (-1119.966) (-1118.048) * (-1117.374) [-1119.091] (-1117.527) (-1117.324) -- 0:00:48
143000 -- [-1117.216] (-1117.990) (-1119.907) (-1116.310) * (-1117.138) (-1117.032) [-1116.287] (-1117.352) -- 0:00:47
143500 -- (-1117.387) [-1122.929] (-1118.612) (-1117.512) * (-1117.582) (-1118.679) [-1116.287] (-1117.987) -- 0:00:53
144000 -- (-1120.469) (-1122.846) (-1118.127) [-1119.423] * (-1120.006) (-1122.782) (-1116.225) [-1117.438] -- 0:00:53
144500 -- (-1119.634) (-1118.475) (-1118.787) [-1117.586] * (-1119.029) (-1119.904) [-1116.508] (-1120.244) -- 0:00:53
145000 -- (-1119.918) [-1118.987] (-1119.245) (-1117.912) * (-1117.751) (-1118.659) [-1116.883] (-1117.256) -- 0:00:53
Average standard deviation of split frequencies: 0.023961
145500 -- (-1126.504) (-1118.198) (-1117.831) [-1118.100] * (-1120.585) [-1122.854] (-1116.733) (-1118.692) -- 0:00:52
146000 -- (-1118.909) (-1117.447) [-1121.675] (-1116.446) * (-1117.143) (-1120.497) [-1116.994] (-1121.328) -- 0:00:52
146500 -- (-1117.069) [-1116.515] (-1118.827) (-1118.325) * (-1120.283) (-1118.670) [-1119.955] (-1121.665) -- 0:00:52
147000 -- (-1117.452) (-1119.125) (-1118.781) [-1117.790] * [-1116.651] (-1117.361) (-1121.355) (-1119.549) -- 0:00:52
147500 -- (-1116.710) (-1120.459) (-1118.875) [-1119.924] * [-1117.481] (-1120.133) (-1117.475) (-1123.679) -- 0:00:52
148000 -- (-1119.024) (-1119.319) (-1123.333) [-1117.439] * (-1119.301) (-1118.887) (-1116.796) [-1121.245] -- 0:00:51
148500 -- (-1120.178) [-1117.051] (-1123.228) (-1122.399) * (-1121.207) (-1117.617) [-1120.869] (-1121.951) -- 0:00:51
149000 -- (-1118.693) [-1118.553] (-1122.420) (-1120.355) * (-1121.930) (-1118.935) (-1118.335) [-1119.164] -- 0:00:51
149500 -- (-1119.263) (-1117.847) [-1124.327] (-1119.039) * (-1118.113) (-1119.740) (-1118.363) [-1120.025] -- 0:00:51
150000 -- (-1120.754) [-1117.875] (-1119.765) (-1121.772) * (-1117.338) (-1118.896) (-1120.039) [-1120.572] -- 0:00:51
Average standard deviation of split frequencies: 0.024536
150500 -- (-1118.747) (-1120.991) (-1117.537) [-1119.984] * (-1125.452) [-1117.503] (-1116.652) (-1121.285) -- 0:00:50
151000 -- (-1120.221) [-1117.777] (-1118.173) (-1119.473) * (-1119.037) (-1123.346) (-1117.108) [-1117.872] -- 0:00:50
151500 -- (-1117.504) (-1118.831) [-1119.934] (-1118.484) * (-1118.073) (-1120.264) [-1118.752] (-1117.431) -- 0:00:50
152000 -- (-1117.330) (-1120.174) [-1121.049] (-1117.860) * (-1118.672) (-1119.630) [-1119.626] (-1117.579) -- 0:00:50
152500 -- [-1117.274] (-1119.601) (-1118.990) (-1120.298) * (-1118.398) (-1117.534) [-1118.636] (-1118.082) -- 0:00:50
153000 -- [-1117.597] (-1122.316) (-1117.322) (-1116.672) * (-1118.518) (-1118.501) [-1117.939] (-1117.880) -- 0:00:49
153500 -- (-1117.502) (-1122.191) (-1116.969) [-1117.980] * (-1121.093) [-1122.162] (-1117.554) (-1117.341) -- 0:00:49
154000 -- [-1121.812] (-1117.956) (-1118.690) (-1118.456) * (-1121.344) [-1119.997] (-1118.857) (-1119.778) -- 0:00:49
154500 -- [-1117.539] (-1119.411) (-1118.137) (-1118.608) * (-1118.516) (-1119.475) [-1118.924] (-1121.362) -- 0:00:49
155000 -- (-1119.947) [-1119.001] (-1118.133) (-1118.474) * [-1117.920] (-1121.523) (-1117.680) (-1120.621) -- 0:00:49
Average standard deviation of split frequencies: 0.024175
155500 -- (-1122.549) (-1120.609) (-1119.554) [-1118.097] * (-1118.092) (-1122.568) [-1119.367] (-1122.765) -- 0:00:48
156000 -- (-1122.228) [-1117.135] (-1117.379) (-1118.749) * (-1120.639) (-1119.285) (-1120.104) [-1117.694] -- 0:00:48
156500 -- (-1117.614) [-1116.620] (-1117.303) (-1117.811) * [-1118.023] (-1118.269) (-1120.398) (-1116.882) -- 0:00:48
157000 -- (-1117.418) [-1118.119] (-1117.785) (-1120.975) * (-1122.746) (-1120.120) (-1118.442) [-1116.837] -- 0:00:48
157500 -- [-1120.924] (-1116.701) (-1117.699) (-1120.733) * (-1121.383) [-1118.425] (-1116.823) (-1117.412) -- 0:00:48
158000 -- [-1117.145] (-1118.696) (-1117.149) (-1120.183) * [-1119.375] (-1118.998) (-1120.146) (-1117.989) -- 0:00:47
158500 -- (-1118.617) [-1120.505] (-1117.397) (-1116.737) * [-1119.723] (-1119.255) (-1120.921) (-1117.425) -- 0:00:53
159000 -- [-1121.287] (-1121.723) (-1118.071) (-1117.436) * [-1118.106] (-1118.869) (-1120.501) (-1118.153) -- 0:00:52
159500 -- (-1117.435) (-1120.837) (-1117.983) [-1117.424] * (-1122.051) (-1118.606) [-1120.571] (-1117.119) -- 0:00:52
160000 -- (-1118.276) (-1120.104) [-1119.802] (-1117.079) * (-1119.795) (-1119.156) (-1119.377) [-1117.125] -- 0:00:52
Average standard deviation of split frequencies: 0.022983
160500 -- [-1117.969] (-1123.595) (-1118.523) (-1117.198) * (-1118.387) (-1123.694) (-1121.029) [-1121.024] -- 0:00:52
161000 -- (-1116.905) (-1117.516) (-1119.538) [-1117.184] * [-1116.135] (-1119.491) (-1118.792) (-1117.725) -- 0:00:52
161500 -- [-1117.159] (-1117.469) (-1119.772) (-1119.088) * (-1122.485) (-1120.505) (-1118.940) [-1116.625] -- 0:00:51
162000 -- (-1119.399) (-1119.139) [-1117.290] (-1122.406) * [-1117.064] (-1124.269) (-1118.938) (-1116.707) -- 0:00:51
162500 -- (-1118.571) [-1119.958] (-1117.437) (-1120.777) * (-1117.275) (-1121.442) (-1118.774) [-1116.578] -- 0:00:51
163000 -- [-1117.223] (-1120.416) (-1118.118) (-1118.989) * [-1120.046] (-1120.510) (-1117.844) (-1117.303) -- 0:00:51
163500 -- (-1119.203) [-1116.729] (-1119.746) (-1120.691) * (-1121.430) (-1119.061) [-1119.478] (-1119.181) -- 0:00:51
164000 -- [-1123.859] (-1116.655) (-1121.374) (-1118.046) * (-1123.543) [-1117.544] (-1117.544) (-1119.826) -- 0:00:50
164500 -- (-1119.668) (-1117.515) (-1118.031) [-1116.930] * (-1119.508) (-1117.001) (-1120.892) [-1117.031] -- 0:00:50
165000 -- (-1116.388) (-1119.719) (-1117.802) [-1117.753] * (-1120.294) [-1117.190] (-1118.008) (-1119.284) -- 0:00:50
Average standard deviation of split frequencies: 0.021373
165500 -- (-1116.832) (-1119.722) [-1116.660] (-1117.727) * [-1118.655] (-1117.196) (-1124.715) (-1118.071) -- 0:00:50
166000 -- [-1117.136] (-1121.883) (-1117.234) (-1118.312) * (-1118.891) (-1121.387) (-1117.867) [-1118.086] -- 0:00:50
166500 -- (-1116.887) [-1119.411] (-1119.515) (-1117.740) * (-1118.891) (-1119.050) (-1120.152) [-1118.473] -- 0:00:50
167000 -- (-1120.105) [-1118.363] (-1120.772) (-1118.230) * (-1118.891) [-1119.450] (-1119.050) (-1118.852) -- 0:00:49
167500 -- [-1122.162] (-1118.072) (-1118.350) (-1121.050) * (-1118.594) (-1119.835) (-1117.815) [-1118.852] -- 0:00:49
168000 -- [-1120.021] (-1116.474) (-1117.438) (-1120.674) * (-1118.478) (-1117.559) [-1117.023] (-1117.991) -- 0:00:49
168500 -- (-1119.549) [-1117.362] (-1117.208) (-1119.700) * (-1119.097) (-1117.568) (-1117.738) [-1116.599] -- 0:00:49
169000 -- (-1117.940) (-1121.669) [-1116.183] (-1119.969) * (-1117.675) (-1118.252) (-1118.863) [-1116.875] -- 0:00:49
169500 -- (-1116.935) (-1119.133) (-1117.838) [-1118.068] * (-1117.693) (-1117.729) (-1117.555) [-1119.960] -- 0:00:48
170000 -- (-1117.394) (-1123.539) (-1117.309) [-1117.564] * (-1121.200) (-1120.224) (-1117.250) [-1116.985] -- 0:00:48
Average standard deviation of split frequencies: 0.021370
170500 -- (-1117.424) (-1118.786) (-1120.508) [-1118.531] * [-1117.281] (-1118.521) (-1117.843) (-1118.818) -- 0:00:48
171000 -- (-1118.323) [-1119.452] (-1119.366) (-1117.814) * (-1118.439) (-1117.160) (-1119.217) [-1121.048] -- 0:00:48
171500 -- (-1120.052) [-1117.335] (-1117.429) (-1117.408) * (-1117.002) [-1118.553] (-1119.640) (-1118.587) -- 0:00:48
172000 -- (-1122.768) [-1117.607] (-1118.539) (-1117.518) * (-1118.249) [-1119.342] (-1117.951) (-1117.086) -- 0:00:48
172500 -- (-1121.629) [-1117.291] (-1118.079) (-1117.237) * (-1119.870) (-1122.557) (-1120.179) [-1117.752] -- 0:00:47
173000 -- [-1119.002] (-1117.034) (-1116.818) (-1118.707) * (-1117.725) (-1118.709) [-1117.244] (-1116.893) -- 0:00:47
173500 -- (-1119.259) (-1116.684) [-1116.781] (-1118.469) * (-1117.111) (-1118.685) [-1117.600] (-1118.031) -- 0:00:47
174000 -- [-1117.143] (-1116.708) (-1119.999) (-1118.561) * [-1117.422] (-1118.265) (-1119.282) (-1118.289) -- 0:00:52
174500 -- (-1117.963) (-1117.248) (-1118.197) [-1118.177] * [-1117.614] (-1120.255) (-1118.375) (-1118.306) -- 0:00:52
175000 -- (-1116.601) [-1117.135] (-1118.144) (-1119.560) * [-1118.108] (-1117.981) (-1117.367) (-1119.440) -- 0:00:51
Average standard deviation of split frequencies: 0.019493
175500 -- (-1117.608) (-1117.766) [-1118.062] (-1118.362) * (-1118.570) [-1117.611] (-1117.026) (-1123.087) -- 0:00:51
176000 -- [-1117.644] (-1117.078) (-1117.395) (-1118.595) * (-1117.588) [-1118.001] (-1118.594) (-1121.467) -- 0:00:51
176500 -- [-1118.128] (-1117.083) (-1120.253) (-1117.493) * [-1119.016] (-1118.911) (-1119.654) (-1119.744) -- 0:00:51
177000 -- (-1117.784) [-1117.009] (-1119.485) (-1117.749) * (-1118.448) (-1124.117) [-1118.826] (-1119.089) -- 0:00:51
177500 -- (-1119.451) (-1116.761) [-1123.628] (-1117.062) * (-1117.831) [-1118.558] (-1116.433) (-1119.107) -- 0:00:50
178000 -- (-1125.692) [-1118.973] (-1121.104) (-1116.681) * (-1121.129) (-1119.951) (-1117.491) [-1119.271] -- 0:00:50
178500 -- (-1117.159) [-1121.359] (-1118.369) (-1117.794) * [-1118.390] (-1117.023) (-1118.715) (-1119.559) -- 0:00:50
179000 -- (-1117.646) (-1124.725) [-1119.123] (-1118.088) * (-1118.458) (-1119.784) [-1118.836] (-1118.756) -- 0:00:50
179500 -- (-1120.275) (-1119.320) (-1118.183) [-1118.494] * [-1116.809] (-1116.858) (-1117.480) (-1122.024) -- 0:00:50
180000 -- (-1116.671) (-1119.402) (-1118.236) [-1119.142] * (-1116.587) [-1117.157] (-1117.961) (-1118.040) -- 0:00:50
Average standard deviation of split frequencies: 0.019800
180500 -- [-1116.753] (-1118.945) (-1121.249) (-1118.963) * (-1116.712) (-1118.566) [-1118.143] (-1118.158) -- 0:00:49
181000 -- (-1117.512) (-1121.267) (-1119.270) [-1118.400] * (-1117.623) [-1117.806] (-1118.407) (-1119.703) -- 0:00:49
181500 -- [-1117.809] (-1118.844) (-1118.409) (-1117.494) * (-1116.966) [-1117.692] (-1116.329) (-1119.477) -- 0:00:49
182000 -- (-1119.396) (-1118.760) [-1118.160] (-1123.137) * (-1117.757) (-1117.935) (-1124.743) [-1119.088] -- 0:00:49
182500 -- (-1118.152) (-1118.250) (-1119.708) [-1119.796] * [-1118.821] (-1116.296) (-1118.753) (-1118.814) -- 0:00:49
183000 -- (-1119.694) [-1117.435] (-1120.553) (-1119.206) * (-1118.065) (-1119.022) [-1119.105] (-1121.236) -- 0:00:49
183500 -- [-1119.825] (-1117.897) (-1119.027) (-1121.010) * [-1117.470] (-1125.789) (-1117.768) (-1119.701) -- 0:00:48
184000 -- (-1118.945) (-1117.344) (-1118.897) [-1119.846] * (-1117.229) [-1118.877] (-1121.870) (-1124.892) -- 0:00:48
184500 -- (-1119.522) (-1118.489) (-1117.910) [-1118.185] * (-1116.894) [-1117.387] (-1117.153) (-1123.722) -- 0:00:48
185000 -- [-1119.118] (-1116.753) (-1118.451) (-1118.002) * (-1116.760) [-1123.125] (-1117.153) (-1118.804) -- 0:00:48
Average standard deviation of split frequencies: 0.019679
185500 -- (-1120.800) [-1116.872] (-1116.776) (-1119.297) * (-1116.584) (-1121.885) [-1117.054] (-1120.980) -- 0:00:48
186000 -- [-1118.405] (-1121.718) (-1116.927) (-1118.049) * (-1119.407) (-1119.136) [-1117.251] (-1126.060) -- 0:00:48
186500 -- (-1116.588) (-1121.730) [-1119.037] (-1118.978) * (-1119.478) (-1118.944) [-1116.884] (-1121.093) -- 0:00:47
187000 -- (-1116.413) [-1121.717] (-1120.590) (-1119.452) * (-1116.818) (-1116.756) [-1118.289] (-1121.002) -- 0:00:47
187500 -- (-1119.230) (-1123.168) (-1120.331) [-1118.360] * [-1116.914] (-1117.899) (-1120.554) (-1121.247) -- 0:00:47
188000 -- (-1118.936) (-1118.612) (-1120.542) [-1119.277] * (-1119.018) (-1118.026) (-1121.835) [-1117.437] -- 0:00:47
188500 -- (-1120.455) (-1122.272) [-1117.210] (-1118.976) * (-1119.428) (-1119.124) [-1116.710] (-1116.480) -- 0:00:47
189000 -- (-1122.037) [-1121.390] (-1119.067) (-1121.329) * (-1117.770) [-1117.241] (-1117.504) (-1117.618) -- 0:00:47
189500 -- (-1117.546) (-1120.887) [-1119.802] (-1122.568) * (-1118.424) (-1117.147) [-1117.719] (-1117.467) -- 0:00:51
190000 -- [-1118.931] (-1123.622) (-1120.598) (-1118.745) * (-1120.362) (-1116.899) (-1120.060) [-1117.031] -- 0:00:51
Average standard deviation of split frequencies: 0.018034
190500 -- (-1116.896) (-1119.460) [-1119.363] (-1118.593) * (-1119.614) (-1116.886) (-1119.457) [-1117.247] -- 0:00:50
191000 -- [-1116.916] (-1119.829) (-1118.877) (-1122.242) * (-1119.091) (-1118.703) (-1123.031) [-1117.897] -- 0:00:50
191500 -- [-1116.876] (-1118.697) (-1120.566) (-1118.993) * (-1120.484) (-1118.940) (-1121.330) [-1118.633] -- 0:00:50
192000 -- (-1116.840) (-1118.335) [-1117.799] (-1118.536) * (-1117.374) (-1120.112) [-1122.319] (-1118.556) -- 0:00:50
192500 -- (-1119.069) (-1117.371) (-1120.111) [-1117.587] * (-1117.313) (-1122.697) (-1123.074) [-1120.017] -- 0:00:50
193000 -- (-1118.059) (-1122.031) (-1119.687) [-1117.046] * [-1117.550] (-1119.393) (-1123.432) (-1118.159) -- 0:00:50
193500 -- [-1116.425] (-1117.692) (-1119.167) (-1117.101) * (-1119.640) (-1117.232) [-1117.944] (-1120.568) -- 0:00:50
194000 -- (-1116.640) (-1117.087) (-1118.002) [-1118.450] * (-1119.341) [-1118.579] (-1118.447) (-1120.460) -- 0:00:49
194500 -- (-1119.504) (-1118.065) [-1121.168] (-1119.171) * (-1118.691) (-1118.596) (-1121.339) [-1117.538] -- 0:00:49
195000 -- (-1119.961) (-1118.837) [-1119.374] (-1119.092) * [-1118.519] (-1119.134) (-1117.991) (-1116.407) -- 0:00:49
Average standard deviation of split frequencies: 0.017119
195500 -- (-1119.395) [-1119.510] (-1119.788) (-1118.362) * (-1119.847) (-1128.762) [-1118.025] (-1116.687) -- 0:00:49
196000 -- (-1117.216) [-1117.877] (-1119.603) (-1117.758) * (-1117.358) [-1120.425] (-1118.331) (-1118.512) -- 0:00:49
196500 -- (-1116.906) (-1117.486) [-1117.489] (-1116.604) * (-1116.955) (-1119.150) [-1118.882] (-1119.035) -- 0:00:49
197000 -- (-1118.324) (-1116.511) [-1119.056] (-1116.397) * (-1119.163) (-1121.941) [-1116.938] (-1118.182) -- 0:00:48
197500 -- [-1116.553] (-1116.948) (-1119.980) (-1117.807) * (-1119.530) (-1117.098) (-1117.290) [-1118.857] -- 0:00:48
198000 -- [-1117.101] (-1118.664) (-1125.707) (-1117.789) * (-1117.297) [-1118.132] (-1118.219) (-1118.113) -- 0:00:48
198500 -- (-1117.195) (-1117.389) [-1118.482] (-1119.389) * [-1117.518] (-1117.087) (-1118.916) (-1117.200) -- 0:00:48
199000 -- (-1117.970) (-1119.236) [-1124.913] (-1117.992) * (-1118.148) (-1116.786) [-1117.257] (-1119.034) -- 0:00:48
199500 -- (-1117.927) (-1118.680) (-1118.744) [-1118.912] * [-1120.727] (-1120.337) (-1118.258) (-1117.816) -- 0:00:48
200000 -- (-1116.927) (-1119.909) [-1118.834] (-1118.826) * (-1117.103) (-1119.601) [-1117.806] (-1116.616) -- 0:00:48
Average standard deviation of split frequencies: 0.018141
200500 -- (-1117.380) (-1118.331) (-1116.819) [-1117.561] * [-1117.019] (-1117.650) (-1116.492) (-1117.208) -- 0:00:47
201000 -- (-1120.354) [-1118.274] (-1117.298) (-1117.978) * (-1120.197) [-1117.069] (-1118.375) (-1120.888) -- 0:00:47
201500 -- [-1119.885] (-1121.557) (-1116.299) (-1118.394) * (-1118.927) [-1117.057] (-1118.105) (-1120.981) -- 0:00:47
202000 -- [-1119.731] (-1118.137) (-1121.627) (-1118.019) * (-1118.147) [-1117.784] (-1116.756) (-1119.409) -- 0:00:47
202500 -- [-1119.350] (-1117.936) (-1117.289) (-1118.593) * (-1117.693) (-1118.647) [-1117.847] (-1118.858) -- 0:00:47
203000 -- [-1119.479] (-1117.652) (-1117.090) (-1117.624) * (-1117.488) [-1119.557] (-1118.740) (-1119.981) -- 0:00:47
203500 -- (-1124.156) (-1118.232) (-1118.315) [-1118.088] * (-1118.920) (-1118.219) [-1122.543] (-1118.678) -- 0:00:46
204000 -- (-1119.105) (-1117.987) [-1118.644] (-1117.001) * [-1118.182] (-1119.174) (-1119.641) (-1117.812) -- 0:00:46
204500 -- [-1117.690] (-1118.540) (-1119.843) (-1118.343) * [-1119.314] (-1117.462) (-1117.481) (-1119.383) -- 0:00:46
205000 -- [-1117.710] (-1117.366) (-1121.736) (-1119.565) * (-1117.450) [-1118.532] (-1118.511) (-1118.030) -- 0:00:50
Average standard deviation of split frequencies: 0.016909
205500 -- [-1117.080] (-1119.446) (-1119.466) (-1117.650) * (-1117.450) (-1117.988) (-1119.611) [-1118.707] -- 0:00:50
206000 -- (-1117.074) (-1117.883) [-1118.602] (-1118.496) * [-1117.368] (-1117.802) (-1117.774) (-1117.648) -- 0:00:50
206500 -- (-1119.990) [-1117.849] (-1118.857) (-1117.404) * (-1117.621) [-1117.783] (-1122.761) (-1118.441) -- 0:00:49
207000 -- (-1120.931) (-1120.450) (-1119.318) [-1117.785] * (-1118.752) (-1119.588) (-1120.499) [-1120.468] -- 0:00:49
207500 -- (-1120.301) (-1118.490) [-1118.129] (-1118.263) * [-1116.838] (-1117.157) (-1124.750) (-1117.337) -- 0:00:49
208000 -- (-1118.067) (-1119.493) [-1116.519] (-1118.630) * (-1121.788) (-1117.295) (-1122.165) [-1116.942] -- 0:00:49
208500 -- (-1118.516) [-1121.666] (-1120.737) (-1117.415) * [-1119.585] (-1117.662) (-1118.470) (-1116.853) -- 0:00:49
209000 -- (-1118.770) (-1120.206) [-1117.928] (-1118.010) * (-1119.919) (-1117.723) [-1116.986] (-1120.951) -- 0:00:49
209500 -- (-1119.012) (-1122.784) [-1116.833] (-1117.719) * [-1121.736] (-1119.446) (-1116.609) (-1118.206) -- 0:00:49
210000 -- (-1118.198) (-1118.638) [-1116.873] (-1118.990) * [-1117.524] (-1117.101) (-1117.168) (-1117.169) -- 0:00:48
Average standard deviation of split frequencies: 0.016841
210500 -- (-1117.751) (-1118.607) (-1118.564) [-1121.134] * [-1117.384] (-1119.152) (-1117.470) (-1119.281) -- 0:00:48
211000 -- [-1117.470] (-1116.944) (-1121.941) (-1116.842) * (-1118.378) [-1117.733] (-1118.155) (-1118.562) -- 0:00:48
211500 -- (-1118.344) (-1123.978) [-1117.803] (-1119.256) * (-1122.615) (-1118.053) [-1119.945] (-1122.433) -- 0:00:48
212000 -- (-1118.552) (-1121.877) (-1118.606) [-1119.422] * (-1121.472) (-1117.317) [-1121.935] (-1118.319) -- 0:00:48
212500 -- (-1117.721) (-1118.398) (-1117.591) [-1118.914] * (-1119.926) (-1116.681) (-1117.967) [-1117.676] -- 0:00:48
213000 -- [-1121.392] (-1117.616) (-1117.103) (-1119.013) * [-1120.509] (-1116.511) (-1117.244) (-1121.450) -- 0:00:48
213500 -- (-1118.853) [-1121.129] (-1116.964) (-1119.228) * [-1120.748] (-1118.965) (-1119.352) (-1117.333) -- 0:00:47
214000 -- (-1117.361) (-1121.264) [-1118.124] (-1121.741) * (-1119.094) (-1120.347) (-1118.124) [-1117.334] -- 0:00:47
214500 -- (-1117.771) [-1116.677] (-1119.184) (-1117.010) * [-1116.839] (-1119.268) (-1122.995) (-1121.235) -- 0:00:47
215000 -- (-1116.478) (-1118.156) (-1121.548) [-1117.096] * [-1117.859] (-1117.483) (-1116.879) (-1122.256) -- 0:00:47
Average standard deviation of split frequencies: 0.016885
215500 -- [-1117.023] (-1118.873) (-1119.138) (-1118.573) * (-1117.852) [-1117.467] (-1119.216) (-1121.951) -- 0:00:47
216000 -- (-1117.290) (-1123.547) (-1121.611) [-1117.047] * (-1121.523) (-1116.990) (-1120.598) [-1120.662] -- 0:00:47
216500 -- [-1120.834] (-1120.464) (-1119.798) (-1116.470) * [-1118.891] (-1119.199) (-1123.987) (-1117.780) -- 0:00:47
217000 -- [-1116.505] (-1117.999) (-1121.177) (-1116.522) * (-1118.357) (-1118.263) [-1119.575] (-1119.929) -- 0:00:46
217500 -- (-1117.270) [-1117.634] (-1120.805) (-1117.374) * [-1117.328] (-1119.937) (-1118.096) (-1117.490) -- 0:00:46
218000 -- [-1117.948] (-1118.649) (-1124.908) (-1122.439) * (-1116.963) (-1117.620) (-1123.182) [-1116.393] -- 0:00:46
218500 -- (-1120.460) (-1119.287) (-1121.114) [-1117.450] * (-1116.883) [-1118.192] (-1116.974) (-1117.512) -- 0:00:46
219000 -- (-1116.843) [-1118.140] (-1119.363) (-1117.577) * (-1118.324) [-1116.918] (-1116.966) (-1117.985) -- 0:00:46
219500 -- (-1117.400) [-1116.231] (-1121.464) (-1117.671) * (-1117.783) [-1121.884] (-1117.659) (-1119.890) -- 0:00:46
220000 -- [-1116.815] (-1118.491) (-1119.112) (-1119.200) * (-1117.069) [-1117.422] (-1118.005) (-1119.763) -- 0:00:46
Average standard deviation of split frequencies: 0.016853
220500 -- [-1118.567] (-1123.285) (-1119.675) (-1122.642) * (-1118.767) [-1117.408] (-1121.214) (-1120.084) -- 0:00:49
221000 -- (-1116.443) (-1118.443) (-1119.142) [-1121.946] * (-1119.063) (-1118.092) [-1119.015] (-1117.613) -- 0:00:49
221500 -- (-1118.877) (-1119.312) (-1116.988) [-1118.264] * [-1118.809] (-1117.666) (-1116.942) (-1116.905) -- 0:00:49
222000 -- (-1117.362) [-1118.450] (-1121.630) (-1117.573) * [-1119.752] (-1123.060) (-1121.109) (-1119.765) -- 0:00:49
222500 -- (-1120.344) [-1119.118] (-1121.219) (-1118.794) * [-1118.956] (-1117.797) (-1116.885) (-1120.669) -- 0:00:48
223000 -- (-1117.558) [-1119.197] (-1123.547) (-1117.745) * (-1118.398) (-1123.506) [-1118.673] (-1120.335) -- 0:00:48
223500 -- [-1120.237] (-1119.364) (-1117.241) (-1118.834) * [-1118.671] (-1122.277) (-1120.761) (-1118.301) -- 0:00:48
224000 -- (-1120.315) (-1123.820) (-1116.799) [-1119.720] * [-1117.402] (-1121.577) (-1117.296) (-1118.174) -- 0:00:48
224500 -- [-1117.442] (-1117.760) (-1116.290) (-1117.722) * (-1117.496) (-1119.234) [-1117.918] (-1118.265) -- 0:00:48
225000 -- (-1116.479) [-1118.138] (-1118.580) (-1120.932) * (-1116.393) [-1116.437] (-1117.463) (-1120.787) -- 0:00:48
Average standard deviation of split frequencies: 0.015876
225500 -- (-1118.369) (-1117.689) (-1116.148) [-1118.232] * (-1117.033) (-1117.729) (-1121.961) [-1120.918] -- 0:00:48
226000 -- (-1119.212) (-1118.315) [-1116.149] (-1118.283) * (-1116.965) (-1117.318) (-1120.130) [-1118.528] -- 0:00:47
226500 -- [-1118.847] (-1118.297) (-1116.384) (-1121.660) * (-1116.619) (-1119.064) (-1121.020) [-1118.214] -- 0:00:47
227000 -- (-1119.451) [-1118.526] (-1120.978) (-1120.111) * (-1117.179) (-1119.425) (-1119.119) [-1118.898] -- 0:00:47
227500 -- (-1119.587) [-1120.404] (-1117.493) (-1116.865) * (-1117.845) (-1118.221) (-1117.919) [-1116.311] -- 0:00:47
228000 -- (-1118.699) (-1118.457) (-1125.012) [-1120.157] * (-1116.341) (-1119.066) [-1118.308] (-1117.099) -- 0:00:47
228500 -- (-1118.192) [-1117.901] (-1124.309) (-1121.182) * (-1120.456) (-1116.898) [-1118.355] (-1118.375) -- 0:00:47
229000 -- (-1118.487) [-1121.740] (-1119.079) (-1124.382) * [-1120.317] (-1120.993) (-1121.339) (-1118.375) -- 0:00:47
229500 -- (-1122.968) (-1120.847) (-1118.373) [-1117.687] * (-1117.853) (-1119.187) [-1119.469] (-1117.598) -- 0:00:47
230000 -- [-1118.940] (-1118.129) (-1120.852) (-1117.409) * [-1118.583] (-1118.393) (-1117.319) (-1119.291) -- 0:00:46
Average standard deviation of split frequencies: 0.014987
230500 -- (-1121.512) (-1116.912) (-1118.210) [-1119.538] * [-1118.563] (-1118.433) (-1118.917) (-1121.343) -- 0:00:46
231000 -- (-1121.920) [-1117.874] (-1116.877) (-1119.640) * (-1118.892) (-1119.039) (-1120.694) [-1118.492] -- 0:00:46
231500 -- (-1119.861) (-1117.865) [-1117.182] (-1118.220) * (-1117.591) (-1120.198) [-1117.083] (-1119.980) -- 0:00:46
232000 -- (-1122.579) (-1117.811) (-1116.871) [-1118.353] * (-1116.972) [-1118.878] (-1118.009) (-1118.407) -- 0:00:46
232500 -- [-1118.347] (-1120.811) (-1117.104) (-1117.123) * (-1119.016) (-1118.955) (-1117.708) [-1119.578] -- 0:00:46
233000 -- (-1118.266) (-1121.393) (-1119.025) [-1118.317] * (-1121.666) (-1118.577) [-1118.641] (-1121.912) -- 0:00:46
233500 -- [-1116.732] (-1121.087) (-1118.554) (-1119.006) * [-1117.779] (-1119.495) (-1117.696) (-1125.180) -- 0:00:45
234000 -- (-1118.216) (-1119.355) [-1118.489] (-1121.101) * (-1117.839) [-1116.661] (-1118.605) (-1119.610) -- 0:00:45
234500 -- [-1119.948] (-1118.732) (-1118.959) (-1118.032) * [-1117.511] (-1116.399) (-1117.138) (-1118.961) -- 0:00:45
235000 -- [-1120.507] (-1117.309) (-1119.579) (-1119.209) * (-1120.048) (-1121.076) [-1117.325] (-1118.154) -- 0:00:45
Average standard deviation of split frequencies: 0.014805
235500 -- (-1121.153) (-1117.850) (-1123.067) [-1116.967] * (-1120.861) [-1123.619] (-1118.529) (-1118.831) -- 0:00:48
236000 -- [-1116.293] (-1117.119) (-1118.420) (-1121.131) * [-1120.557] (-1121.612) (-1120.793) (-1121.724) -- 0:00:48
236500 -- [-1116.406] (-1117.684) (-1116.834) (-1116.630) * (-1119.637) [-1118.918] (-1117.798) (-1121.000) -- 0:00:48
237000 -- [-1116.427] (-1117.986) (-1117.858) (-1117.646) * (-1119.566) [-1122.251] (-1117.594) (-1120.758) -- 0:00:48
237500 -- [-1118.732] (-1117.665) (-1117.222) (-1124.841) * (-1118.499) (-1121.328) (-1118.191) [-1118.133] -- 0:00:48
238000 -- (-1118.536) (-1117.439) (-1118.113) [-1119.322] * (-1118.170) [-1120.993] (-1119.937) (-1119.608) -- 0:00:48
238500 -- [-1118.189] (-1116.518) (-1119.886) (-1119.708) * (-1119.385) (-1122.783) (-1117.714) [-1118.789] -- 0:00:47
239000 -- (-1117.641) (-1117.660) (-1121.251) [-1116.881] * (-1121.367) (-1122.841) (-1118.517) [-1118.572] -- 0:00:47
239500 -- [-1116.958] (-1118.743) (-1120.166) (-1121.951) * (-1122.350) (-1120.134) (-1118.151) [-1118.305] -- 0:00:47
240000 -- (-1123.950) [-1118.998] (-1118.346) (-1120.608) * (-1120.721) [-1121.488] (-1120.595) (-1118.115) -- 0:00:47
Average standard deviation of split frequencies: 0.015209
240500 -- (-1121.892) (-1118.770) [-1118.806] (-1120.101) * [-1118.248] (-1120.171) (-1119.654) (-1119.239) -- 0:00:47
241000 -- (-1121.148) (-1117.988) (-1119.581) [-1117.744] * (-1118.224) (-1120.612) [-1117.794] (-1124.655) -- 0:00:47
241500 -- (-1118.240) (-1119.315) [-1119.740] (-1116.923) * (-1117.338) [-1121.775] (-1118.080) (-1119.780) -- 0:00:47
242000 -- (-1119.258) (-1118.567) [-1116.736] (-1116.661) * (-1118.161) [-1118.890] (-1119.782) (-1119.434) -- 0:00:46
242500 -- (-1119.389) (-1118.028) [-1116.490] (-1117.589) * [-1117.113] (-1118.434) (-1116.639) (-1117.064) -- 0:00:46
243000 -- (-1120.580) [-1119.047] (-1117.877) (-1118.481) * [-1121.396] (-1119.909) (-1119.006) (-1116.751) -- 0:00:46
243500 -- (-1123.273) (-1116.493) (-1119.051) [-1120.393] * [-1120.078] (-1120.390) (-1116.461) (-1117.377) -- 0:00:46
244000 -- (-1118.201) (-1116.929) (-1118.478) [-1119.130] * (-1119.325) (-1116.601) [-1116.918] (-1117.407) -- 0:00:46
244500 -- (-1118.139) (-1117.569) [-1117.541] (-1121.275) * [-1119.096] (-1116.500) (-1119.015) (-1117.721) -- 0:00:46
245000 -- (-1117.390) (-1117.172) (-1117.223) [-1123.064] * (-1116.858) [-1116.289] (-1121.361) (-1116.225) -- 0:00:46
Average standard deviation of split frequencies: 0.014479
245500 -- [-1119.394] (-1117.071) (-1116.916) (-1117.610) * (-1118.859) (-1116.289) [-1119.216] (-1116.652) -- 0:00:46
246000 -- (-1119.187) [-1116.637] (-1118.208) (-1118.949) * (-1118.280) (-1117.213) (-1119.258) [-1116.424] -- 0:00:45
246500 -- (-1117.457) (-1117.142) [-1121.090] (-1123.994) * (-1116.774) (-1118.124) (-1119.495) [-1117.200] -- 0:00:45
247000 -- [-1117.303] (-1120.221) (-1118.249) (-1118.551) * (-1118.671) (-1118.152) (-1118.382) [-1117.127] -- 0:00:45
247500 -- (-1117.303) [-1119.455] (-1120.220) (-1122.660) * (-1119.051) (-1121.189) (-1117.488) [-1116.825] -- 0:00:45
248000 -- (-1118.345) [-1120.433] (-1119.132) (-1117.598) * (-1117.980) (-1117.660) (-1118.263) [-1117.844] -- 0:00:45
248500 -- (-1118.901) (-1120.937) [-1117.994] (-1118.584) * [-1118.703] (-1117.367) (-1117.359) (-1118.844) -- 0:00:45
249000 -- [-1117.934] (-1118.217) (-1120.464) (-1117.383) * (-1118.996) (-1118.508) (-1119.736) [-1119.413] -- 0:00:45
249500 -- (-1119.559) (-1118.035) [-1119.826] (-1117.870) * (-1121.088) (-1120.343) [-1121.144] (-1119.582) -- 0:00:45
250000 -- (-1119.131) [-1118.240] (-1122.022) (-1117.170) * (-1122.707) [-1117.846] (-1120.267) (-1117.693) -- 0:00:45
Average standard deviation of split frequencies: 0.015567
250500 -- (-1120.276) [-1118.296] (-1120.237) (-1119.737) * (-1121.858) (-1117.734) (-1117.682) [-1118.596] -- 0:00:44
251000 -- [-1120.652] (-1118.564) (-1121.091) (-1119.248) * (-1121.096) [-1118.300] (-1116.371) (-1124.009) -- 0:00:47
251500 -- [-1116.892] (-1118.196) (-1118.775) (-1119.986) * (-1117.025) (-1120.782) [-1118.309] (-1121.961) -- 0:00:47
252000 -- (-1116.615) [-1119.509] (-1118.204) (-1118.887) * [-1119.798] (-1116.979) (-1119.649) (-1121.444) -- 0:00:47
252500 -- [-1119.724] (-1116.853) (-1118.181) (-1120.274) * [-1119.617] (-1116.715) (-1118.941) (-1119.040) -- 0:00:47
253000 -- (-1120.432) [-1118.682] (-1119.477) (-1117.981) * (-1118.163) (-1117.306) (-1122.571) [-1119.525] -- 0:00:47
253500 -- (-1116.832) [-1118.433] (-1120.327) (-1116.619) * (-1116.567) [-1117.027] (-1121.816) (-1120.571) -- 0:00:47
254000 -- (-1119.086) [-1117.944] (-1119.711) (-1116.847) * [-1117.062] (-1116.940) (-1123.134) (-1117.080) -- 0:00:46
254500 -- (-1121.803) (-1119.114) (-1117.882) [-1118.152] * (-1117.083) [-1117.607] (-1117.537) (-1124.805) -- 0:00:46
255000 -- [-1117.845] (-1118.094) (-1118.501) (-1118.497) * (-1119.592) (-1120.816) [-1116.763] (-1119.772) -- 0:00:46
Average standard deviation of split frequencies: 0.014731
255500 -- [-1117.071] (-1118.348) (-1118.625) (-1119.107) * (-1121.701) [-1118.171] (-1120.351) (-1118.287) -- 0:00:46
256000 -- (-1117.113) [-1117.567] (-1119.085) (-1119.315) * (-1118.852) (-1121.923) [-1118.002] (-1119.006) -- 0:00:46
256500 -- (-1117.524) [-1122.579] (-1118.576) (-1119.182) * (-1118.869) (-1119.023) (-1116.717) [-1116.936] -- 0:00:46
257000 -- (-1116.947) (-1118.893) (-1117.550) [-1117.559] * (-1117.648) (-1119.511) [-1119.033] (-1118.263) -- 0:00:46
257500 -- (-1118.446) (-1119.702) (-1120.420) [-1117.130] * (-1117.082) [-1119.951] (-1118.752) (-1116.940) -- 0:00:46
258000 -- (-1120.280) (-1122.649) (-1117.344) [-1116.898] * [-1117.204] (-1119.429) (-1122.551) (-1117.690) -- 0:00:46
258500 -- (-1121.198) [-1118.850] (-1121.409) (-1117.439) * (-1117.461) (-1119.792) [-1119.689] (-1117.339) -- 0:00:45
259000 -- (-1118.218) (-1119.455) (-1118.558) [-1123.077] * (-1116.410) (-1119.813) [-1119.549] (-1118.569) -- 0:00:45
259500 -- (-1119.303) (-1120.364) [-1119.285] (-1116.830) * [-1116.127] (-1117.738) (-1119.623) (-1119.795) -- 0:00:45
260000 -- [-1116.775] (-1120.374) (-1119.058) (-1120.746) * [-1117.178] (-1116.734) (-1119.197) (-1120.310) -- 0:00:45
Average standard deviation of split frequencies: 0.016075
260500 -- [-1118.835] (-1119.133) (-1123.344) (-1118.404) * (-1118.247) (-1116.915) [-1118.376] (-1120.687) -- 0:00:45
261000 -- [-1119.850] (-1120.330) (-1118.837) (-1119.236) * (-1120.730) [-1118.428] (-1118.973) (-1123.465) -- 0:00:45
261500 -- [-1119.963] (-1120.525) (-1121.746) (-1117.660) * (-1121.840) [-1119.117] (-1117.703) (-1118.757) -- 0:00:45
262000 -- (-1119.719) (-1117.991) [-1117.776] (-1118.010) * [-1124.928] (-1119.805) (-1117.827) (-1122.102) -- 0:00:45
262500 -- (-1121.191) (-1120.235) [-1118.338] (-1120.492) * (-1125.969) (-1119.941) (-1117.078) [-1120.684] -- 0:00:44
263000 -- (-1116.948) [-1118.018] (-1120.151) (-1118.554) * (-1120.184) [-1120.146] (-1116.909) (-1119.975) -- 0:00:44
263500 -- (-1118.078) [-1117.664] (-1117.525) (-1121.027) * (-1118.140) (-1119.076) [-1117.104] (-1119.424) -- 0:00:44
264000 -- (-1117.435) [-1116.902] (-1117.320) (-1121.927) * (-1117.378) (-1117.934) (-1117.516) [-1119.207] -- 0:00:44
264500 -- (-1116.907) [-1117.378] (-1119.909) (-1120.439) * (-1118.543) [-1120.991] (-1120.384) (-1119.136) -- 0:00:44
265000 -- [-1116.575] (-1118.547) (-1120.078) (-1117.647) * [-1118.172] (-1119.521) (-1118.238) (-1117.493) -- 0:00:44
Average standard deviation of split frequencies: 0.015162
265500 -- (-1117.088) (-1119.882) (-1118.523) [-1117.761] * (-1118.301) (-1120.158) [-1123.664] (-1117.496) -- 0:00:44
266000 -- (-1116.586) (-1117.355) [-1118.823] (-1121.512) * (-1120.094) (-1118.072) [-1118.518] (-1118.421) -- 0:00:44
266500 -- (-1117.281) (-1121.529) [-1119.060] (-1118.860) * [-1123.086] (-1121.018) (-1120.594) (-1118.043) -- 0:00:44
267000 -- (-1119.820) (-1117.936) (-1119.693) [-1117.759] * [-1122.090] (-1118.060) (-1118.561) (-1117.048) -- 0:00:46
267500 -- (-1121.333) (-1118.967) (-1119.906) [-1120.982] * (-1122.054) (-1119.040) (-1118.208) [-1117.056] -- 0:00:46
268000 -- [-1117.022] (-1117.512) (-1120.496) (-1118.325) * [-1121.825] (-1117.929) (-1121.170) (-1122.959) -- 0:00:46
268500 -- (-1116.977) (-1116.520) [-1118.505] (-1123.686) * [-1118.324] (-1116.744) (-1120.642) (-1117.769) -- 0:00:46
269000 -- (-1118.143) (-1117.039) (-1117.738) [-1117.271] * (-1117.283) (-1117.465) [-1118.311] (-1119.241) -- 0:00:46
269500 -- [-1119.124] (-1119.354) (-1119.169) (-1119.780) * [-1117.416] (-1120.227) (-1118.132) (-1117.045) -- 0:00:46
270000 -- [-1116.922] (-1120.887) (-1117.503) (-1119.613) * (-1118.706) (-1119.598) [-1117.025] (-1119.198) -- 0:00:45
Average standard deviation of split frequencies: 0.015578
270500 -- (-1118.784) [-1117.832] (-1116.871) (-1118.879) * [-1117.580] (-1119.936) (-1122.059) (-1121.738) -- 0:00:45
271000 -- (-1116.786) (-1120.056) [-1117.305] (-1119.552) * (-1117.595) (-1118.481) (-1119.399) [-1120.341] -- 0:00:45
271500 -- (-1116.688) (-1121.545) [-1119.094] (-1118.035) * [-1118.620] (-1119.865) (-1118.242) (-1122.306) -- 0:00:45
272000 -- (-1116.592) [-1119.459] (-1119.993) (-1123.302) * [-1116.416] (-1118.081) (-1118.695) (-1121.098) -- 0:00:45
272500 -- (-1116.558) [-1117.913] (-1118.539) (-1117.715) * [-1118.493] (-1120.116) (-1125.258) (-1119.917) -- 0:00:45
273000 -- (-1116.961) (-1117.790) [-1119.714] (-1119.922) * (-1117.277) [-1117.519] (-1119.739) (-1117.957) -- 0:00:45
273500 -- (-1119.552) (-1119.181) [-1117.595] (-1119.938) * (-1116.548) (-1117.515) (-1118.921) [-1117.641] -- 0:00:45
274000 -- [-1120.971] (-1116.419) (-1118.821) (-1119.567) * (-1118.666) [-1117.281] (-1119.942) (-1119.888) -- 0:00:45
274500 -- (-1120.060) (-1116.162) [-1121.134] (-1117.940) * (-1116.260) [-1117.600] (-1122.323) (-1119.942) -- 0:00:44
275000 -- (-1120.036) (-1116.742) (-1119.110) [-1117.535] * (-1116.430) (-1118.336) [-1125.238] (-1119.345) -- 0:00:44
Average standard deviation of split frequencies: 0.017459
275500 -- (-1121.288) (-1121.071) (-1117.219) [-1118.393] * (-1116.540) (-1117.409) [-1118.798] (-1118.548) -- 0:00:44
276000 -- [-1119.085] (-1117.308) (-1117.518) (-1118.658) * (-1117.836) [-1121.297] (-1120.374) (-1117.773) -- 0:00:44
276500 -- [-1117.626] (-1118.131) (-1117.601) (-1117.539) * (-1116.383) [-1118.077] (-1121.032) (-1117.136) -- 0:00:44
277000 -- [-1118.756] (-1117.340) (-1117.760) (-1118.294) * (-1117.313) [-1118.356] (-1121.675) (-1118.440) -- 0:00:44
277500 -- (-1121.604) (-1117.227) (-1121.450) [-1118.389] * (-1116.561) [-1118.324] (-1117.005) (-1119.622) -- 0:00:44
278000 -- (-1117.193) (-1119.355) (-1121.105) [-1117.606] * (-1117.465) (-1117.804) [-1117.328] (-1119.473) -- 0:00:44
278500 -- [-1117.592] (-1117.360) (-1120.939) (-1117.023) * (-1118.300) (-1122.362) [-1119.960] (-1120.318) -- 0:00:44
279000 -- (-1120.353) (-1117.385) (-1117.506) [-1116.865] * (-1126.219) [-1120.828] (-1117.269) (-1122.066) -- 0:00:43
279500 -- (-1117.490) (-1119.471) (-1117.512) [-1121.609] * (-1122.761) [-1119.327] (-1117.012) (-1120.548) -- 0:00:43
280000 -- (-1118.932) (-1119.778) (-1118.374) [-1120.441] * (-1118.699) (-1116.877) [-1119.895] (-1121.696) -- 0:00:43
Average standard deviation of split frequencies: 0.017449
280500 -- [-1117.099] (-1120.402) (-1117.239) (-1121.502) * (-1118.370) (-1120.680) (-1117.559) [-1118.123] -- 0:00:43
281000 -- (-1116.897) (-1118.300) (-1117.672) [-1117.396] * (-1118.154) [-1118.468] (-1118.471) (-1118.062) -- 0:00:43
281500 -- (-1116.882) [-1118.182] (-1119.031) (-1119.053) * (-1119.224) [-1117.684] (-1118.373) (-1116.923) -- 0:00:43
282000 -- [-1116.297] (-1119.761) (-1119.462) (-1122.722) * (-1117.055) [-1117.239] (-1119.086) (-1116.923) -- 0:00:43
282500 -- [-1117.601] (-1116.349) (-1118.394) (-1119.127) * (-1119.859) (-1118.450) (-1118.114) [-1117.550] -- 0:00:43
283000 -- (-1118.365) (-1117.724) (-1118.750) [-1118.960] * [-1117.143] (-1119.159) (-1119.676) (-1117.872) -- 0:00:45
283500 -- [-1118.914] (-1118.929) (-1116.842) (-1120.639) * (-1118.858) [-1119.274] (-1120.123) (-1119.524) -- 0:00:45
284000 -- (-1120.698) (-1117.939) (-1119.686) [-1118.535] * [-1120.711] (-1118.012) (-1119.040) (-1120.062) -- 0:00:45
284500 -- [-1121.047] (-1119.097) (-1118.836) (-1118.166) * (-1118.124) (-1120.796) (-1117.456) [-1122.883] -- 0:00:45
285000 -- (-1118.476) [-1118.128] (-1117.124) (-1120.526) * (-1117.807) (-1121.188) [-1117.705] (-1120.515) -- 0:00:45
Average standard deviation of split frequencies: 0.017307
285500 -- (-1118.987) (-1117.732) [-1117.232] (-1118.981) * (-1118.808) (-1121.251) (-1117.557) [-1117.897] -- 0:00:45
286000 -- [-1117.314] (-1118.993) (-1119.953) (-1119.424) * [-1116.605] (-1118.240) (-1121.324) (-1118.091) -- 0:00:44
286500 -- [-1116.841] (-1119.544) (-1121.200) (-1118.195) * (-1122.796) [-1119.790] (-1117.448) (-1116.536) -- 0:00:44
287000 -- (-1120.422) (-1118.229) (-1118.003) [-1119.503] * (-1120.420) (-1116.575) [-1119.740] (-1118.551) -- 0:00:44
287500 -- [-1122.923] (-1118.932) (-1123.813) (-1118.669) * (-1119.424) [-1116.671] (-1123.285) (-1118.338) -- 0:00:44
288000 -- (-1122.612) [-1119.646] (-1119.668) (-1117.323) * [-1119.864] (-1116.479) (-1117.932) (-1121.086) -- 0:00:44
288500 -- (-1117.129) (-1124.446) [-1121.007] (-1118.460) * [-1117.688] (-1117.065) (-1117.925) (-1121.321) -- 0:00:44
289000 -- (-1117.318) [-1119.404] (-1119.368) (-1118.824) * [-1116.652] (-1122.567) (-1124.425) (-1118.796) -- 0:00:44
289500 -- [-1118.009] (-1118.509) (-1121.381) (-1119.779) * [-1118.781] (-1126.417) (-1117.798) (-1117.715) -- 0:00:44
290000 -- (-1118.938) (-1118.363) (-1118.244) [-1119.095] * (-1119.669) [-1118.813] (-1118.460) (-1119.575) -- 0:00:44
Average standard deviation of split frequencies: 0.017029
290500 -- (-1117.144) [-1116.982] (-1118.436) (-1117.668) * (-1121.670) [-1120.330] (-1117.852) (-1117.395) -- 0:00:43
291000 -- (-1120.906) (-1118.118) [-1116.972] (-1119.405) * (-1121.437) [-1119.996] (-1117.345) (-1126.040) -- 0:00:43
291500 -- (-1116.481) (-1120.072) (-1116.187) [-1117.448] * (-1120.036) (-1118.847) [-1118.005] (-1118.381) -- 0:00:43
292000 -- (-1117.429) (-1116.383) [-1116.879] (-1117.218) * (-1118.942) (-1117.986) [-1118.790] (-1116.922) -- 0:00:43
292500 -- [-1117.260] (-1116.683) (-1119.615) (-1116.999) * [-1117.348] (-1118.770) (-1119.301) (-1117.175) -- 0:00:43
293000 -- (-1117.798) (-1116.766) (-1122.025) [-1117.029] * (-1117.771) (-1116.888) (-1117.892) [-1117.478] -- 0:00:43
293500 -- (-1118.410) [-1118.721] (-1119.452) (-1116.852) * (-1117.385) (-1118.210) [-1118.630] (-1119.971) -- 0:00:43
294000 -- (-1118.734) (-1120.342) (-1119.563) [-1118.451] * [-1119.192] (-1118.136) (-1122.082) (-1116.153) -- 0:00:43
294500 -- (-1118.098) (-1116.377) [-1118.057] (-1120.867) * (-1121.172) (-1117.783) (-1122.068) [-1117.850] -- 0:00:43
295000 -- (-1118.902) (-1119.063) [-1117.805] (-1119.957) * (-1118.048) (-1117.039) (-1118.933) [-1117.741] -- 0:00:43
Average standard deviation of split frequencies: 0.017076
295500 -- (-1120.501) (-1118.175) (-1117.418) [-1119.672] * [-1117.319] (-1118.128) (-1117.295) (-1116.950) -- 0:00:42
296000 -- [-1120.123] (-1118.683) (-1118.139) (-1119.501) * (-1116.875) (-1120.330) [-1117.802] (-1117.867) -- 0:00:42
296500 -- (-1118.345) (-1117.873) [-1118.160] (-1122.382) * (-1118.348) (-1117.636) (-1118.510) [-1117.530] -- 0:00:45
297000 -- [-1117.474] (-1117.726) (-1118.549) (-1118.167) * (-1117.935) (-1118.003) (-1119.118) [-1117.660] -- 0:00:44
297500 -- (-1123.719) [-1121.253] (-1120.348) (-1118.881) * (-1116.739) [-1118.811] (-1117.613) (-1116.528) -- 0:00:44
298000 -- (-1121.284) (-1123.437) [-1120.925] (-1116.884) * [-1118.210] (-1119.455) (-1119.743) (-1116.166) -- 0:00:44
298500 -- (-1120.188) (-1119.518) (-1121.776) [-1117.885] * (-1121.245) (-1119.325) (-1119.081) [-1116.205] -- 0:00:44
299000 -- [-1117.932] (-1120.454) (-1120.217) (-1117.856) * (-1118.662) (-1118.367) (-1120.136) [-1118.236] -- 0:00:44
299500 -- [-1119.630] (-1118.071) (-1119.604) (-1116.660) * (-1117.823) [-1117.880] (-1119.723) (-1119.170) -- 0:00:44
300000 -- (-1120.079) (-1118.157) (-1118.514) [-1118.379] * (-1119.903) [-1118.264] (-1119.806) (-1118.144) -- 0:00:44
Average standard deviation of split frequencies: 0.016999
300500 -- (-1120.266) [-1118.882] (-1116.727) (-1120.678) * (-1122.355) (-1118.174) [-1117.107] (-1118.198) -- 0:00:44
301000 -- (-1119.847) (-1119.354) [-1118.980] (-1119.024) * [-1117.178] (-1118.131) (-1122.909) (-1118.038) -- 0:00:44
301500 -- (-1117.012) [-1119.438] (-1119.167) (-1118.992) * (-1118.812) [-1117.348] (-1120.923) (-1119.864) -- 0:00:44
302000 -- [-1117.154] (-1119.846) (-1120.625) (-1117.304) * (-1123.379) [-1118.018] (-1121.423) (-1117.528) -- 0:00:43
302500 -- (-1117.353) (-1121.438) (-1118.011) [-1117.946] * (-1121.003) (-1117.621) (-1121.002) [-1120.797] -- 0:00:43
303000 -- [-1121.236] (-1117.846) (-1118.769) (-1118.542) * (-1119.432) [-1118.155] (-1122.546) (-1121.946) -- 0:00:43
303500 -- (-1121.954) (-1119.589) [-1117.862] (-1117.058) * (-1117.661) (-1119.629) (-1119.592) [-1118.627] -- 0:00:43
304000 -- (-1122.059) (-1120.912) (-1118.150) [-1122.307] * (-1118.258) [-1117.115] (-1121.942) (-1119.295) -- 0:00:43
304500 -- [-1124.266] (-1117.943) (-1117.639) (-1119.388) * (-1117.571) (-1117.112) (-1121.025) [-1124.023] -- 0:00:43
305000 -- (-1121.701) (-1117.322) [-1119.244] (-1120.426) * (-1121.017) (-1117.469) [-1118.119] (-1119.662) -- 0:00:43
Average standard deviation of split frequencies: 0.016541
305500 -- (-1118.443) (-1119.205) [-1117.472] (-1121.444) * [-1117.514] (-1117.587) (-1117.606) (-1116.856) -- 0:00:43
306000 -- (-1121.977) (-1121.980) (-1118.028) [-1120.034] * (-1118.625) (-1119.272) (-1121.032) [-1120.027] -- 0:00:43
306500 -- [-1117.679] (-1121.884) (-1119.111) (-1118.459) * [-1120.247] (-1117.878) (-1122.435) (-1122.812) -- 0:00:42
307000 -- (-1118.397) (-1118.623) [-1120.112] (-1118.807) * (-1118.432) [-1117.598] (-1120.763) (-1124.402) -- 0:00:42
307500 -- (-1121.958) (-1118.669) (-1118.154) [-1118.270] * (-1119.309) [-1117.586] (-1121.152) (-1124.771) -- 0:00:42
308000 -- (-1117.820) (-1119.913) [-1116.860] (-1118.095) * (-1121.010) (-1118.924) [-1118.775] (-1118.060) -- 0:00:42
308500 -- [-1120.231] (-1119.640) (-1119.034) (-1122.002) * (-1121.509) (-1117.784) (-1120.265) [-1119.950] -- 0:00:42
309000 -- (-1120.508) (-1117.723) [-1117.866] (-1120.741) * (-1121.349) (-1119.518) (-1120.376) [-1116.859] -- 0:00:42
309500 -- (-1123.194) (-1118.903) (-1118.054) [-1120.172] * (-1118.412) (-1120.615) (-1120.389) [-1119.294] -- 0:00:44
310000 -- (-1119.849) [-1118.422] (-1121.190) (-1124.125) * (-1120.787) [-1118.937] (-1118.490) (-1116.902) -- 0:00:44
Average standard deviation of split frequencies: 0.017570
310500 -- (-1119.840) [-1117.486] (-1120.260) (-1124.373) * (-1121.173) (-1119.668) [-1116.634] (-1118.297) -- 0:00:44
311000 -- [-1117.089] (-1121.784) (-1119.455) (-1119.768) * (-1121.351) (-1122.732) (-1121.176) [-1116.736] -- 0:00:44
311500 -- (-1117.753) (-1116.418) [-1121.470] (-1119.589) * (-1122.029) [-1118.686] (-1118.564) (-1121.916) -- 0:00:44
312000 -- [-1117.624] (-1120.041) (-1118.448) (-1120.092) * (-1118.123) (-1118.194) [-1123.356] (-1118.716) -- 0:00:44
312500 -- (-1118.539) [-1116.979] (-1124.031) (-1120.092) * (-1118.695) (-1118.810) [-1119.331] (-1118.545) -- 0:00:44
313000 -- (-1117.539) (-1121.580) (-1120.667) [-1117.434] * [-1117.122] (-1121.442) (-1122.836) (-1120.254) -- 0:00:43
313500 -- [-1117.340] (-1120.538) (-1121.050) (-1118.930) * [-1116.569] (-1118.281) (-1117.734) (-1119.399) -- 0:00:43
314000 -- (-1118.568) [-1118.820] (-1119.382) (-1117.369) * (-1117.292) [-1118.692] (-1117.842) (-1120.720) -- 0:00:43
314500 -- (-1118.806) (-1119.445) [-1118.134] (-1117.624) * (-1117.552) [-1118.954] (-1117.252) (-1120.741) -- 0:00:43
315000 -- [-1119.950] (-1118.364) (-1117.592) (-1116.452) * (-1117.553) (-1118.676) [-1117.886] (-1120.012) -- 0:00:43
Average standard deviation of split frequencies: 0.017653
315500 -- (-1118.182) (-1121.113) [-1117.070] (-1116.452) * (-1118.089) [-1121.415] (-1119.983) (-1118.557) -- 0:00:43
316000 -- (-1121.406) [-1116.796] (-1119.209) (-1117.608) * (-1118.296) (-1121.194) (-1118.787) [-1119.076] -- 0:00:43
316500 -- (-1118.414) (-1117.279) [-1119.766] (-1120.898) * (-1118.056) (-1119.261) [-1119.006] (-1118.488) -- 0:00:43
317000 -- (-1118.184) (-1117.080) (-1124.403) [-1119.602] * (-1118.352) [-1118.890] (-1117.829) (-1123.528) -- 0:00:43
317500 -- (-1121.913) [-1119.476] (-1120.207) (-1119.092) * (-1117.296) [-1118.983] (-1117.026) (-1118.268) -- 0:00:42
318000 -- (-1118.667) (-1118.879) (-1121.918) [-1117.948] * (-1119.185) (-1117.355) (-1118.317) [-1120.869] -- 0:00:42
318500 -- (-1122.026) (-1118.602) [-1117.089] (-1118.336) * (-1117.045) [-1119.042] (-1118.089) (-1120.687) -- 0:00:42
319000 -- (-1118.500) (-1120.782) (-1119.622) [-1117.296] * (-1126.529) [-1119.452] (-1117.190) (-1118.542) -- 0:00:42
319500 -- (-1118.540) (-1117.776) (-1119.379) [-1117.891] * (-1125.515) (-1124.992) [-1118.646] (-1120.017) -- 0:00:42
320000 -- (-1116.593) (-1118.210) [-1119.317] (-1120.975) * [-1118.336] (-1123.005) (-1121.214) (-1122.453) -- 0:00:42
Average standard deviation of split frequencies: 0.016480
320500 -- (-1117.101) (-1119.128) (-1120.867) [-1117.882] * (-1116.550) (-1117.240) [-1116.621] (-1119.585) -- 0:00:42
321000 -- (-1116.582) (-1116.758) [-1117.480] (-1118.507) * (-1116.613) (-1117.245) (-1117.014) [-1119.674] -- 0:00:42
321500 -- [-1118.503] (-1117.230) (-1116.401) (-1119.239) * [-1119.323] (-1116.709) (-1117.093) (-1117.195) -- 0:00:42
322000 -- (-1116.889) (-1119.404) [-1118.166] (-1118.941) * (-1121.075) (-1118.199) (-1117.706) [-1117.427] -- 0:00:42
322500 -- (-1118.425) [-1116.853] (-1118.702) (-1118.291) * [-1117.499] (-1118.351) (-1116.943) (-1118.679) -- 0:00:42
323000 -- (-1118.107) (-1116.826) [-1117.987] (-1117.705) * (-1118.067) (-1118.196) [-1118.260] (-1119.397) -- 0:00:41
323500 -- (-1117.207) (-1117.441) (-1121.207) [-1118.606] * (-1117.854) [-1118.662] (-1120.307) (-1120.463) -- 0:00:41
324000 -- (-1118.194) (-1118.486) (-1119.719) [-1118.979] * (-1118.184) (-1118.616) [-1119.481] (-1119.726) -- 0:00:41
324500 -- (-1118.349) (-1117.123) (-1118.894) [-1117.534] * [-1117.459] (-1119.393) (-1117.844) (-1121.645) -- 0:00:41
325000 -- (-1117.468) (-1117.866) [-1121.472] (-1121.448) * [-1117.775] (-1117.122) (-1116.857) (-1118.099) -- 0:00:41
Average standard deviation of split frequencies: 0.016820
325500 -- (-1120.122) [-1120.135] (-1119.707) (-1119.084) * (-1117.359) [-1119.121] (-1117.498) (-1117.639) -- 0:00:43
326000 -- (-1122.548) (-1117.349) (-1124.308) [-1118.293] * (-1116.780) (-1119.722) (-1116.719) [-1117.692] -- 0:00:43
326500 -- [-1119.585] (-1116.464) (-1123.137) (-1117.649) * (-1116.959) (-1120.003) [-1119.753] (-1117.677) -- 0:00:43
327000 -- (-1117.768) (-1120.365) (-1120.715) [-1120.642] * (-1118.134) (-1120.668) (-1123.246) [-1118.942] -- 0:00:43
327500 -- [-1121.411] (-1116.874) (-1121.634) (-1117.752) * (-1117.718) [-1118.461] (-1120.240) (-1118.442) -- 0:00:43
328000 -- (-1120.414) [-1117.406] (-1121.720) (-1117.508) * (-1117.794) [-1119.126] (-1120.226) (-1118.079) -- 0:00:43
328500 -- (-1118.387) [-1117.848] (-1118.654) (-1118.206) * (-1121.295) (-1121.646) (-1118.699) [-1117.719] -- 0:00:42
329000 -- (-1118.714) (-1119.358) (-1119.026) [-1117.839] * (-1118.988) (-1123.297) (-1124.520) [-1117.147] -- 0:00:42
329500 -- (-1120.840) (-1116.730) (-1123.506) [-1116.545] * (-1116.506) [-1120.562] (-1123.830) (-1117.077) -- 0:00:42
330000 -- (-1118.923) (-1117.176) [-1120.369] (-1125.797) * (-1117.884) (-1116.981) (-1118.360) [-1117.280] -- 0:00:42
Average standard deviation of split frequencies: 0.016657
330500 -- (-1123.326) (-1117.136) [-1119.785] (-1118.250) * (-1116.840) [-1116.657] (-1117.316) (-1116.851) -- 0:00:42
331000 -- (-1118.400) [-1119.931] (-1119.768) (-1118.340) * (-1121.385) (-1124.725) [-1117.789] (-1116.766) -- 0:00:42
331500 -- [-1118.047] (-1120.250) (-1117.325) (-1118.091) * (-1120.537) (-1124.374) (-1117.156) [-1118.064] -- 0:00:42
332000 -- (-1117.634) [-1118.921] (-1117.682) (-1117.457) * (-1118.342) (-1117.698) (-1117.528) [-1118.480] -- 0:00:42
332500 -- (-1117.259) (-1119.241) [-1116.929] (-1117.410) * [-1118.283] (-1121.029) (-1117.157) (-1119.063) -- 0:00:42
333000 -- [-1120.455] (-1120.448) (-1120.157) (-1119.762) * (-1121.389) (-1119.191) [-1116.541] (-1119.078) -- 0:00:42
333500 -- (-1116.550) [-1117.185] (-1116.508) (-1120.181) * (-1119.775) [-1119.156] (-1117.487) (-1118.889) -- 0:00:41
334000 -- (-1119.836) (-1118.626) [-1117.600] (-1119.977) * (-1120.585) (-1118.776) (-1118.334) [-1119.705] -- 0:00:41
334500 -- [-1123.415] (-1118.595) (-1117.810) (-1120.295) * (-1119.156) (-1118.819) [-1117.981] (-1118.961) -- 0:00:41
335000 -- (-1121.451) (-1119.455) (-1116.876) [-1119.359] * [-1122.108] (-1117.388) (-1119.865) (-1118.522) -- 0:00:41
Average standard deviation of split frequencies: 0.015433
335500 -- (-1121.948) [-1117.245] (-1116.465) (-1117.612) * (-1121.261) (-1117.205) [-1118.366] (-1118.371) -- 0:00:41
336000 -- [-1121.502] (-1117.747) (-1118.505) (-1117.859) * [-1120.452] (-1121.088) (-1116.993) (-1119.495) -- 0:00:41
336500 -- [-1118.612] (-1118.030) (-1116.869) (-1118.303) * (-1116.818) [-1118.098] (-1117.079) (-1119.162) -- 0:00:41
337000 -- (-1120.951) [-1119.604] (-1117.199) (-1117.184) * (-1117.798) (-1124.171) [-1118.318] (-1119.428) -- 0:00:41
337500 -- [-1116.594] (-1119.494) (-1118.530) (-1118.532) * (-1119.419) (-1119.913) [-1118.053] (-1119.841) -- 0:00:41
338000 -- (-1116.599) (-1122.345) (-1118.523) [-1121.301] * (-1121.262) [-1122.215] (-1118.020) (-1117.922) -- 0:00:41
338500 -- (-1116.468) [-1119.170] (-1120.387) (-1121.364) * (-1118.852) (-1118.562) [-1119.332] (-1120.983) -- 0:00:41
339000 -- (-1116.511) [-1120.422] (-1117.677) (-1119.464) * (-1117.738) (-1117.568) (-1118.733) [-1121.051] -- 0:00:40
339500 -- (-1123.490) (-1117.008) (-1117.492) [-1118.512] * [-1117.595] (-1117.577) (-1119.875) (-1123.666) -- 0:00:40
340000 -- (-1118.108) (-1116.955) [-1117.470] (-1118.420) * (-1116.347) (-1118.266) [-1116.726] (-1122.716) -- 0:00:40
Average standard deviation of split frequencies: 0.015221
340500 -- (-1117.553) (-1119.418) [-1117.613] (-1118.447) * [-1119.691] (-1117.439) (-1118.716) (-1118.584) -- 0:00:40
341000 -- (-1123.096) (-1118.194) [-1117.858] (-1116.946) * (-1119.711) (-1120.364) [-1118.704] (-1117.885) -- 0:00:42
341500 -- (-1117.132) (-1117.906) [-1116.851] (-1117.686) * [-1118.617] (-1117.520) (-1117.282) (-1118.491) -- 0:00:42
342000 -- (-1123.186) (-1118.043) (-1116.981) [-1120.153] * (-1119.891) (-1119.288) (-1117.224) [-1117.844] -- 0:00:42
342500 -- [-1119.365] (-1117.696) (-1116.887) (-1121.279) * (-1119.469) [-1119.906] (-1117.523) (-1125.112) -- 0:00:42
343000 -- (-1118.227) [-1120.374] (-1118.594) (-1118.616) * (-1118.198) (-1118.594) [-1118.682] (-1119.316) -- 0:00:42
343500 -- [-1117.129] (-1116.660) (-1117.082) (-1119.574) * (-1119.307) [-1117.315] (-1118.911) (-1120.699) -- 0:00:42
344000 -- (-1116.759) (-1119.643) (-1116.545) [-1119.854] * (-1116.594) [-1119.893] (-1119.042) (-1118.085) -- 0:00:41
344500 -- (-1118.101) (-1123.324) [-1116.456] (-1118.076) * (-1121.392) (-1118.471) (-1117.354) [-1119.896] -- 0:00:41
345000 -- (-1118.468) (-1121.237) [-1116.703] (-1119.283) * (-1117.824) (-1118.431) [-1118.859] (-1125.565) -- 0:00:41
Average standard deviation of split frequencies: 0.015919
345500 -- [-1120.435] (-1117.600) (-1118.414) (-1118.362) * (-1118.602) [-1116.766] (-1119.067) (-1117.366) -- 0:00:41
346000 -- (-1119.720) (-1117.991) (-1116.585) [-1119.971] * [-1118.800] (-1121.680) (-1118.558) (-1116.910) -- 0:00:41
346500 -- (-1116.393) (-1119.092) [-1117.636] (-1119.948) * [-1117.486] (-1118.046) (-1117.443) (-1117.202) -- 0:00:41
347000 -- (-1117.161) (-1118.895) (-1119.329) [-1120.018] * (-1116.584) (-1119.326) (-1118.273) [-1117.604] -- 0:00:41
347500 -- (-1118.698) [-1117.742] (-1118.628) (-1117.437) * (-1116.700) [-1121.112] (-1120.739) (-1117.901) -- 0:00:41
348000 -- [-1120.939] (-1118.743) (-1118.468) (-1118.231) * (-1118.403) (-1117.873) (-1120.067) [-1117.932] -- 0:00:41
348500 -- [-1119.467] (-1120.499) (-1117.133) (-1117.128) * (-1118.191) (-1120.391) [-1117.291] (-1118.212) -- 0:00:41
349000 -- (-1117.466) (-1117.759) [-1120.938] (-1120.395) * [-1117.710] (-1119.230) (-1116.983) (-1119.109) -- 0:00:41
349500 -- [-1119.716] (-1118.619) (-1119.544) (-1117.878) * (-1118.931) (-1118.589) [-1117.134] (-1122.813) -- 0:00:40
350000 -- (-1116.919) [-1116.622] (-1117.788) (-1116.381) * [-1119.127] (-1118.382) (-1119.948) (-1119.431) -- 0:00:40
Average standard deviation of split frequencies: 0.016729
350500 -- (-1123.209) (-1120.771) (-1118.084) [-1117.210] * (-1117.745) (-1117.646) [-1118.827] (-1123.858) -- 0:00:40
351000 -- (-1125.215) [-1118.757] (-1118.123) (-1119.722) * (-1118.035) (-1117.520) (-1117.928) [-1116.369] -- 0:00:40
351500 -- (-1122.740) (-1119.505) [-1116.969] (-1121.415) * [-1120.814] (-1117.322) (-1118.651) (-1116.957) -- 0:00:40
352000 -- (-1121.454) [-1117.115] (-1117.398) (-1122.092) * (-1118.087) (-1117.894) [-1120.470] (-1116.842) -- 0:00:40
352500 -- (-1123.130) [-1117.707] (-1117.414) (-1119.754) * (-1117.356) (-1119.683) (-1118.092) [-1116.828] -- 0:00:40
353000 -- [-1119.285] (-1116.230) (-1117.564) (-1119.766) * [-1117.988] (-1117.425) (-1119.349) (-1118.226) -- 0:00:40
353500 -- [-1117.290] (-1117.288) (-1119.373) (-1118.829) * (-1118.363) (-1118.076) (-1122.646) [-1117.223] -- 0:00:40
354000 -- (-1118.484) (-1116.819) (-1117.271) [-1120.254] * [-1117.724] (-1121.018) (-1120.154) (-1118.740) -- 0:00:40
354500 -- [-1119.267] (-1118.173) (-1119.454) (-1118.336) * (-1119.852) [-1118.616] (-1119.364) (-1118.940) -- 0:00:40
355000 -- [-1117.444] (-1117.832) (-1117.205) (-1118.346) * [-1121.997] (-1119.801) (-1118.836) (-1120.537) -- 0:00:39
Average standard deviation of split frequencies: 0.016517
355500 -- [-1119.472] (-1120.914) (-1124.309) (-1120.398) * (-1128.988) (-1120.628) (-1118.709) [-1117.484] -- 0:00:39
356000 -- (-1118.794) (-1121.899) (-1120.008) [-1118.402] * (-1128.031) (-1121.238) (-1117.366) [-1116.614] -- 0:00:39
356500 -- (-1120.165) [-1118.423] (-1118.288) (-1120.071) * [-1121.758] (-1116.938) (-1119.301) (-1119.908) -- 0:00:39
357000 -- [-1119.396] (-1120.441) (-1119.771) (-1121.843) * (-1119.550) (-1116.777) (-1117.208) [-1119.180] -- 0:00:39
357500 -- (-1120.451) (-1117.117) [-1118.163] (-1121.744) * (-1119.534) (-1117.718) (-1118.189) [-1119.616] -- 0:00:41
358000 -- (-1120.030) [-1118.183] (-1119.927) (-1118.227) * (-1119.311) (-1119.798) (-1116.354) [-1119.117] -- 0:00:41
358500 -- (-1120.763) (-1119.945) (-1119.888) [-1117.199] * (-1117.955) (-1116.945) [-1116.419] (-1119.902) -- 0:00:41
359000 -- (-1118.189) (-1123.732) [-1121.694] (-1118.107) * (-1118.889) (-1117.218) (-1117.799) [-1117.588] -- 0:00:41
359500 -- (-1117.210) [-1119.157] (-1118.182) (-1119.439) * (-1116.620) (-1117.618) [-1117.551] (-1117.360) -- 0:00:40
360000 -- [-1117.212] (-1117.470) (-1118.341) (-1116.891) * (-1120.041) (-1122.143) [-1118.288] (-1116.672) -- 0:00:40
Average standard deviation of split frequencies: 0.017790
360500 -- (-1116.551) [-1117.318] (-1118.188) (-1116.754) * [-1116.863] (-1122.201) (-1117.394) (-1117.047) -- 0:00:40
361000 -- [-1118.162] (-1118.427) (-1117.811) (-1119.731) * (-1117.724) (-1119.903) [-1119.465] (-1123.925) -- 0:00:40
361500 -- [-1118.018] (-1116.678) (-1119.430) (-1116.587) * (-1118.188) (-1120.260) (-1119.174) [-1120.539] -- 0:00:40
362000 -- (-1117.764) [-1118.009] (-1117.945) (-1116.677) * (-1123.161) [-1118.445] (-1123.695) (-1127.844) -- 0:00:40
362500 -- (-1123.106) [-1117.717] (-1117.453) (-1116.826) * (-1119.501) (-1117.690) [-1117.402] (-1122.812) -- 0:00:40
363000 -- (-1121.241) [-1116.999] (-1122.383) (-1118.091) * (-1119.802) (-1121.641) [-1117.090] (-1118.638) -- 0:00:40
363500 -- (-1117.328) (-1117.801) (-1118.048) [-1118.276] * (-1120.085) (-1123.791) [-1117.850] (-1123.169) -- 0:00:40
364000 -- (-1117.008) [-1117.197] (-1122.908) (-1122.325) * (-1118.973) (-1120.733) [-1118.498] (-1118.737) -- 0:00:40
364500 -- (-1116.931) [-1117.086] (-1120.184) (-1117.798) * (-1118.885) (-1118.267) (-1117.113) [-1117.726] -- 0:00:40
365000 -- (-1123.581) (-1120.128) [-1120.564] (-1118.983) * [-1119.054] (-1116.820) (-1119.579) (-1117.956) -- 0:00:40
Average standard deviation of split frequencies: 0.016744
365500 -- (-1121.667) [-1122.879] (-1120.477) (-1121.995) * (-1120.047) [-1119.034] (-1118.717) (-1117.509) -- 0:00:39
366000 -- (-1118.858) [-1119.555] (-1118.071) (-1118.783) * [-1118.425] (-1125.781) (-1118.930) (-1118.998) -- 0:00:39
366500 -- (-1119.298) (-1118.972) [-1116.591] (-1121.130) * (-1116.991) (-1123.008) [-1119.378] (-1116.925) -- 0:00:39
367000 -- (-1118.346) [-1118.942] (-1117.318) (-1118.494) * (-1119.488) (-1124.894) (-1121.175) [-1116.971] -- 0:00:39
367500 -- (-1117.502) [-1118.290] (-1117.259) (-1122.313) * (-1118.250) [-1118.594] (-1118.282) (-1118.743) -- 0:00:39
368000 -- [-1119.106] (-1120.250) (-1117.117) (-1119.466) * [-1117.688] (-1118.011) (-1120.495) (-1120.025) -- 0:00:39
368500 -- (-1118.081) (-1117.744) (-1116.817) [-1120.458] * [-1116.224] (-1119.534) (-1116.981) (-1121.075) -- 0:00:39
369000 -- (-1117.960) (-1118.148) [-1119.553] (-1117.310) * [-1116.705] (-1116.872) (-1120.762) (-1119.418) -- 0:00:39
369500 -- (-1119.201) (-1119.536) (-1119.865) [-1117.286] * [-1116.362] (-1117.191) (-1120.660) (-1117.068) -- 0:00:39
370000 -- (-1118.950) (-1118.455) (-1118.660) [-1118.038] * (-1116.458) (-1120.245) [-1119.077] (-1117.780) -- 0:00:39
Average standard deviation of split frequencies: 0.017269
370500 -- (-1117.314) (-1118.927) (-1117.520) [-1119.785] * (-1117.191) (-1118.308) [-1117.865] (-1119.263) -- 0:00:39
371000 -- (-1119.644) (-1121.420) [-1116.632] (-1119.265) * (-1119.027) (-1119.139) [-1118.097] (-1119.327) -- 0:00:38
371500 -- (-1117.182) (-1120.136) [-1116.884] (-1121.433) * (-1117.372) [-1118.296] (-1117.003) (-1123.510) -- 0:00:38
372000 -- (-1120.365) (-1117.151) [-1131.417] (-1121.151) * (-1119.519) (-1124.430) [-1117.458] (-1118.943) -- 0:00:38
372500 -- [-1117.917] (-1120.013) (-1126.360) (-1117.718) * [-1120.616] (-1117.040) (-1117.063) (-1117.705) -- 0:00:38
373000 -- (-1118.830) (-1118.759) [-1119.168] (-1127.506) * [-1116.841] (-1117.999) (-1118.463) (-1119.168) -- 0:00:38
373500 -- [-1117.993] (-1116.894) (-1118.765) (-1119.199) * (-1121.374) [-1116.878] (-1120.590) (-1118.365) -- 0:00:40
374000 -- (-1120.789) (-1117.216) [-1117.260] (-1118.373) * (-1120.277) (-1116.703) [-1120.416] (-1116.852) -- 0:00:40
374500 -- (-1119.031) (-1116.846) [-1117.366] (-1117.642) * (-1116.478) [-1116.827] (-1120.596) (-1117.888) -- 0:00:40
375000 -- [-1118.508] (-1117.377) (-1121.259) (-1117.103) * (-1116.311) (-1116.959) (-1118.455) [-1120.623] -- 0:00:40
Average standard deviation of split frequencies: 0.016892
375500 -- (-1119.099) (-1117.065) (-1117.583) [-1118.470] * (-1116.155) [-1120.268] (-1117.647) (-1117.981) -- 0:00:39
376000 -- (-1122.087) (-1116.988) [-1117.146] (-1118.034) * (-1116.355) (-1119.464) (-1116.976) [-1118.814] -- 0:00:39
376500 -- (-1116.165) (-1117.977) (-1117.881) [-1118.566] * (-1118.893) (-1122.506) [-1120.135] (-1120.885) -- 0:00:39
377000 -- (-1118.004) [-1117.095] (-1118.123) (-1117.585) * (-1121.620) [-1117.397] (-1123.176) (-1119.865) -- 0:00:39
377500 -- [-1118.880] (-1122.434) (-1116.925) (-1120.675) * [-1118.015] (-1120.612) (-1122.697) (-1118.592) -- 0:00:39
378000 -- [-1118.702] (-1118.217) (-1116.512) (-1118.540) * [-1116.978] (-1118.398) (-1122.700) (-1117.645) -- 0:00:39
378500 -- [-1117.283] (-1119.935) (-1118.479) (-1117.733) * (-1117.814) [-1118.011] (-1117.367) (-1118.822) -- 0:00:39
379000 -- [-1116.975] (-1118.815) (-1120.839) (-1116.632) * [-1119.314] (-1118.933) (-1116.480) (-1119.519) -- 0:00:39
379500 -- (-1116.857) (-1123.103) [-1117.417] (-1118.719) * (-1118.845) [-1118.782] (-1116.922) (-1118.963) -- 0:00:39
380000 -- [-1118.156] (-1116.908) (-1117.874) (-1126.492) * (-1120.649) [-1120.425] (-1117.330) (-1119.366) -- 0:00:39
Average standard deviation of split frequencies: 0.016099
380500 -- (-1119.336) [-1118.870] (-1117.894) (-1118.880) * (-1121.482) [-1120.846] (-1117.350) (-1122.892) -- 0:00:39
381000 -- [-1118.024] (-1118.104) (-1117.651) (-1121.733) * (-1120.358) (-1119.280) [-1116.414] (-1120.372) -- 0:00:38
381500 -- [-1121.972] (-1120.737) (-1122.981) (-1120.772) * [-1116.850] (-1120.079) (-1118.366) (-1119.574) -- 0:00:38
382000 -- (-1119.243) (-1117.545) (-1119.685) [-1121.406] * (-1118.451) (-1119.552) (-1117.437) [-1120.046] -- 0:00:38
382500 -- (-1119.653) [-1116.998] (-1120.443) (-1118.718) * (-1117.381) (-1119.143) (-1116.663) [-1118.694] -- 0:00:38
383000 -- (-1119.624) (-1118.686) (-1122.796) [-1118.276] * (-1118.797) (-1119.236) [-1117.752] (-1117.418) -- 0:00:38
383500 -- (-1118.289) (-1119.052) [-1121.225] (-1116.627) * (-1122.429) (-1119.356) [-1117.471] (-1118.861) -- 0:00:38
384000 -- (-1123.005) [-1118.430] (-1119.780) (-1116.936) * (-1120.540) [-1119.434] (-1123.873) (-1116.663) -- 0:00:38
384500 -- (-1117.081) (-1116.991) (-1118.966) [-1118.265] * (-1119.445) (-1118.475) (-1119.831) [-1116.679] -- 0:00:38
385000 -- (-1122.643) (-1119.468) (-1120.867) [-1118.369] * (-1118.146) [-1121.307] (-1123.557) (-1117.954) -- 0:00:38
Average standard deviation of split frequencies: 0.015298
385500 -- (-1116.823) (-1122.284) [-1117.208] (-1117.925) * [-1117.902] (-1117.431) (-1118.928) (-1116.554) -- 0:00:38
386000 -- [-1117.821] (-1116.283) (-1117.936) (-1117.417) * (-1117.613) (-1118.317) (-1119.404) [-1116.256] -- 0:00:38
386500 -- (-1119.040) (-1119.798) [-1116.995] (-1118.356) * [-1116.817] (-1118.416) (-1118.158) (-1117.112) -- 0:00:38
387000 -- (-1119.649) (-1117.083) (-1118.774) [-1117.124] * [-1116.188] (-1117.504) (-1117.609) (-1117.522) -- 0:00:38
387500 -- (-1119.126) [-1117.257] (-1121.443) (-1118.701) * (-1116.651) [-1118.410] (-1117.609) (-1117.523) -- 0:00:37
388000 -- (-1118.056) (-1119.442) [-1118.542] (-1119.337) * (-1117.151) (-1118.458) (-1119.916) [-1117.490] -- 0:00:37
388500 -- [-1117.939] (-1122.129) (-1117.228) (-1119.418) * (-1116.955) (-1116.217) (-1118.757) [-1117.270] -- 0:00:37
389000 -- [-1117.944] (-1123.669) (-1116.973) (-1117.809) * (-1118.226) [-1117.450] (-1123.871) (-1121.687) -- 0:00:37
389500 -- (-1118.617) [-1118.390] (-1123.963) (-1117.681) * (-1119.793) (-1116.295) [-1117.942] (-1122.806) -- 0:00:37
390000 -- [-1117.854] (-1119.799) (-1120.485) (-1118.271) * (-1122.296) (-1117.499) [-1117.814] (-1124.141) -- 0:00:39
Average standard deviation of split frequencies: 0.014078
390500 -- (-1118.853) [-1119.304] (-1119.287) (-1119.039) * (-1121.363) (-1118.636) [-1117.711] (-1120.064) -- 0:00:39
391000 -- (-1121.046) (-1118.322) (-1118.759) [-1118.899] * (-1117.953) (-1117.942) (-1117.764) [-1119.545] -- 0:00:38
391500 -- (-1118.313) [-1117.338] (-1121.912) (-1118.903) * (-1117.505) (-1118.460) [-1116.972] (-1120.563) -- 0:00:38
392000 -- (-1118.530) (-1119.721) (-1121.341) [-1118.362] * [-1117.710] (-1118.677) (-1117.392) (-1121.169) -- 0:00:38
392500 -- [-1119.734] (-1120.706) (-1122.985) (-1117.198) * (-1117.411) (-1118.469) (-1117.350) [-1123.330] -- 0:00:38
393000 -- (-1124.995) (-1119.327) (-1121.207) [-1116.980] * [-1117.952] (-1117.820) (-1117.556) (-1126.489) -- 0:00:38
393500 -- (-1126.491) [-1117.528] (-1118.311) (-1118.667) * [-1118.983] (-1119.649) (-1117.465) (-1122.456) -- 0:00:38
394000 -- (-1124.694) (-1119.436) [-1117.356] (-1118.429) * (-1118.820) [-1117.842] (-1118.816) (-1119.329) -- 0:00:38
394500 -- (-1117.162) (-1118.146) [-1119.773] (-1119.087) * (-1118.982) (-1116.983) (-1125.223) [-1120.450] -- 0:00:38
395000 -- (-1118.312) (-1119.191) [-1118.242] (-1120.667) * (-1120.249) (-1117.031) [-1117.612] (-1120.987) -- 0:00:38
Average standard deviation of split frequencies: 0.013165
395500 -- (-1119.129) (-1120.729) [-1117.114] (-1117.623) * [-1119.801] (-1119.136) (-1119.789) (-1121.900) -- 0:00:38
396000 -- (-1118.474) [-1120.140] (-1121.940) (-1120.006) * (-1117.165) (-1119.433) [-1120.166] (-1124.731) -- 0:00:38
396500 -- (-1116.481) (-1117.920) [-1118.558] (-1118.950) * (-1116.962) (-1120.284) (-1120.056) [-1118.550] -- 0:00:38
397000 -- (-1118.684) [-1117.068] (-1118.916) (-1120.781) * [-1119.307] (-1120.937) (-1119.822) (-1118.577) -- 0:00:37
397500 -- (-1118.772) (-1122.296) [-1119.168] (-1118.116) * (-1120.296) [-1118.037] (-1117.459) (-1118.508) -- 0:00:37
398000 -- (-1119.362) [-1118.537] (-1118.359) (-1118.531) * (-1119.636) [-1117.459] (-1118.349) (-1117.472) -- 0:00:37
398500 -- (-1122.674) (-1118.728) (-1117.590) [-1119.104] * [-1117.069] (-1119.165) (-1119.706) (-1116.592) -- 0:00:37
399000 -- [-1116.830] (-1117.832) (-1116.440) (-1119.074) * (-1118.013) [-1118.497] (-1119.785) (-1119.946) -- 0:00:37
399500 -- (-1117.277) [-1118.240] (-1116.592) (-1119.502) * (-1120.024) [-1117.746] (-1118.686) (-1120.733) -- 0:00:37
400000 -- (-1122.182) (-1116.629) (-1120.206) [-1116.912] * [-1118.199] (-1117.999) (-1120.312) (-1117.132) -- 0:00:37
Average standard deviation of split frequencies: 0.013751
400500 -- (-1122.509) [-1118.033] (-1116.876) (-1116.980) * [-1118.315] (-1117.264) (-1121.297) (-1117.607) -- 0:00:37
401000 -- (-1123.068) (-1117.223) (-1118.736) [-1116.655] * (-1118.088) [-1116.617] (-1121.030) (-1117.332) -- 0:00:37
401500 -- [-1121.534] (-1118.529) (-1121.304) (-1117.891) * (-1116.756) (-1117.948) (-1118.948) [-1119.099] -- 0:00:37
402000 -- (-1121.440) [-1120.581] (-1118.708) (-1118.554) * [-1116.463] (-1116.208) (-1118.082) (-1117.105) -- 0:00:37
402500 -- [-1116.644] (-1118.312) (-1117.869) (-1117.600) * [-1117.073] (-1117.867) (-1117.515) (-1117.094) -- 0:00:37
403000 -- (-1116.874) (-1117.052) (-1117.980) [-1117.893] * (-1117.431) (-1117.722) [-1116.619] (-1116.728) -- 0:00:37
403500 -- (-1118.405) (-1121.456) [-1116.491] (-1121.504) * (-1117.724) (-1118.072) [-1117.459] (-1119.730) -- 0:00:36
404000 -- (-1119.054) [-1119.718] (-1121.050) (-1120.480) * [-1118.178] (-1118.303) (-1117.249) (-1118.896) -- 0:00:36
404500 -- (-1117.173) (-1118.134) [-1118.754] (-1118.090) * (-1119.106) [-1117.805] (-1117.867) (-1118.900) -- 0:00:36
405000 -- [-1116.729] (-1117.754) (-1118.577) (-1119.288) * [-1119.587] (-1119.067) (-1119.381) (-1117.935) -- 0:00:36
Average standard deviation of split frequencies: 0.012917
405500 -- (-1117.315) [-1117.441] (-1119.860) (-1118.206) * (-1119.622) (-1117.827) (-1117.849) [-1117.506] -- 0:00:36
406000 -- (-1120.047) (-1119.274) [-1122.919] (-1118.375) * (-1117.995) (-1118.255) [-1117.390] (-1116.597) -- 0:00:38
406500 -- (-1118.238) [-1118.348] (-1123.113) (-1118.460) * (-1116.269) (-1117.481) [-1117.516] (-1118.404) -- 0:00:37
407000 -- (-1119.200) [-1119.319] (-1120.590) (-1119.008) * (-1118.182) (-1118.372) (-1118.085) [-1119.494] -- 0:00:37
407500 -- (-1118.635) (-1119.541) [-1119.811] (-1117.562) * (-1117.055) (-1120.625) [-1121.069] (-1122.473) -- 0:00:37
408000 -- (-1118.562) [-1120.932] (-1118.747) (-1119.250) * [-1117.162] (-1120.247) (-1121.700) (-1118.148) -- 0:00:37
408500 -- [-1119.140] (-1117.491) (-1118.571) (-1118.986) * (-1117.300) [-1122.205] (-1121.237) (-1120.043) -- 0:00:37
409000 -- (-1116.805) (-1118.075) [-1121.927] (-1117.831) * (-1117.341) (-1117.390) [-1116.976] (-1118.900) -- 0:00:37
409500 -- (-1122.453) (-1119.005) [-1121.539] (-1117.510) * (-1116.351) (-1119.735) (-1116.751) [-1119.323] -- 0:00:37
410000 -- (-1118.100) [-1119.057] (-1118.123) (-1119.571) * (-1122.371) [-1118.639] (-1120.730) (-1119.266) -- 0:00:37
Average standard deviation of split frequencies: 0.012559
410500 -- (-1118.157) (-1121.014) [-1118.012] (-1116.587) * (-1122.327) (-1118.388) (-1116.936) [-1118.267] -- 0:00:37
411000 -- (-1118.291) [-1119.039] (-1118.156) (-1120.521) * [-1116.825] (-1119.161) (-1118.591) (-1117.753) -- 0:00:37
411500 -- (-1117.232) (-1120.716) (-1118.581) [-1119.589] * [-1117.602] (-1120.000) (-1117.480) (-1117.858) -- 0:00:37
412000 -- (-1123.986) (-1121.051) (-1119.343) [-1120.047] * [-1118.619] (-1119.186) (-1117.238) (-1118.819) -- 0:00:37
412500 -- (-1121.838) (-1118.286) [-1118.196] (-1119.622) * (-1121.732) (-1122.086) [-1117.884] (-1117.943) -- 0:00:37
413000 -- [-1121.662] (-1118.219) (-1120.153) (-1116.949) * (-1120.379) (-1120.240) (-1119.005) [-1117.400] -- 0:00:36
413500 -- [-1119.984] (-1117.209) (-1117.356) (-1118.642) * [-1117.093] (-1118.280) (-1118.637) (-1117.452) -- 0:00:36
414000 -- (-1117.735) (-1118.348) (-1116.653) [-1119.509] * (-1119.786) [-1118.300] (-1118.120) (-1117.463) -- 0:00:36
414500 -- (-1116.624) (-1120.426) [-1116.931] (-1121.198) * (-1117.613) (-1118.383) [-1117.864] (-1123.206) -- 0:00:36
415000 -- (-1116.625) [-1116.582] (-1120.611) (-1118.602) * (-1117.689) (-1119.080) [-1116.516] (-1122.323) -- 0:00:36
Average standard deviation of split frequencies: 0.012182
415500 -- [-1116.623] (-1117.554) (-1116.727) (-1118.713) * (-1120.504) (-1118.014) [-1116.990] (-1119.627) -- 0:00:36
416000 -- (-1116.762) [-1116.424] (-1122.449) (-1119.199) * (-1121.719) (-1122.732) (-1121.062) [-1117.048] -- 0:00:36
416500 -- (-1117.991) (-1116.677) [-1119.266] (-1117.871) * (-1118.670) (-1118.644) (-1118.361) [-1120.996] -- 0:00:36
417000 -- [-1117.334] (-1117.544) (-1116.925) (-1120.144) * (-1119.885) (-1120.839) [-1117.889] (-1118.252) -- 0:00:36
417500 -- (-1119.439) (-1118.023) (-1117.442) [-1118.314] * (-1119.835) (-1120.355) [-1122.836] (-1118.839) -- 0:00:36
418000 -- (-1117.156) [-1120.836] (-1119.154) (-1118.858) * [-1119.557] (-1117.682) (-1120.549) (-1117.558) -- 0:00:36
418500 -- [-1116.335] (-1117.009) (-1117.411) (-1122.433) * (-1117.270) (-1117.480) (-1116.317) [-1119.964] -- 0:00:36
419000 -- (-1117.868) [-1117.611] (-1117.493) (-1119.040) * [-1123.125] (-1117.555) (-1119.553) (-1119.739) -- 0:00:36
419500 -- (-1118.339) [-1117.635] (-1118.553) (-1120.653) * (-1118.134) (-1116.773) (-1122.371) [-1117.528] -- 0:00:35
420000 -- (-1117.883) (-1118.324) [-1118.012] (-1122.169) * (-1119.543) (-1117.650) (-1119.630) [-1119.392] -- 0:00:35
Average standard deviation of split frequencies: 0.012747
420500 -- [-1117.762] (-1119.585) (-1117.764) (-1119.709) * (-1119.523) [-1116.393] (-1119.909) (-1117.245) -- 0:00:35
421000 -- (-1117.377) [-1117.263] (-1118.898) (-1122.634) * (-1123.710) (-1118.330) [-1117.107] (-1118.104) -- 0:00:35
421500 -- [-1117.906] (-1117.201) (-1118.250) (-1117.680) * [-1120.894] (-1116.650) (-1118.981) (-1118.039) -- 0:00:35
422000 -- (-1117.085) (-1116.789) [-1118.519] (-1117.548) * [-1118.902] (-1118.170) (-1118.492) (-1118.338) -- 0:00:35
422500 -- [-1117.336] (-1118.562) (-1116.645) (-1118.952) * (-1118.867) [-1123.253] (-1119.233) (-1122.440) -- 0:00:36
423000 -- [-1117.124] (-1116.484) (-1116.630) (-1119.587) * [-1120.869] (-1125.739) (-1121.053) (-1118.537) -- 0:00:36
423500 -- (-1117.475) (-1117.722) (-1116.808) [-1119.931] * (-1121.453) (-1117.886) [-1117.221] (-1117.928) -- 0:00:36
424000 -- (-1117.475) [-1117.450] (-1116.421) (-1120.803) * (-1120.905) (-1119.042) [-1116.640] (-1116.869) -- 0:00:36
424500 -- [-1118.346] (-1116.405) (-1119.742) (-1119.817) * (-1119.633) (-1118.763) [-1119.491] (-1117.389) -- 0:00:36
425000 -- [-1117.493] (-1118.244) (-1121.199) (-1116.736) * (-1119.373) (-1120.484) [-1117.980] (-1118.250) -- 0:00:36
Average standard deviation of split frequencies: 0.013586
425500 -- [-1116.340] (-1119.037) (-1120.004) (-1116.759) * (-1119.102) [-1117.094] (-1118.512) (-1117.950) -- 0:00:36
426000 -- (-1116.906) [-1119.120] (-1118.633) (-1121.290) * (-1118.824) (-1120.688) [-1118.031] (-1119.012) -- 0:00:36
426500 -- [-1116.677] (-1120.716) (-1117.907) (-1119.419) * (-1117.991) [-1119.555] (-1116.928) (-1119.079) -- 0:00:36
427000 -- (-1117.192) [-1117.375] (-1122.350) (-1122.013) * [-1117.103] (-1120.808) (-1116.631) (-1120.046) -- 0:00:36
427500 -- (-1118.150) (-1117.229) [-1117.160] (-1117.474) * (-1117.054) [-1120.914] (-1117.447) (-1121.067) -- 0:00:36
428000 -- (-1117.932) [-1118.147] (-1119.469) (-1118.254) * [-1120.577] (-1119.783) (-1118.140) (-1117.053) -- 0:00:36
428500 -- [-1119.545] (-1118.813) (-1120.876) (-1119.899) * (-1118.767) (-1119.038) (-1122.939) [-1122.024] -- 0:00:36
429000 -- (-1121.161) [-1117.384] (-1121.100) (-1120.373) * (-1119.211) (-1120.058) (-1117.995) [-1125.729] -- 0:00:35
429500 -- (-1118.832) (-1118.246) (-1116.651) [-1118.218] * (-1117.978) (-1119.990) [-1116.148] (-1125.190) -- 0:00:35
430000 -- (-1120.069) [-1118.285] (-1116.230) (-1118.726) * (-1119.418) [-1119.303] (-1117.457) (-1121.089) -- 0:00:35
Average standard deviation of split frequencies: 0.013196
430500 -- (-1118.619) [-1116.442] (-1119.885) (-1118.790) * (-1125.563) (-1123.023) [-1118.026] (-1118.658) -- 0:00:35
431000 -- (-1117.653) (-1118.858) [-1116.988] (-1122.708) * [-1119.230] (-1116.480) (-1118.790) (-1117.896) -- 0:00:35
431500 -- (-1117.651) (-1120.204) (-1117.971) [-1118.800] * (-1118.344) (-1120.728) (-1122.580) [-1116.615] -- 0:00:35
432000 -- (-1118.353) (-1120.267) (-1122.677) [-1118.719] * (-1117.912) (-1122.185) [-1121.291] (-1122.083) -- 0:00:35
432500 -- (-1117.823) [-1118.786] (-1119.752) (-1122.791) * (-1117.505) (-1122.449) [-1123.418] (-1117.370) -- 0:00:35
433000 -- (-1118.386) (-1122.414) (-1118.651) [-1121.273] * [-1120.087] (-1124.988) (-1118.682) (-1119.955) -- 0:00:35
433500 -- (-1119.849) [-1118.108] (-1117.558) (-1122.164) * (-1120.103) [-1117.192] (-1119.326) (-1118.795) -- 0:00:35
434000 -- (-1119.116) [-1118.644] (-1122.006) (-1117.562) * (-1119.041) [-1117.046] (-1120.008) (-1117.429) -- 0:00:35
434500 -- (-1118.641) [-1119.416] (-1117.289) (-1121.409) * (-1119.741) [-1117.006] (-1118.491) (-1117.560) -- 0:00:35
435000 -- (-1117.797) (-1118.620) [-1117.849] (-1120.648) * (-1120.803) (-1117.276) (-1116.909) [-1118.698] -- 0:00:35
Average standard deviation of split frequencies: 0.013430
435500 -- (-1120.969) (-1118.606) [-1118.682] (-1123.152) * (-1119.332) (-1117.771) (-1119.227) [-1119.162] -- 0:00:34
436000 -- [-1120.459] (-1120.283) (-1118.406) (-1118.956) * (-1117.695) [-1116.577] (-1118.978) (-1117.482) -- 0:00:34
436500 -- (-1119.409) (-1117.789) [-1118.219] (-1119.072) * (-1120.566) [-1117.077] (-1118.571) (-1116.732) -- 0:00:34
437000 -- (-1117.754) [-1118.448] (-1120.505) (-1117.087) * [-1119.076] (-1118.182) (-1117.449) (-1119.724) -- 0:00:34
437500 -- (-1116.984) (-1117.415) [-1119.848] (-1119.173) * [-1118.592] (-1119.072) (-1117.741) (-1118.577) -- 0:00:34
438000 -- [-1116.921] (-1117.015) (-1119.540) (-1119.088) * (-1122.548) [-1117.233] (-1119.754) (-1117.209) -- 0:00:34
438500 -- (-1117.187) [-1117.347] (-1117.707) (-1121.286) * (-1121.779) (-1119.040) (-1117.208) [-1120.605] -- 0:00:34
439000 -- [-1121.484] (-1120.246) (-1118.528) (-1119.516) * [-1117.903] (-1118.901) (-1118.389) (-1119.890) -- 0:00:35
439500 -- (-1117.995) (-1118.996) (-1118.227) [-1116.842] * [-1121.903] (-1121.528) (-1116.324) (-1121.276) -- 0:00:35
440000 -- (-1123.113) (-1118.737) (-1119.110) [-1116.875] * [-1121.562] (-1117.959) (-1123.719) (-1119.938) -- 0:00:35
Average standard deviation of split frequencies: 0.012235
440500 -- [-1119.605] (-1116.708) (-1116.879) (-1117.522) * (-1121.062) (-1118.820) [-1120.165] (-1118.590) -- 0:00:35
441000 -- (-1116.385) (-1117.834) [-1116.431] (-1116.294) * (-1118.058) [-1122.515] (-1118.020) (-1119.054) -- 0:00:35
441500 -- (-1117.206) (-1121.267) (-1119.213) [-1116.764] * (-1118.714) (-1120.809) [-1117.594] (-1127.259) -- 0:00:35
442000 -- [-1117.930] (-1119.774) (-1119.215) (-1119.391) * (-1117.849) (-1119.213) (-1117.134) [-1123.879] -- 0:00:35
442500 -- (-1118.588) (-1117.523) (-1116.400) [-1119.766] * (-1117.702) (-1116.691) [-1119.860] (-1120.132) -- 0:00:35
443000 -- (-1118.659) (-1117.464) [-1120.250] (-1117.715) * (-1117.531) (-1118.893) (-1117.288) [-1119.889] -- 0:00:35
443500 -- (-1117.642) (-1119.330) [-1119.687] (-1118.574) * (-1116.775) [-1116.509] (-1117.060) (-1119.945) -- 0:00:35
444000 -- [-1119.044] (-1117.408) (-1117.003) (-1118.576) * [-1119.454] (-1116.767) (-1122.599) (-1119.751) -- 0:00:35
444500 -- (-1121.444) [-1117.010] (-1121.991) (-1117.055) * [-1117.327] (-1118.314) (-1120.389) (-1118.660) -- 0:00:34
445000 -- (-1125.444) (-1117.920) (-1118.918) [-1116.751] * (-1117.746) [-1117.167] (-1119.100) (-1117.997) -- 0:00:34
Average standard deviation of split frequencies: 0.013153
445500 -- (-1117.575) (-1117.904) (-1119.946) [-1116.374] * (-1119.006) (-1129.309) (-1118.103) [-1119.883] -- 0:00:34
446000 -- [-1118.718] (-1121.360) (-1119.833) (-1118.725) * (-1118.550) (-1124.278) (-1117.363) [-1118.823] -- 0:00:34
446500 -- [-1120.322] (-1117.320) (-1117.618) (-1119.377) * (-1119.450) (-1120.035) (-1117.999) [-1118.691] -- 0:00:34
447000 -- (-1118.450) (-1117.336) [-1117.763] (-1119.613) * (-1118.731) (-1120.784) [-1117.013] (-1117.364) -- 0:00:34
447500 -- (-1117.253) (-1117.442) [-1117.578] (-1121.049) * (-1118.091) (-1124.347) (-1118.209) [-1118.505] -- 0:00:34
448000 -- (-1117.048) (-1120.865) [-1117.994] (-1116.972) * (-1117.750) [-1122.160] (-1121.535) (-1122.130) -- 0:00:34
448500 -- (-1119.305) (-1123.700) [-1117.911] (-1120.952) * [-1118.473] (-1124.471) (-1125.025) (-1116.927) -- 0:00:34
449000 -- [-1119.300] (-1117.535) (-1121.783) (-1118.881) * (-1122.865) [-1118.617] (-1118.926) (-1118.414) -- 0:00:34
449500 -- (-1122.058) (-1118.257) (-1121.241) [-1117.786] * (-1118.154) (-1118.103) [-1118.448] (-1120.064) -- 0:00:34
450000 -- (-1125.395) [-1118.933] (-1118.474) (-1117.768) * (-1120.005) (-1118.380) [-1117.967] (-1118.654) -- 0:00:34
Average standard deviation of split frequencies: 0.013229
450500 -- (-1118.039) (-1119.557) [-1117.828] (-1116.892) * (-1120.229) (-1119.620) [-1117.553] (-1116.540) -- 0:00:34
451000 -- (-1117.873) (-1119.164) [-1117.245] (-1117.285) * (-1117.708) (-1116.812) (-1117.682) [-1117.339] -- 0:00:34
451500 -- (-1119.901) [-1116.791] (-1117.910) (-1118.319) * (-1120.161) (-1117.474) (-1117.975) [-1117.574] -- 0:00:34
452000 -- (-1123.912) [-1117.267] (-1118.422) (-1119.141) * (-1116.845) [-1121.469] (-1123.544) (-1117.869) -- 0:00:33
452500 -- (-1123.827) [-1117.229] (-1118.424) (-1118.888) * (-1119.198) [-1119.951] (-1121.370) (-1117.555) -- 0:00:33
453000 -- (-1118.328) [-1118.301] (-1117.848) (-1118.356) * (-1120.998) (-1117.095) (-1118.828) [-1117.646] -- 0:00:33
453500 -- (-1118.781) (-1119.024) [-1117.540] (-1119.393) * (-1122.251) [-1119.145] (-1118.854) (-1116.946) -- 0:00:33
454000 -- [-1118.957] (-1123.598) (-1117.384) (-1120.429) * (-1119.274) [-1118.143] (-1118.831) (-1117.093) -- 0:00:33
454500 -- (-1121.180) [-1117.386] (-1117.873) (-1118.434) * (-1118.449) (-1119.935) (-1119.840) [-1116.447] -- 0:00:33
455000 -- (-1124.613) [-1117.676] (-1117.019) (-1119.934) * (-1117.795) (-1119.898) (-1121.030) [-1116.457] -- 0:00:33
Average standard deviation of split frequencies: 0.013439
455500 -- (-1120.604) (-1118.522) [-1118.708] (-1121.309) * (-1118.549) [-1120.868] (-1117.942) (-1116.722) -- 0:00:34
456000 -- [-1117.405] (-1117.163) (-1118.670) (-1119.083) * (-1118.145) (-1118.175) (-1117.598) [-1118.655] -- 0:00:34
456500 -- [-1118.453] (-1117.322) (-1118.343) (-1121.987) * (-1118.289) (-1125.094) [-1117.594] (-1120.245) -- 0:00:34
457000 -- (-1117.789) (-1117.649) (-1120.404) [-1117.990] * (-1118.818) [-1120.272] (-1119.254) (-1118.567) -- 0:00:34
457500 -- [-1120.356] (-1118.937) (-1119.454) (-1118.085) * (-1119.338) (-1123.542) (-1125.436) [-1119.394] -- 0:00:34
458000 -- [-1118.106] (-1120.196) (-1118.642) (-1117.341) * (-1119.792) (-1122.579) [-1118.560] (-1121.051) -- 0:00:34
458500 -- (-1120.165) (-1119.325) [-1118.807] (-1117.434) * (-1117.773) (-1122.417) (-1118.796) [-1118.147] -- 0:00:34
459000 -- [-1123.240] (-1117.990) (-1117.479) (-1119.533) * (-1117.692) (-1120.178) (-1117.788) [-1117.321] -- 0:00:34
459500 -- (-1124.089) [-1117.504] (-1120.184) (-1121.329) * (-1119.066) (-1119.423) (-1116.789) [-1117.046] -- 0:00:34
460000 -- [-1118.236] (-1121.738) (-1119.014) (-1119.913) * [-1119.153] (-1117.483) (-1120.132) (-1117.189) -- 0:00:34
Average standard deviation of split frequencies: 0.013122
460500 -- (-1117.391) (-1121.664) (-1118.457) [-1119.709] * (-1121.026) [-1119.176] (-1125.279) (-1116.985) -- 0:00:33
461000 -- (-1117.254) (-1116.895) (-1116.942) [-1119.785] * [-1119.960] (-1118.111) (-1121.131) (-1118.330) -- 0:00:33
461500 -- (-1118.502) (-1116.607) [-1117.746] (-1119.468) * [-1118.233] (-1118.398) (-1120.259) (-1119.606) -- 0:00:33
462000 -- [-1121.390] (-1120.036) (-1121.136) (-1119.087) * [-1118.167] (-1122.161) (-1117.253) (-1121.241) -- 0:00:33
462500 -- [-1121.968] (-1118.437) (-1121.813) (-1117.788) * (-1116.697) (-1119.656) (-1117.196) [-1118.279] -- 0:00:33
463000 -- [-1120.340] (-1120.059) (-1122.352) (-1119.541) * (-1118.878) [-1117.669] (-1117.385) (-1119.442) -- 0:00:33
463500 -- [-1116.673] (-1118.754) (-1118.142) (-1119.179) * [-1118.845] (-1117.748) (-1118.060) (-1118.066) -- 0:00:33
464000 -- (-1119.086) (-1117.632) [-1121.792] (-1122.789) * (-1118.481) (-1118.535) [-1116.625] (-1119.626) -- 0:00:33
464500 -- (-1119.122) (-1118.733) [-1122.494] (-1118.479) * (-1118.117) (-1118.574) [-1117.280] (-1117.334) -- 0:00:33
465000 -- (-1120.015) (-1123.887) (-1122.574) [-1118.118] * (-1121.538) (-1116.951) (-1117.171) [-1117.483] -- 0:00:33
Average standard deviation of split frequencies: 0.012794
465500 -- (-1120.241) [-1123.953] (-1122.345) (-1117.203) * (-1118.311) (-1119.434) (-1117.769) [-1116.819] -- 0:00:33
466000 -- [-1121.203] (-1118.931) (-1119.671) (-1118.807) * [-1120.114] (-1119.639) (-1117.475) (-1118.014) -- 0:00:33
466500 -- (-1117.213) (-1119.188) (-1119.426) [-1119.932] * (-1120.220) (-1120.665) (-1119.550) [-1117.824] -- 0:00:33
467000 -- (-1117.631) [-1116.789] (-1119.197) (-1117.627) * (-1117.825) (-1121.063) (-1118.089) [-1119.255] -- 0:00:33
467500 -- (-1120.109) [-1119.051] (-1121.179) (-1116.460) * (-1119.286) (-1122.100) [-1117.842] (-1117.703) -- 0:00:33
468000 -- (-1118.577) (-1120.306) (-1121.715) [-1117.389] * (-1117.481) [-1120.371] (-1119.648) (-1121.159) -- 0:00:32
468500 -- (-1117.790) [-1119.127] (-1117.959) (-1119.075) * [-1121.312] (-1117.536) (-1117.680) (-1119.621) -- 0:00:32
469000 -- (-1118.697) (-1117.923) (-1117.759) [-1119.552] * (-1117.006) [-1117.964] (-1117.046) (-1120.240) -- 0:00:32
469500 -- (-1119.221) [-1117.245] (-1118.420) (-1119.128) * [-1118.320] (-1117.636) (-1117.201) (-1117.910) -- 0:00:32
470000 -- (-1118.191) (-1120.662) (-1117.707) [-1117.227] * (-1118.324) (-1120.500) (-1119.343) [-1118.350] -- 0:00:32
Average standard deviation of split frequencies: 0.012372
470500 -- [-1116.888] (-1119.603) (-1120.596) (-1117.105) * (-1118.790) (-1117.435) (-1118.348) [-1118.898] -- 0:00:32
471000 -- (-1117.697) (-1119.757) (-1118.508) [-1117.327] * [-1117.790] (-1117.090) (-1116.750) (-1122.147) -- 0:00:32
471500 -- (-1117.514) (-1116.952) (-1116.254) [-1119.229] * (-1118.666) (-1117.905) [-1118.582] (-1119.547) -- 0:00:32
472000 -- (-1120.327) (-1117.829) (-1119.146) [-1117.588] * (-1118.524) (-1117.916) [-1120.714] (-1116.673) -- 0:00:33
472500 -- [-1118.074] (-1118.926) (-1118.003) (-1119.188) * (-1118.153) (-1119.450) (-1117.929) [-1121.632] -- 0:00:33
473000 -- [-1119.181] (-1118.842) (-1116.761) (-1117.221) * (-1118.145) [-1117.811] (-1118.002) (-1120.923) -- 0:00:33
473500 -- (-1118.345) [-1118.657] (-1116.806) (-1120.059) * [-1117.168] (-1120.016) (-1118.384) (-1118.988) -- 0:00:33
474000 -- (-1117.448) [-1121.191] (-1118.922) (-1118.770) * (-1119.332) [-1117.607] (-1117.762) (-1122.486) -- 0:00:33
474500 -- (-1118.852) [-1121.228] (-1118.177) (-1118.770) * (-1121.695) [-1118.012] (-1118.701) (-1118.945) -- 0:00:33
475000 -- (-1118.198) (-1120.611) [-1118.124] (-1118.505) * (-1119.310) (-1118.469) [-1119.528] (-1118.724) -- 0:00:33
Average standard deviation of split frequencies: 0.012001
475500 -- [-1119.255] (-1118.095) (-1121.505) (-1118.848) * (-1116.453) [-1118.816] (-1117.478) (-1118.351) -- 0:00:33
476000 -- (-1118.048) (-1117.351) (-1118.825) [-1121.379] * (-1116.453) [-1117.933] (-1118.488) (-1120.034) -- 0:00:33
476500 -- (-1120.146) (-1117.379) [-1116.982] (-1121.573) * (-1118.465) (-1121.816) (-1119.307) [-1119.761] -- 0:00:32
477000 -- [-1120.585] (-1117.224) (-1117.433) (-1119.908) * (-1118.198) (-1116.286) [-1118.553] (-1117.447) -- 0:00:32
477500 -- [-1116.772] (-1118.161) (-1117.589) (-1117.333) * [-1120.221] (-1116.926) (-1120.987) (-1116.621) -- 0:00:32
478000 -- (-1117.160) (-1118.833) [-1121.350] (-1117.040) * (-1120.621) [-1117.260] (-1121.285) (-1118.119) -- 0:00:32
478500 -- (-1119.205) (-1120.799) (-1116.953) [-1117.849] * [-1116.795] (-1120.030) (-1118.787) (-1117.481) -- 0:00:32
479000 -- (-1118.426) [-1119.008] (-1118.868) (-1117.632) * (-1116.943) [-1118.467] (-1117.633) (-1119.195) -- 0:00:32
479500 -- (-1122.962) (-1118.433) (-1117.933) [-1120.385] * (-1116.748) (-1117.616) (-1117.979) [-1117.309] -- 0:00:32
480000 -- [-1120.922] (-1117.940) (-1119.190) (-1117.461) * [-1117.757] (-1118.279) (-1118.801) (-1120.483) -- 0:00:32
Average standard deviation of split frequencies: 0.012461
480500 -- (-1120.111) (-1118.716) (-1118.443) [-1118.041] * [-1120.488] (-1120.473) (-1119.273) (-1118.997) -- 0:00:32
481000 -- [-1117.630] (-1118.912) (-1117.311) (-1118.579) * (-1119.953) (-1119.670) [-1121.494] (-1119.841) -- 0:00:32
481500 -- (-1118.871) [-1116.391] (-1117.625) (-1123.515) * (-1117.959) (-1120.097) [-1119.408] (-1117.316) -- 0:00:32
482000 -- (-1116.326) [-1119.077] (-1117.418) (-1121.851) * (-1117.716) [-1117.491] (-1118.397) (-1117.022) -- 0:00:32
482500 -- (-1117.986) [-1116.987] (-1119.308) (-1120.323) * [-1117.210] (-1117.475) (-1117.612) (-1117.381) -- 0:00:32
483000 -- (-1117.280) (-1118.046) (-1119.238) [-1118.216] * (-1116.216) [-1117.083] (-1119.481) (-1122.488) -- 0:00:32
483500 -- (-1116.508) (-1120.413) (-1118.892) [-1117.606] * (-1118.851) (-1119.187) [-1118.945] (-1119.675) -- 0:00:32
484000 -- (-1116.600) (-1120.296) [-1116.463] (-1118.518) * (-1118.307) [-1117.703] (-1118.105) (-1117.544) -- 0:00:31
484500 -- (-1121.627) (-1119.459) [-1117.388] (-1121.563) * (-1118.848) [-1116.309] (-1117.159) (-1121.503) -- 0:00:31
485000 -- [-1118.318] (-1117.412) (-1118.731) (-1117.892) * (-1117.108) (-1117.574) [-1116.648] (-1121.199) -- 0:00:31
Average standard deviation of split frequencies: 0.011821
485500 -- (-1116.338) (-1116.837) (-1117.103) [-1118.714] * (-1122.434) (-1118.304) [-1118.261] (-1121.276) -- 0:00:31
486000 -- (-1117.475) (-1117.365) [-1119.086] (-1117.803) * (-1118.528) [-1116.678] (-1117.645) (-1120.688) -- 0:00:31
486500 -- (-1118.610) (-1117.100) (-1117.810) [-1123.035] * (-1117.026) (-1116.579) (-1123.250) [-1117.416] -- 0:00:31
487000 -- [-1117.348] (-1118.058) (-1123.418) (-1118.452) * (-1118.745) (-1121.242) (-1119.750) [-1118.094] -- 0:00:31
487500 -- [-1120.849] (-1118.099) (-1118.509) (-1119.415) * (-1117.038) (-1120.206) (-1123.658) [-1118.734] -- 0:00:31
488000 -- (-1117.152) (-1116.652) (-1118.383) [-1116.621] * [-1118.043] (-1121.002) (-1121.282) (-1117.384) -- 0:00:31
488500 -- (-1118.481) (-1119.685) [-1118.322] (-1118.616) * (-1118.369) (-1119.233) [-1118.069] (-1117.679) -- 0:00:32
489000 -- (-1121.912) (-1120.176) (-1117.734) [-1118.911] * (-1119.275) (-1117.440) (-1122.604) [-1117.776] -- 0:00:32
489500 -- (-1118.070) (-1118.264) [-1119.015] (-1117.043) * (-1116.905) (-1124.741) [-1119.034] (-1117.896) -- 0:00:32
490000 -- [-1119.279] (-1120.232) (-1117.994) (-1118.171) * (-1118.301) [-1117.698] (-1120.485) (-1118.579) -- 0:00:32
Average standard deviation of split frequencies: 0.012998
490500 -- (-1117.833) [-1120.141] (-1124.292) (-1118.388) * (-1119.849) [-1121.645] (-1117.830) (-1116.696) -- 0:00:32
491000 -- (-1118.169) [-1121.739] (-1118.171) (-1118.421) * (-1117.167) [-1121.149] (-1120.114) (-1116.976) -- 0:00:32
491500 -- [-1117.204] (-1119.321) (-1116.483) (-1119.302) * (-1116.809) [-1120.424] (-1116.407) (-1121.216) -- 0:00:32
492000 -- (-1119.081) (-1119.902) (-1121.430) [-1118.779] * (-1124.722) (-1120.769) (-1118.665) [-1121.603] -- 0:00:32
492500 -- (-1116.917) (-1118.381) (-1118.268) [-1116.770] * (-1118.777) (-1117.326) (-1116.426) [-1118.040] -- 0:00:31
493000 -- (-1118.457) [-1121.518] (-1118.057) (-1116.898) * (-1117.957) (-1118.112) (-1118.279) [-1116.477] -- 0:00:31
493500 -- (-1118.186) [-1121.124] (-1117.156) (-1116.833) * (-1117.572) [-1119.778] (-1121.388) (-1119.765) -- 0:00:31
494000 -- (-1119.042) [-1117.471] (-1117.951) (-1116.654) * [-1118.479] (-1122.288) (-1117.542) (-1120.370) -- 0:00:31
494500 -- (-1118.670) (-1117.126) (-1118.729) [-1118.849] * (-1119.389) [-1118.247] (-1117.481) (-1121.084) -- 0:00:31
495000 -- (-1119.246) (-1117.226) [-1116.774] (-1122.261) * (-1118.499) (-1117.640) (-1118.151) [-1118.487] -- 0:00:31
Average standard deviation of split frequencies: 0.013082
495500 -- (-1121.377) [-1117.356] (-1122.814) (-1119.518) * (-1117.322) [-1118.605] (-1119.423) (-1121.387) -- 0:00:31
496000 -- (-1121.186) (-1118.107) [-1121.237] (-1118.195) * (-1116.962) (-1118.421) (-1117.348) [-1120.613] -- 0:00:31
496500 -- (-1117.664) (-1118.002) [-1121.300] (-1118.536) * (-1117.413) [-1119.352] (-1117.832) (-1118.642) -- 0:00:31
497000 -- (-1119.876) (-1119.928) (-1119.869) [-1117.146] * (-1117.332) (-1119.141) (-1118.814) [-1119.002] -- 0:00:31
497500 -- (-1119.376) (-1117.570) (-1120.108) [-1119.287] * (-1121.030) [-1119.966] (-1118.260) (-1120.329) -- 0:00:31
498000 -- (-1119.326) (-1120.089) (-1118.199) [-1119.361] * [-1116.859] (-1117.510) (-1119.083) (-1118.857) -- 0:00:31
498500 -- (-1118.129) [-1120.439] (-1128.247) (-1117.964) * (-1118.754) (-1116.672) (-1116.783) [-1117.204] -- 0:00:31
499000 -- (-1122.526) [-1118.154] (-1122.196) (-1116.924) * [-1117.890] (-1117.115) (-1122.997) (-1117.609) -- 0:00:31
499500 -- (-1118.199) (-1118.549) (-1121.523) [-1116.518] * (-1117.392) [-1116.798] (-1121.215) (-1118.888) -- 0:00:31
500000 -- [-1121.350] (-1123.322) (-1118.676) (-1120.044) * (-1116.810) (-1117.372) (-1117.670) [-1117.627] -- 0:00:31
Average standard deviation of split frequencies: 0.012406
500500 -- [-1117.567] (-1119.217) (-1119.258) (-1121.829) * (-1116.982) (-1117.574) (-1120.168) [-1117.032] -- 0:00:30
501000 -- (-1118.904) (-1117.361) (-1118.920) [-1118.129] * (-1118.438) [-1119.038] (-1118.650) (-1118.457) -- 0:00:30
501500 -- [-1116.598] (-1117.764) (-1119.355) (-1117.073) * (-1118.986) [-1118.342] (-1117.652) (-1123.280) -- 0:00:30
502000 -- (-1116.154) (-1117.439) [-1120.884] (-1117.223) * [-1116.788] (-1119.466) (-1119.866) (-1118.720) -- 0:00:30
502500 -- (-1117.821) (-1117.439) [-1116.743] (-1117.169) * (-1119.215) (-1117.510) [-1121.591] (-1118.540) -- 0:00:30
503000 -- (-1117.563) (-1118.223) (-1118.389) [-1117.505] * (-1122.523) [-1117.695] (-1121.211) (-1118.766) -- 0:00:30
503500 -- (-1120.517) (-1118.046) (-1118.279) [-1117.695] * (-1119.406) (-1118.387) (-1118.955) [-1119.118] -- 0:00:30
504000 -- (-1120.057) (-1117.632) (-1116.785) [-1118.633] * (-1120.701) (-1119.828) [-1122.152] (-1126.034) -- 0:00:30
504500 -- (-1119.116) (-1117.211) [-1119.728] (-1119.916) * (-1117.395) (-1118.488) (-1119.802) [-1120.506] -- 0:00:31
505000 -- (-1120.891) (-1116.667) [-1120.624] (-1117.126) * (-1116.791) (-1118.632) (-1121.383) [-1117.434] -- 0:00:31
Average standard deviation of split frequencies: 0.011399
505500 -- (-1120.469) (-1123.737) [-1121.956] (-1117.988) * [-1121.214] (-1119.781) (-1119.845) (-1120.959) -- 0:00:31
506000 -- (-1117.913) [-1123.666] (-1122.476) (-1120.631) * (-1119.611) (-1120.641) (-1120.957) [-1118.034] -- 0:00:31
506500 -- (-1118.669) [-1119.983] (-1121.270) (-1117.960) * (-1119.413) [-1117.859] (-1117.368) (-1117.686) -- 0:00:31
507000 -- (-1119.314) (-1120.800) (-1118.487) [-1117.524] * (-1118.359) (-1120.705) (-1117.199) [-1117.705] -- 0:00:31
507500 -- (-1120.134) (-1120.643) (-1120.166) [-1118.828] * (-1117.183) (-1120.245) [-1118.382] (-1119.927) -- 0:00:31
508000 -- (-1116.584) [-1124.078] (-1120.372) (-1119.432) * (-1116.632) (-1120.850) [-1116.829] (-1116.328) -- 0:00:30
508500 -- [-1118.833] (-1117.620) (-1119.690) (-1120.129) * (-1119.756) (-1117.025) (-1118.324) [-1116.672] -- 0:00:30
509000 -- (-1118.758) [-1118.949] (-1120.031) (-1118.773) * [-1120.323] (-1116.925) (-1117.347) (-1117.400) -- 0:00:30
509500 -- (-1117.099) (-1119.322) [-1118.736] (-1119.361) * (-1119.567) [-1116.254] (-1121.639) (-1119.372) -- 0:00:30
510000 -- (-1121.391) (-1119.347) [-1119.496] (-1118.261) * (-1118.665) (-1116.158) [-1118.087] (-1122.515) -- 0:00:30
Average standard deviation of split frequencies: 0.011349
510500 -- (-1118.132) (-1118.228) [-1118.742] (-1122.187) * (-1120.838) (-1117.997) (-1120.747) [-1120.617] -- 0:00:30
511000 -- [-1116.953] (-1117.694) (-1118.195) (-1123.368) * [-1118.167] (-1119.582) (-1119.242) (-1118.926) -- 0:00:30
511500 -- (-1116.570) (-1119.519) (-1116.671) [-1123.795] * (-1121.626) (-1118.318) (-1119.637) [-1116.419] -- 0:00:30
512000 -- (-1116.477) (-1116.640) (-1116.833) [-1124.781] * (-1121.024) (-1117.884) (-1119.779) [-1117.276] -- 0:00:30
512500 -- (-1117.462) (-1118.343) [-1118.672] (-1119.456) * (-1118.887) (-1118.186) [-1117.302] (-1116.987) -- 0:00:30
513000 -- (-1119.445) (-1119.966) [-1118.220] (-1119.852) * (-1118.937) (-1117.562) (-1119.670) [-1116.566] -- 0:00:30
513500 -- [-1118.205] (-1118.302) (-1118.806) (-1119.645) * (-1117.591) [-1117.496] (-1118.798) (-1116.602) -- 0:00:30
514000 -- (-1118.666) (-1119.875) [-1118.798] (-1118.648) * [-1118.890] (-1117.601) (-1120.691) (-1122.563) -- 0:00:30
514500 -- (-1118.845) (-1122.702) (-1116.941) [-1118.427] * (-1117.811) (-1119.250) (-1122.057) [-1120.886] -- 0:00:30
515000 -- (-1118.521) (-1120.347) [-1118.322] (-1119.247) * [-1117.474] (-1118.511) (-1121.204) (-1117.161) -- 0:00:30
Average standard deviation of split frequencies: 0.010748
515500 -- (-1117.451) [-1119.745] (-1117.411) (-1120.652) * (-1117.718) (-1117.346) (-1117.339) [-1116.651] -- 0:00:30
516000 -- (-1118.494) (-1117.681) (-1117.359) [-1119.361] * (-1116.458) [-1117.519] (-1119.087) (-1117.466) -- 0:00:30
516500 -- (-1118.005) (-1116.701) [-1118.206] (-1117.497) * (-1119.553) (-1119.697) [-1119.341] (-1117.548) -- 0:00:29
517000 -- (-1117.803) (-1118.243) (-1119.303) [-1117.172] * [-1118.487] (-1119.024) (-1121.967) (-1117.359) -- 0:00:29
517500 -- (-1117.977) (-1116.973) (-1118.058) [-1117.178] * (-1117.167) (-1124.095) [-1120.255] (-1117.733) -- 0:00:29
518000 -- (-1119.064) [-1117.326] (-1117.693) (-1117.014) * (-1118.510) (-1121.196) (-1117.731) [-1116.711] -- 0:00:29
518500 -- (-1119.845) [-1117.062] (-1119.386) (-1117.226) * [-1119.125] (-1121.131) (-1122.804) (-1122.261) -- 0:00:29
519000 -- [-1117.805] (-1116.988) (-1123.518) (-1116.834) * (-1118.217) (-1119.140) [-1118.272] (-1117.979) -- 0:00:29
519500 -- [-1119.059] (-1119.500) (-1122.710) (-1123.443) * (-1117.524) [-1118.171] (-1116.756) (-1119.219) -- 0:00:29
520000 -- (-1117.812) (-1117.691) (-1127.023) [-1117.229] * (-1116.435) (-1117.570) [-1117.796] (-1117.875) -- 0:00:29
Average standard deviation of split frequencies: 0.011291
520500 -- (-1118.265) [-1118.811] (-1119.151) (-1119.394) * (-1118.614) [-1117.640] (-1119.711) (-1116.180) -- 0:00:29
521000 -- (-1121.439) [-1118.211] (-1119.374) (-1122.275) * (-1119.005) (-1118.051) (-1122.924) [-1117.276] -- 0:00:30
521500 -- [-1117.280] (-1118.270) (-1117.561) (-1117.777) * [-1118.780] (-1117.766) (-1121.662) (-1117.218) -- 0:00:30
522000 -- [-1121.156] (-1119.459) (-1118.352) (-1116.790) * (-1119.717) (-1120.654) [-1122.702] (-1116.613) -- 0:00:30
522500 -- [-1119.086] (-1117.745) (-1124.313) (-1117.827) * (-1117.573) (-1117.169) [-1117.604] (-1117.021) -- 0:00:30
523000 -- (-1119.133) [-1117.121] (-1117.389) (-1118.614) * [-1116.795] (-1116.703) (-1118.848) (-1119.627) -- 0:00:30
523500 -- (-1121.979) (-1122.679) [-1117.202] (-1117.691) * (-1117.865) (-1117.106) (-1119.611) [-1118.200] -- 0:00:30
524000 -- (-1119.431) [-1117.806] (-1120.438) (-1117.620) * (-1117.678) (-1116.926) (-1121.811) [-1117.858] -- 0:00:29
524500 -- (-1117.197) [-1116.715] (-1119.664) (-1119.383) * (-1124.141) [-1118.063] (-1120.938) (-1119.590) -- 0:00:29
525000 -- (-1117.813) (-1117.755) [-1117.342] (-1118.807) * (-1119.486) [-1117.127] (-1120.673) (-1118.747) -- 0:00:29
Average standard deviation of split frequencies: 0.010807
525500 -- (-1119.615) (-1118.099) [-1117.163] (-1118.374) * (-1117.642) (-1118.014) (-1120.596) [-1118.880] -- 0:00:29
526000 -- (-1116.915) [-1119.228] (-1116.734) (-1120.375) * [-1116.763] (-1118.133) (-1120.704) (-1118.049) -- 0:00:29
526500 -- (-1117.410) (-1118.272) [-1116.409] (-1116.737) * (-1117.264) (-1119.523) (-1117.348) [-1120.690] -- 0:00:29
527000 -- [-1116.291] (-1116.484) (-1116.884) (-1121.345) * (-1117.093) (-1122.879) (-1126.268) [-1117.754] -- 0:00:29
527500 -- [-1117.538] (-1117.974) (-1116.381) (-1117.104) * (-1116.940) [-1117.728] (-1127.040) (-1118.235) -- 0:00:29
528000 -- (-1118.498) (-1118.951) [-1117.493] (-1120.870) * (-1118.987) (-1120.587) (-1121.391) [-1118.235] -- 0:00:29
528500 -- (-1119.385) (-1120.822) (-1118.519) [-1120.712] * (-1122.290) (-1122.092) [-1117.509] (-1118.475) -- 0:00:29
529000 -- (-1120.766) (-1120.074) [-1118.266] (-1120.297) * (-1118.120) [-1116.268] (-1120.989) (-1123.117) -- 0:00:29
529500 -- (-1117.617) (-1120.975) [-1120.802] (-1124.501) * [-1122.641] (-1118.083) (-1120.054) (-1119.510) -- 0:00:29
530000 -- (-1116.951) (-1119.035) [-1119.053] (-1118.467) * (-1119.633) [-1117.208] (-1119.562) (-1119.764) -- 0:00:29
Average standard deviation of split frequencies: 0.010712
530500 -- (-1120.199) (-1119.299) [-1117.733] (-1116.523) * (-1118.471) [-1118.602] (-1118.031) (-1118.127) -- 0:00:29
531000 -- (-1121.038) (-1117.909) (-1118.760) [-1116.585] * (-1120.851) (-1119.250) (-1117.271) [-1117.041] -- 0:00:29
531500 -- (-1122.050) (-1117.518) (-1118.938) [-1116.798] * (-1117.426) (-1119.531) (-1117.520) [-1122.433] -- 0:00:29
532000 -- (-1117.405) (-1121.897) [-1118.958] (-1117.905) * (-1117.867) [-1117.245] (-1118.010) (-1119.228) -- 0:00:29
532500 -- (-1121.698) [-1118.096] (-1118.107) (-1122.099) * [-1116.941] (-1121.936) (-1118.120) (-1122.773) -- 0:00:28
533000 -- (-1125.909) (-1119.360) [-1117.654] (-1121.383) * [-1117.234] (-1119.508) (-1117.922) (-1120.469) -- 0:00:28
533500 -- (-1117.846) (-1129.889) (-1117.739) [-1120.879] * (-1117.892) [-1117.503] (-1119.820) (-1119.184) -- 0:00:28
534000 -- (-1119.005) (-1123.156) (-1118.288) [-1120.808] * (-1118.352) [-1118.266] (-1119.098) (-1119.040) -- 0:00:28
534500 -- (-1120.597) [-1118.341] (-1119.059) (-1119.315) * (-1117.426) [-1117.775] (-1117.725) (-1117.860) -- 0:00:28
535000 -- (-1120.237) (-1118.701) (-1119.323) [-1117.778] * (-1118.294) [-1117.948] (-1116.780) (-1118.984) -- 0:00:28
Average standard deviation of split frequencies: 0.010036
535500 -- [-1117.749] (-1119.001) (-1123.171) (-1117.952) * (-1117.828) [-1118.699] (-1121.105) (-1119.203) -- 0:00:28
536000 -- (-1116.945) (-1118.348) (-1120.340) [-1116.082] * [-1118.865] (-1117.473) (-1119.945) (-1118.503) -- 0:00:28
536500 -- (-1116.455) (-1116.603) [-1119.260] (-1119.068) * (-1118.397) [-1118.053] (-1117.538) (-1117.426) -- 0:00:28
537000 -- (-1118.727) (-1117.279) (-1117.158) [-1119.155] * (-1116.746) [-1118.147] (-1117.355) (-1118.033) -- 0:00:29
537500 -- (-1118.521) (-1118.501) (-1117.394) [-1120.467] * (-1117.111) (-1118.084) [-1116.791] (-1116.700) -- 0:00:29
538000 -- (-1120.062) [-1117.605] (-1118.110) (-1119.075) * [-1116.801] (-1116.674) (-1117.224) (-1117.627) -- 0:00:29
538500 -- (-1120.624) (-1118.407) (-1119.069) [-1117.771] * [-1119.599] (-1126.264) (-1116.262) (-1120.144) -- 0:00:29
539000 -- (-1121.100) (-1119.987) (-1117.486) [-1118.535] * [-1117.351] (-1121.397) (-1116.813) (-1117.990) -- 0:00:29
539500 -- (-1120.453) [-1119.080] (-1116.733) (-1118.282) * (-1120.089) (-1119.653) (-1118.246) [-1119.550] -- 0:00:29
540000 -- (-1117.306) [-1117.247] (-1117.219) (-1120.065) * [-1120.907] (-1116.952) (-1117.186) (-1119.162) -- 0:00:28
Average standard deviation of split frequencies: 0.010001
540500 -- (-1117.490) (-1118.309) [-1117.286] (-1120.708) * [-1117.661] (-1116.596) (-1118.070) (-1116.634) -- 0:00:28
541000 -- (-1119.750) (-1118.759) [-1119.393] (-1119.472) * (-1117.340) [-1118.222] (-1118.569) (-1117.578) -- 0:00:28
541500 -- (-1116.958) [-1118.291] (-1118.081) (-1116.785) * (-1116.484) (-1117.777) [-1121.462] (-1116.437) -- 0:00:28
542000 -- (-1122.071) (-1118.543) [-1118.027] (-1117.826) * [-1116.319] (-1122.321) (-1119.707) (-1119.246) -- 0:00:28
542500 -- (-1119.067) (-1118.922) (-1123.991) [-1117.087] * [-1116.495] (-1119.132) (-1120.029) (-1117.867) -- 0:00:28
543000 -- (-1116.790) (-1118.062) (-1118.228) [-1116.993] * (-1118.846) (-1118.823) [-1118.224] (-1118.149) -- 0:00:28
543500 -- (-1116.387) [-1117.943] (-1117.367) (-1119.640) * [-1117.476] (-1118.569) (-1118.092) (-1123.197) -- 0:00:28
544000 -- (-1120.167) (-1118.629) [-1116.794] (-1120.236) * (-1117.682) [-1116.968] (-1117.072) (-1119.774) -- 0:00:28
544500 -- (-1117.547) (-1119.747) [-1118.231] (-1121.922) * (-1118.595) [-1118.375] (-1118.066) (-1116.538) -- 0:00:28
545000 -- (-1120.151) (-1119.126) [-1119.186] (-1118.182) * (-1117.336) (-1120.922) (-1117.549) [-1119.029] -- 0:00:28
Average standard deviation of split frequencies: 0.010310
545500 -- [-1118.181] (-1117.436) (-1120.700) (-1118.427) * [-1118.195] (-1123.299) (-1118.045) (-1121.666) -- 0:00:28
546000 -- (-1118.695) (-1117.522) (-1118.505) [-1119.192] * [-1118.181] (-1119.005) (-1119.244) (-1117.857) -- 0:00:28
546500 -- (-1117.615) (-1117.819) [-1119.709] (-1122.147) * (-1119.226) (-1118.200) [-1116.861] (-1118.808) -- 0:00:28
547000 -- (-1118.553) (-1118.080) (-1118.515) [-1117.969] * [-1117.321] (-1118.601) (-1120.383) (-1120.002) -- 0:00:28
547500 -- (-1117.687) (-1118.302) (-1120.821) [-1118.167] * (-1117.338) (-1118.131) (-1117.272) [-1119.325] -- 0:00:28
548000 -- (-1120.871) [-1119.115] (-1116.917) (-1117.520) * (-1121.609) [-1117.196] (-1118.136) (-1116.551) -- 0:00:28
548500 -- [-1118.808] (-1118.497) (-1116.966) (-1117.512) * (-1122.907) [-1118.808] (-1120.961) (-1118.661) -- 0:00:27
549000 -- [-1116.818] (-1116.763) (-1116.258) (-1117.985) * [-1125.371] (-1118.059) (-1120.930) (-1120.980) -- 0:00:27
549500 -- [-1116.700] (-1118.976) (-1116.723) (-1120.951) * [-1118.643] (-1118.309) (-1120.108) (-1123.905) -- 0:00:27
550000 -- (-1116.962) (-1122.040) [-1116.570] (-1118.368) * (-1118.465) (-1118.067) (-1120.267) [-1118.573] -- 0:00:27
Average standard deviation of split frequencies: 0.010222
550500 -- (-1119.643) (-1117.031) [-1118.357] (-1118.730) * (-1118.877) (-1118.394) (-1119.034) [-1120.713] -- 0:00:27
551000 -- (-1116.651) (-1118.205) (-1117.192) [-1119.540] * (-1119.374) (-1120.532) [-1118.861] (-1118.245) -- 0:00:27
551500 -- (-1119.448) (-1116.758) (-1120.156) [-1117.439] * (-1120.036) [-1116.313] (-1117.966) (-1118.266) -- 0:00:27
552000 -- (-1118.324) [-1116.623] (-1116.305) (-1119.730) * (-1119.935) (-1119.334) [-1118.331] (-1119.177) -- 0:00:27
552500 -- (-1121.026) (-1118.094) [-1119.009] (-1116.902) * (-1117.644) [-1121.801] (-1117.383) (-1118.362) -- 0:00:27
553000 -- (-1117.778) (-1117.809) [-1117.204] (-1117.506) * (-1122.508) (-1117.718) [-1117.027] (-1118.936) -- 0:00:27
553500 -- (-1117.867) (-1119.469) [-1118.556] (-1120.042) * (-1118.132) (-1119.163) [-1117.043] (-1117.504) -- 0:00:28
554000 -- [-1118.345] (-1118.020) (-1118.156) (-1118.577) * (-1120.101) [-1117.984] (-1116.801) (-1118.698) -- 0:00:28
554500 -- (-1118.727) (-1117.111) (-1119.475) [-1119.850] * (-1116.643) [-1117.296] (-1117.414) (-1117.902) -- 0:00:28
555000 -- (-1120.819) (-1117.443) (-1116.428) [-1126.199] * [-1117.951] (-1119.628) (-1127.485) (-1118.240) -- 0:00:28
Average standard deviation of split frequencies: 0.010473
555500 -- (-1118.946) (-1118.386) [-1117.114] (-1120.299) * (-1120.432) [-1121.959] (-1119.874) (-1118.456) -- 0:00:28
556000 -- (-1120.160) (-1119.458) [-1116.843] (-1123.477) * (-1118.226) (-1118.754) (-1119.204) [-1119.046] -- 0:00:27
556500 -- (-1117.182) [-1117.834] (-1125.199) (-1117.855) * (-1117.171) [-1117.775] (-1121.160) (-1121.458) -- 0:00:27
557000 -- [-1118.322] (-1123.114) (-1127.962) (-1119.375) * [-1117.390] (-1118.105) (-1121.247) (-1121.629) -- 0:00:27
557500 -- (-1117.076) [-1121.754] (-1121.114) (-1116.569) * (-1118.170) [-1117.340] (-1118.122) (-1117.005) -- 0:00:27
558000 -- (-1117.293) (-1124.167) (-1120.999) [-1118.235] * (-1117.274) (-1118.134) [-1116.562] (-1118.317) -- 0:00:27
558500 -- [-1118.131] (-1122.265) (-1122.328) (-1117.185) * (-1117.952) [-1120.044] (-1116.609) (-1118.227) -- 0:00:27
559000 -- [-1118.049] (-1119.831) (-1118.970) (-1117.185) * (-1119.143) [-1119.156] (-1117.648) (-1119.002) -- 0:00:27
559500 -- (-1118.190) (-1116.433) (-1118.397) [-1116.498] * (-1118.145) (-1117.493) [-1117.695] (-1118.157) -- 0:00:27
560000 -- (-1118.648) (-1117.323) [-1125.735] (-1118.704) * (-1118.236) [-1117.797] (-1119.314) (-1119.292) -- 0:00:27
Average standard deviation of split frequencies: 0.010090
560500 -- (-1117.605) [-1117.606] (-1120.880) (-1117.514) * (-1117.367) (-1118.985) [-1116.699] (-1122.176) -- 0:00:27
561000 -- (-1118.240) (-1118.623) (-1120.119) [-1118.087] * (-1120.889) (-1119.623) (-1118.376) [-1117.034] -- 0:00:27
561500 -- (-1120.467) (-1118.393) [-1116.741] (-1118.115) * (-1118.696) [-1120.074] (-1116.973) (-1116.863) -- 0:00:27
562000 -- (-1118.442) (-1120.996) [-1119.025] (-1119.289) * [-1118.172] (-1118.535) (-1117.734) (-1116.752) -- 0:00:27
562500 -- [-1118.127] (-1119.188) (-1117.841) (-1117.465) * (-1117.273) [-1116.894] (-1118.478) (-1122.445) -- 0:00:27
563000 -- [-1118.858] (-1117.510) (-1119.483) (-1116.991) * (-1120.555) (-1118.717) (-1118.477) [-1119.795] -- 0:00:27
563500 -- [-1117.978] (-1117.991) (-1120.391) (-1117.031) * (-1121.872) (-1118.065) (-1118.220) [-1122.378] -- 0:00:27
564000 -- (-1121.466) [-1118.754] (-1118.910) (-1116.839) * (-1117.818) (-1117.434) [-1118.502] (-1122.264) -- 0:00:27
564500 -- [-1120.708] (-1119.378) (-1116.458) (-1120.522) * (-1117.428) [-1120.399] (-1122.705) (-1129.530) -- 0:00:27
565000 -- (-1119.803) [-1120.135] (-1116.347) (-1117.770) * (-1118.560) [-1121.909] (-1122.400) (-1118.393) -- 0:00:26
Average standard deviation of split frequencies: 0.010337
565500 -- (-1118.239) [-1118.867] (-1118.193) (-1118.828) * (-1118.676) (-1121.589) [-1117.698] (-1118.209) -- 0:00:26
566000 -- (-1118.450) (-1118.019) (-1116.595) [-1119.194] * (-1119.637) (-1123.081) [-1120.061] (-1118.932) -- 0:00:26
566500 -- (-1121.299) (-1120.547) [-1118.002] (-1120.952) * (-1119.110) (-1119.948) [-1122.093] (-1118.154) -- 0:00:26
567000 -- (-1119.131) [-1117.471] (-1120.326) (-1120.043) * (-1122.381) (-1117.616) [-1117.348] (-1116.830) -- 0:00:26
567500 -- (-1117.897) (-1116.851) (-1117.560) [-1120.377] * (-1122.143) (-1122.749) [-1118.275] (-1118.196) -- 0:00:26
568000 -- (-1120.567) (-1116.920) [-1118.187] (-1121.418) * (-1118.733) (-1117.058) (-1118.594) [-1117.803] -- 0:00:26
568500 -- (-1117.206) (-1117.074) [-1118.520] (-1118.280) * (-1120.082) (-1116.692) (-1120.592) [-1116.742] -- 0:00:26
569000 -- [-1119.954] (-1116.291) (-1117.649) (-1120.126) * [-1118.010] (-1117.089) (-1119.346) (-1118.130) -- 0:00:26
569500 -- [-1118.368] (-1119.766) (-1116.752) (-1118.232) * (-1119.466) (-1119.218) (-1117.914) [-1119.558] -- 0:00:26
570000 -- (-1118.121) (-1119.106) (-1125.756) [-1119.260] * (-1118.998) [-1117.810] (-1119.357) (-1116.847) -- 0:00:27
Average standard deviation of split frequencies: 0.010642
570500 -- [-1120.373] (-1116.857) (-1116.299) (-1121.194) * (-1120.962) (-1119.608) [-1118.984] (-1117.093) -- 0:00:27
571000 -- (-1119.427) (-1119.491) [-1116.365] (-1123.759) * (-1123.159) (-1118.672) [-1116.871] (-1119.568) -- 0:00:27
571500 -- (-1117.632) [-1119.151] (-1116.756) (-1122.438) * (-1117.726) (-1116.774) (-1116.957) [-1118.278] -- 0:00:26
572000 -- (-1117.057) (-1118.272) [-1116.533] (-1121.192) * (-1117.554) (-1117.845) (-1118.641) [-1117.928] -- 0:00:26
572500 -- (-1119.423) [-1116.940] (-1117.380) (-1121.538) * [-1119.843] (-1117.593) (-1120.247) (-1122.397) -- 0:00:26
573000 -- (-1119.785) (-1121.049) (-1118.970) [-1119.568] * [-1117.665] (-1119.802) (-1116.899) (-1119.520) -- 0:00:26
573500 -- [-1121.766] (-1119.006) (-1118.204) (-1121.278) * (-1121.949) [-1119.916] (-1119.639) (-1117.701) -- 0:00:26
574000 -- (-1118.957) (-1118.534) [-1118.211] (-1118.269) * [-1117.388] (-1120.834) (-1119.315) (-1120.603) -- 0:00:26
574500 -- [-1117.114] (-1117.637) (-1117.041) (-1116.671) * [-1118.864] (-1119.826) (-1119.749) (-1117.119) -- 0:00:26
575000 -- (-1118.973) (-1120.879) [-1116.665] (-1118.256) * (-1116.742) (-1121.750) (-1121.157) [-1120.296] -- 0:00:26
Average standard deviation of split frequencies: 0.010832
575500 -- (-1123.139) (-1117.197) [-1117.901] (-1117.452) * (-1117.167) [-1117.333] (-1120.080) (-1117.571) -- 0:00:26
576000 -- (-1117.769) (-1117.567) (-1119.884) [-1118.964] * (-1117.379) (-1119.258) (-1118.844) [-1120.157] -- 0:00:26
576500 -- (-1116.877) (-1117.653) [-1117.467] (-1118.877) * [-1116.997] (-1116.881) (-1120.116) (-1119.281) -- 0:00:26
577000 -- (-1116.807) (-1118.586) (-1117.978) [-1117.033] * (-1117.596) [-1117.126] (-1117.197) (-1117.539) -- 0:00:26
577500 -- (-1116.675) (-1118.819) (-1118.589) [-1119.511] * [-1118.844] (-1118.762) (-1117.693) (-1117.954) -- 0:00:26
578000 -- [-1117.440] (-1119.752) (-1119.548) (-1122.208) * (-1119.125) [-1117.231] (-1118.269) (-1118.678) -- 0:00:26
578500 -- (-1117.833) (-1119.852) (-1120.510) [-1120.078] * (-1123.751) (-1117.459) (-1119.608) [-1120.372] -- 0:00:26
579000 -- [-1116.877] (-1117.073) (-1118.745) (-1117.857) * (-1119.920) [-1119.261] (-1119.761) (-1116.463) -- 0:00:26
579500 -- [-1116.367] (-1118.164) (-1119.559) (-1117.316) * (-1118.732) (-1118.397) (-1119.389) [-1116.385] -- 0:00:26
580000 -- (-1116.101) (-1116.273) (-1117.681) [-1117.950] * (-1120.157) (-1122.673) [-1116.768] (-1117.368) -- 0:00:26
Average standard deviation of split frequencies: 0.010745
580500 -- (-1118.888) (-1118.232) (-1120.652) [-1120.428] * (-1121.387) (-1118.303) [-1117.778] (-1119.576) -- 0:00:26
581000 -- (-1122.262) (-1118.110) (-1118.581) [-1118.894] * (-1121.477) [-1118.977] (-1120.163) (-1121.446) -- 0:00:25
581500 -- (-1118.435) (-1118.456) (-1118.902) [-1116.768] * [-1121.379] (-1118.168) (-1117.204) (-1122.145) -- 0:00:25
582000 -- [-1117.632] (-1118.163) (-1117.370) (-1116.821) * (-1125.006) (-1118.307) [-1118.713] (-1122.631) -- 0:00:25
582500 -- (-1118.089) [-1116.437] (-1117.722) (-1121.957) * (-1125.442) [-1116.464] (-1118.074) (-1118.806) -- 0:00:25
583000 -- [-1117.476] (-1116.256) (-1117.937) (-1121.957) * (-1118.681) [-1117.816] (-1119.366) (-1119.242) -- 0:00:25
583500 -- (-1119.853) [-1117.197] (-1119.576) (-1124.339) * (-1118.299) (-1117.072) [-1116.245] (-1118.823) -- 0:00:25
584000 -- (-1117.383) (-1121.157) (-1116.591) [-1118.030] * (-1116.600) (-1117.686) (-1116.344) [-1117.589] -- 0:00:25
584500 -- (-1117.384) (-1118.050) [-1116.313] (-1120.810) * [-1117.941] (-1118.308) (-1120.348) (-1121.259) -- 0:00:25
585000 -- (-1117.025) (-1117.261) [-1117.890] (-1119.826) * (-1117.968) (-1119.403) (-1122.310) [-1118.085] -- 0:00:25
Average standard deviation of split frequencies: 0.011215
585500 -- (-1117.963) (-1118.094) [-1117.306] (-1117.569) * (-1118.406) (-1118.917) (-1117.101) [-1118.373] -- 0:00:25
586000 -- (-1119.554) [-1120.315] (-1120.119) (-1118.016) * (-1118.147) (-1116.474) [-1121.432] (-1118.279) -- 0:00:26
586500 -- (-1117.243) (-1117.829) (-1121.209) [-1117.010] * (-1117.674) [-1117.990] (-1120.363) (-1119.865) -- 0:00:26
587000 -- [-1121.506] (-1117.473) (-1117.892) (-1119.478) * [-1118.107] (-1118.737) (-1121.460) (-1116.911) -- 0:00:26
587500 -- [-1118.794] (-1119.204) (-1117.795) (-1119.824) * (-1120.808) [-1116.625] (-1116.950) (-1120.536) -- 0:00:25
588000 -- (-1117.589) (-1116.686) [-1119.410] (-1118.721) * (-1119.287) (-1122.302) (-1118.800) [-1118.940] -- 0:00:25
588500 -- (-1120.437) (-1117.882) [-1116.860] (-1116.925) * (-1120.228) (-1117.458) [-1117.142] (-1116.822) -- 0:00:25
589000 -- (-1119.823) (-1118.286) [-1120.671] (-1116.965) * (-1117.874) [-1117.264] (-1117.260) (-1119.899) -- 0:00:25
589500 -- (-1119.642) (-1117.049) (-1119.833) [-1118.617] * (-1121.488) [-1117.544] (-1117.906) (-1119.072) -- 0:00:25
590000 -- (-1118.223) (-1117.243) (-1120.927) [-1118.512] * (-1118.443) [-1119.036] (-1118.046) (-1118.497) -- 0:00:25
Average standard deviation of split frequencies: 0.010751
590500 -- [-1117.377] (-1120.102) (-1118.308) (-1119.450) * (-1121.007) (-1120.452) [-1121.293] (-1118.825) -- 0:00:25
591000 -- (-1117.378) (-1118.406) (-1118.772) [-1118.721] * [-1117.766] (-1122.157) (-1118.496) (-1117.288) -- 0:00:25
591500 -- (-1117.341) [-1120.400] (-1117.550) (-1118.771) * (-1118.539) [-1116.762] (-1117.527) (-1120.351) -- 0:00:25
592000 -- (-1117.505) (-1119.361) [-1117.758] (-1120.293) * (-1118.350) (-1117.894) (-1119.981) [-1118.313] -- 0:00:25
592500 -- (-1121.449) [-1117.762] (-1118.390) (-1119.500) * [-1117.963] (-1116.814) (-1119.644) (-1119.846) -- 0:00:25
593000 -- (-1118.205) (-1122.065) (-1119.363) [-1117.551] * [-1116.951] (-1119.789) (-1117.206) (-1117.277) -- 0:00:25
593500 -- (-1118.567) [-1119.695] (-1121.425) (-1119.336) * [-1119.771] (-1118.027) (-1117.206) (-1120.113) -- 0:00:25
594000 -- (-1124.351) (-1118.429) (-1118.813) [-1118.452] * [-1119.767] (-1118.845) (-1123.209) (-1119.764) -- 0:00:25
594500 -- (-1120.709) (-1119.684) [-1117.487] (-1120.439) * (-1119.012) (-1118.292) [-1119.961] (-1116.472) -- 0:00:25
595000 -- (-1117.199) (-1119.005) [-1118.912] (-1119.926) * (-1118.987) (-1116.665) [-1118.600] (-1119.962) -- 0:00:25
Average standard deviation of split frequencies: 0.009538
595500 -- (-1120.102) (-1118.618) (-1118.747) [-1119.502] * (-1119.707) (-1118.365) (-1119.663) [-1117.974] -- 0:00:25
596000 -- (-1118.905) [-1117.064] (-1121.324) (-1117.665) * (-1118.156) (-1117.339) (-1119.450) [-1117.367] -- 0:00:25
596500 -- (-1120.891) [-1119.299] (-1119.733) (-1120.461) * (-1118.889) (-1118.975) [-1117.910] (-1120.446) -- 0:00:25
597000 -- (-1120.826) (-1117.004) (-1118.438) [-1118.290] * (-1122.311) [-1117.708] (-1119.548) (-1120.112) -- 0:00:24
597500 -- [-1121.720] (-1118.311) (-1118.336) (-1121.747) * [-1120.009] (-1116.723) (-1120.006) (-1118.851) -- 0:00:24
598000 -- [-1120.071] (-1118.324) (-1117.284) (-1118.798) * (-1122.199) (-1117.584) (-1120.260) [-1121.729] -- 0:00:24
598500 -- (-1120.047) (-1117.869) (-1117.942) [-1116.848] * [-1119.043] (-1116.285) (-1121.248) (-1119.649) -- 0:00:24
599000 -- (-1118.926) (-1118.994) [-1118.945] (-1118.517) * [-1118.427] (-1116.613) (-1118.728) (-1121.782) -- 0:00:24
599500 -- (-1117.371) (-1119.125) (-1123.961) [-1120.676] * (-1116.295) (-1117.953) [-1117.360] (-1120.200) -- 0:00:24
600000 -- (-1120.418) [-1117.349] (-1117.952) (-1120.877) * (-1118.234) (-1118.100) [-1116.885] (-1119.349) -- 0:00:24
Average standard deviation of split frequencies: 0.009510
600500 -- [-1119.319] (-1116.452) (-1122.385) (-1119.621) * (-1117.098) (-1117.991) [-1117.443] (-1119.152) -- 0:00:24
601000 -- (-1120.832) (-1116.609) [-1119.766] (-1117.833) * (-1118.219) (-1122.874) (-1117.166) [-1116.869] -- 0:00:24
601500 -- (-1118.779) (-1119.489) (-1118.758) [-1118.170] * (-1117.872) [-1121.842] (-1118.567) (-1116.783) -- 0:00:24
602000 -- [-1117.042] (-1124.522) (-1116.424) (-1117.227) * (-1117.962) (-1117.251) [-1118.645] (-1116.685) -- 0:00:24
602500 -- [-1118.045] (-1123.095) (-1117.371) (-1116.794) * (-1119.459) (-1116.545) [-1116.742] (-1117.671) -- 0:00:25
603000 -- (-1116.228) (-1120.361) (-1116.841) [-1118.089] * (-1118.067) [-1119.163] (-1117.332) (-1118.935) -- 0:00:25
603500 -- (-1116.617) (-1120.485) [-1120.381] (-1118.058) * [-1116.567] (-1120.693) (-1123.787) (-1118.751) -- 0:00:24
604000 -- (-1117.914) (-1119.784) (-1117.787) [-1116.811] * (-1118.705) [-1120.582] (-1120.086) (-1119.116) -- 0:00:24
604500 -- (-1119.564) (-1117.192) [-1117.774] (-1119.872) * (-1117.495) (-1119.734) [-1116.865] (-1117.375) -- 0:00:24
605000 -- (-1117.523) [-1117.674] (-1121.222) (-1120.549) * (-1116.338) [-1116.366] (-1118.227) (-1117.281) -- 0:00:24
Average standard deviation of split frequencies: 0.008420
605500 -- (-1123.826) (-1119.048) (-1117.791) [-1120.075] * [-1116.381] (-1117.607) (-1117.510) (-1118.042) -- 0:00:24
606000 -- (-1118.789) (-1121.172) (-1117.461) [-1118.224] * (-1120.914) (-1119.328) [-1117.591] (-1117.800) -- 0:00:24
606500 -- (-1120.524) (-1121.737) (-1119.126) [-1117.437] * (-1117.959) (-1118.687) (-1116.933) [-1121.600] -- 0:00:24
607000 -- [-1120.155] (-1120.413) (-1120.132) (-1118.948) * (-1120.134) (-1118.175) [-1116.604] (-1119.559) -- 0:00:24
607500 -- (-1116.950) (-1122.242) (-1117.369) [-1121.062] * [-1118.143] (-1118.869) (-1118.159) (-1120.424) -- 0:00:24
608000 -- (-1117.631) (-1119.123) [-1118.582] (-1118.352) * (-1120.764) [-1117.323] (-1120.897) (-1124.236) -- 0:00:24
608500 -- (-1117.648) (-1121.223) (-1119.442) [-1118.296] * (-1119.044) [-1117.322] (-1118.641) (-1120.455) -- 0:00:24
609000 -- (-1120.970) [-1120.622] (-1118.442) (-1118.529) * (-1116.682) [-1118.499] (-1121.318) (-1117.415) -- 0:00:24
609500 -- [-1118.955] (-1119.317) (-1117.507) (-1116.902) * (-1118.080) (-1122.267) (-1119.982) [-1117.295] -- 0:00:24
610000 -- [-1118.019] (-1118.600) (-1117.801) (-1117.745) * [-1117.456] (-1118.578) (-1118.169) (-1119.291) -- 0:00:24
Average standard deviation of split frequencies: 0.008537
610500 -- (-1118.019) (-1120.824) [-1116.938] (-1116.752) * [-1118.894] (-1118.455) (-1116.975) (-1120.864) -- 0:00:24
611000 -- (-1119.546) (-1118.270) (-1119.006) [-1116.483] * (-1117.052) (-1118.436) [-1116.285] (-1119.071) -- 0:00:24
611500 -- (-1122.723) (-1117.335) (-1123.104) [-1116.541] * (-1117.344) (-1119.841) (-1120.234) [-1118.318] -- 0:00:24
612000 -- [-1121.473] (-1118.844) (-1121.942) (-1116.466) * [-1123.853] (-1117.387) (-1121.891) (-1117.116) -- 0:00:24
612500 -- (-1122.262) (-1117.302) (-1116.552) [-1117.598] * (-1120.565) (-1117.747) [-1119.721] (-1117.395) -- 0:00:24
613000 -- (-1122.320) (-1117.496) [-1118.445] (-1119.614) * (-1119.400) (-1117.575) [-1119.666] (-1117.006) -- 0:00:23
613500 -- [-1117.972] (-1122.173) (-1118.971) (-1117.381) * (-1117.015) [-1118.900] (-1117.042) (-1116.724) -- 0:00:23
614000 -- (-1116.846) (-1117.505) [-1119.864] (-1120.761) * (-1117.047) [-1118.443] (-1118.157) (-1120.517) -- 0:00:23
614500 -- (-1117.883) [-1121.260] (-1118.265) (-1118.644) * (-1117.612) (-1118.104) (-1123.060) [-1119.479] -- 0:00:23
615000 -- (-1116.728) [-1118.055] (-1117.556) (-1117.342) * (-1121.470) [-1117.386] (-1119.641) (-1118.145) -- 0:00:23
Average standard deviation of split frequencies: 0.008688
615500 -- [-1117.885] (-1117.657) (-1121.998) (-1121.114) * (-1119.170) (-1119.402) [-1117.226] (-1119.806) -- 0:00:23
616000 -- (-1121.484) (-1116.371) [-1118.816] (-1116.986) * (-1119.882) (-1120.998) [-1122.130] (-1119.425) -- 0:00:23
616500 -- (-1123.992) (-1116.984) [-1121.018] (-1117.849) * (-1117.540) [-1118.100] (-1118.796) (-1117.436) -- 0:00:23
617000 -- (-1117.785) [-1118.450] (-1121.788) (-1118.116) * (-1118.861) (-1121.393) [-1118.665] (-1119.445) -- 0:00:23
617500 -- (-1117.373) (-1118.244) [-1118.215] (-1121.368) * (-1117.713) [-1117.361] (-1117.742) (-1122.697) -- 0:00:23
618000 -- (-1117.663) (-1122.186) [-1118.672] (-1121.562) * (-1119.391) [-1117.805] (-1117.112) (-1120.442) -- 0:00:23
618500 -- (-1116.844) (-1118.001) [-1120.462] (-1118.757) * (-1119.916) (-1118.349) (-1117.526) [-1119.222] -- 0:00:23
619000 -- (-1117.964) [-1116.497] (-1120.556) (-1120.864) * (-1117.608) (-1119.594) (-1117.135) [-1119.127] -- 0:00:24
619500 -- (-1121.000) [-1117.529] (-1121.873) (-1120.450) * [-1117.900] (-1121.675) (-1116.887) (-1117.861) -- 0:00:23
620000 -- (-1119.658) (-1116.486) (-1118.205) [-1119.814] * (-1121.978) (-1122.029) (-1116.823) [-1116.760] -- 0:00:23
Average standard deviation of split frequencies: 0.008667
620500 -- (-1119.079) [-1119.284] (-1118.856) (-1118.100) * [-1121.051] (-1120.674) (-1117.581) (-1116.471) -- 0:00:23
621000 -- [-1118.679] (-1122.641) (-1118.131) (-1120.736) * (-1118.009) [-1125.714] (-1116.506) (-1117.366) -- 0:00:23
621500 -- (-1122.645) (-1123.000) (-1120.901) [-1117.948] * (-1118.158) [-1117.937] (-1117.006) (-1118.850) -- 0:00:23
622000 -- (-1117.586) (-1118.747) (-1121.074) [-1116.470] * (-1121.087) (-1117.262) (-1117.936) [-1118.852] -- 0:00:23
622500 -- [-1116.422] (-1118.008) (-1118.958) (-1118.427) * (-1117.599) (-1118.301) (-1118.944) [-1118.446] -- 0:00:23
623000 -- [-1116.949] (-1117.126) (-1117.955) (-1118.265) * (-1119.930) (-1124.239) [-1118.993] (-1118.099) -- 0:00:23
623500 -- (-1117.507) (-1117.432) (-1117.035) [-1120.056] * (-1117.673) [-1121.432] (-1121.248) (-1117.765) -- 0:00:23
624000 -- (-1117.627) (-1117.510) [-1117.300] (-1117.156) * (-1120.762) (-1118.977) (-1119.664) [-1118.909] -- 0:00:23
624500 -- [-1117.145] (-1121.973) (-1117.393) (-1119.839) * [-1117.784] (-1117.740) (-1116.647) (-1121.182) -- 0:00:23
625000 -- (-1121.204) (-1120.436) [-1121.764] (-1121.727) * (-1117.854) [-1117.702] (-1118.803) (-1118.944) -- 0:00:23
Average standard deviation of split frequencies: 0.008594
625500 -- (-1117.390) (-1118.607) (-1120.215) [-1118.578] * [-1117.465] (-1118.994) (-1120.009) (-1117.406) -- 0:00:23
626000 -- (-1121.832) (-1120.236) [-1126.818] (-1118.824) * (-1119.259) (-1119.169) (-1119.209) [-1119.714] -- 0:00:23
626500 -- [-1118.888] (-1116.910) (-1120.464) (-1122.252) * [-1118.244] (-1121.410) (-1117.774) (-1118.908) -- 0:00:23
627000 -- (-1121.402) (-1117.782) [-1118.642] (-1119.639) * [-1118.690] (-1120.070) (-1116.831) (-1118.481) -- 0:00:23
627500 -- (-1119.453) [-1119.935] (-1118.869) (-1118.741) * (-1117.115) (-1119.522) (-1122.110) [-1117.641] -- 0:00:23
628000 -- [-1118.697] (-1120.862) (-1121.191) (-1118.256) * (-1116.713) [-1122.194] (-1119.195) (-1120.942) -- 0:00:23
628500 -- (-1118.557) (-1118.038) (-1118.161) [-1119.694] * [-1116.292] (-1119.588) (-1125.372) (-1117.536) -- 0:00:23
629000 -- (-1116.426) [-1117.584] (-1119.527) (-1120.557) * (-1116.292) (-1119.259) (-1118.962) [-1117.846] -- 0:00:23
629500 -- [-1116.399] (-1117.820) (-1119.105) (-1120.090) * [-1120.432] (-1117.465) (-1122.058) (-1118.833) -- 0:00:22
630000 -- (-1118.109) (-1118.394) [-1119.809] (-1120.696) * [-1121.020] (-1116.860) (-1120.234) (-1122.300) -- 0:00:22
Average standard deviation of split frequencies: 0.008354
630500 -- [-1118.114] (-1117.688) (-1119.285) (-1119.009) * [-1117.306] (-1123.212) (-1121.407) (-1118.514) -- 0:00:22
631000 -- (-1118.489) [-1119.078] (-1118.257) (-1123.605) * [-1117.461] (-1118.556) (-1121.089) (-1119.992) -- 0:00:22
631500 -- (-1120.176) [-1119.828] (-1117.698) (-1118.892) * (-1119.667) (-1119.015) (-1122.059) [-1118.208] -- 0:00:22
632000 -- (-1116.960) (-1120.691) [-1117.230] (-1118.773) * (-1118.855) [-1119.456] (-1119.540) (-1123.292) -- 0:00:22
632500 -- (-1117.071) (-1119.687) (-1118.376) [-1117.120] * [-1122.101] (-1121.575) (-1118.616) (-1120.157) -- 0:00:22
633000 -- (-1116.449) (-1118.656) [-1119.732] (-1120.474) * (-1118.322) [-1118.454] (-1120.625) (-1118.430) -- 0:00:22
633500 -- (-1117.245) (-1118.119) [-1118.407] (-1116.971) * [-1117.500] (-1120.583) (-1118.365) (-1120.613) -- 0:00:22
634000 -- (-1116.666) [-1117.515] (-1121.988) (-1117.991) * [-1119.799] (-1118.041) (-1121.923) (-1120.058) -- 0:00:22
634500 -- (-1116.376) (-1119.740) (-1120.579) [-1117.011] * (-1116.966) [-1117.785] (-1120.887) (-1120.332) -- 0:00:22
635000 -- (-1116.329) [-1119.118] (-1119.924) (-1121.213) * [-1117.857] (-1125.555) (-1120.447) (-1120.340) -- 0:00:22
Average standard deviation of split frequencies: 0.008371
635500 -- [-1116.274] (-1117.054) (-1120.601) (-1119.684) * [-1118.708] (-1121.661) (-1117.136) (-1118.335) -- 0:00:22
636000 -- (-1117.876) [-1119.493] (-1122.479) (-1118.082) * [-1116.761] (-1121.233) (-1117.485) (-1118.780) -- 0:00:22
636500 -- [-1117.597] (-1118.389) (-1120.270) (-1120.164) * (-1118.611) [-1118.816] (-1119.366) (-1120.428) -- 0:00:22
637000 -- (-1118.844) (-1123.348) [-1119.045] (-1118.291) * (-1117.920) (-1122.058) (-1118.027) [-1122.036] -- 0:00:22
637500 -- (-1121.089) [-1119.490] (-1120.052) (-1118.822) * (-1117.234) (-1117.923) [-1116.950] (-1119.882) -- 0:00:22
638000 -- (-1117.549) [-1117.816] (-1119.001) (-1119.363) * [-1120.928] (-1120.377) (-1116.856) (-1117.389) -- 0:00:22
638500 -- (-1117.102) (-1125.065) (-1120.446) [-1119.394] * [-1117.943] (-1118.004) (-1116.602) (-1119.387) -- 0:00:22
639000 -- (-1117.268) (-1117.346) [-1119.245] (-1116.592) * (-1119.793) (-1117.725) [-1119.852] (-1119.797) -- 0:00:22
639500 -- (-1117.836) (-1121.781) [-1118.498] (-1117.881) * (-1120.810) (-1118.172) (-1119.320) [-1118.668] -- 0:00:22
640000 -- (-1118.345) (-1119.618) (-1119.484) [-1117.214] * (-1119.712) [-1118.215] (-1119.187) (-1117.424) -- 0:00:22
Average standard deviation of split frequencies: 0.008007
640500 -- (-1120.290) [-1118.724] (-1120.512) (-1117.705) * [-1117.612] (-1119.959) (-1119.111) (-1120.675) -- 0:00:22
641000 -- (-1123.920) [-1118.444] (-1118.579) (-1119.186) * [-1117.899] (-1120.135) (-1117.038) (-1118.206) -- 0:00:22
641500 -- (-1116.243) (-1117.695) (-1119.130) [-1118.868] * [-1117.139] (-1117.523) (-1123.830) (-1119.134) -- 0:00:22
642000 -- [-1116.513] (-1116.842) (-1117.852) (-1118.841) * [-1118.106] (-1121.638) (-1117.387) (-1117.998) -- 0:00:22
642500 -- [-1118.146] (-1121.106) (-1117.881) (-1119.798) * (-1117.842) [-1122.998] (-1118.528) (-1117.732) -- 0:00:22
643000 -- (-1120.402) (-1119.409) (-1117.317) [-1119.569] * [-1118.287] (-1122.695) (-1117.006) (-1118.935) -- 0:00:22
643500 -- (-1117.232) (-1118.232) (-1118.030) [-1118.797] * (-1121.769) (-1120.581) [-1117.459] (-1120.246) -- 0:00:22
644000 -- [-1116.835] (-1120.732) (-1118.809) (-1117.383) * (-1117.523) (-1118.433) (-1118.700) [-1118.754] -- 0:00:22
644500 -- [-1116.942] (-1124.025) (-1118.842) (-1118.938) * (-1117.452) [-1121.304] (-1119.780) (-1118.307) -- 0:00:22
645000 -- (-1118.768) (-1119.638) (-1118.982) [-1120.135] * (-1118.930) (-1117.897) [-1119.592] (-1121.349) -- 0:00:22
Average standard deviation of split frequencies: 0.008113
645500 -- (-1119.474) [-1120.406] (-1118.314) (-1116.973) * (-1119.638) (-1118.250) [-1120.244] (-1119.912) -- 0:00:21
646000 -- (-1118.412) (-1124.850) [-1118.146] (-1118.666) * (-1121.597) (-1118.474) (-1118.006) [-1116.354] -- 0:00:21
646500 -- [-1118.654] (-1121.448) (-1118.270) (-1116.783) * [-1120.546] (-1118.171) (-1117.141) (-1117.262) -- 0:00:21
647000 -- (-1119.220) (-1125.884) [-1118.242] (-1122.234) * [-1118.777] (-1119.645) (-1117.134) (-1121.657) -- 0:00:21
647500 -- (-1121.877) [-1117.108] (-1116.760) (-1118.183) * (-1124.766) [-1119.382] (-1120.280) (-1118.411) -- 0:00:21
648000 -- (-1120.378) (-1117.977) (-1117.861) [-1122.535] * (-1126.753) (-1120.665) (-1119.431) [-1124.645] -- 0:00:21
648500 -- [-1118.303] (-1126.132) (-1117.042) (-1118.541) * [-1119.148] (-1118.593) (-1119.531) (-1124.013) -- 0:00:21
649000 -- (-1123.626) (-1118.639) (-1119.477) [-1116.591] * (-1121.653) (-1119.095) [-1118.439] (-1119.678) -- 0:00:21
649500 -- (-1121.191) (-1119.930) [-1116.877] (-1119.191) * (-1117.202) [-1118.499] (-1117.128) (-1121.137) -- 0:00:21
650000 -- (-1119.527) (-1118.542) (-1117.447) [-1118.781] * (-1121.854) (-1120.470) [-1117.044] (-1118.319) -- 0:00:21
Average standard deviation of split frequencies: 0.008566
650500 -- (-1117.048) [-1120.287] (-1120.274) (-1118.532) * (-1117.683) [-1120.763] (-1117.004) (-1119.006) -- 0:00:21
651000 -- (-1117.473) (-1118.908) (-1117.834) [-1118.741] * [-1116.878] (-1117.863) (-1118.965) (-1124.334) -- 0:00:21
651500 -- (-1119.956) (-1120.107) [-1118.410] (-1119.291) * (-1117.534) (-1119.532) (-1118.812) [-1118.531] -- 0:00:21
652000 -- (-1117.025) (-1117.912) [-1118.009] (-1118.206) * (-1118.088) (-1117.581) (-1119.789) [-1117.073] -- 0:00:21
652500 -- (-1119.042) (-1119.511) [-1118.826] (-1120.798) * (-1117.862) (-1122.414) [-1120.117] (-1117.112) -- 0:00:21
653000 -- (-1117.427) (-1120.582) [-1118.052] (-1117.932) * [-1118.445] (-1117.688) (-1118.178) (-1117.035) -- 0:00:21
653500 -- [-1118.047] (-1119.995) (-1120.094) (-1117.981) * (-1117.022) (-1118.103) [-1116.832] (-1118.891) -- 0:00:21
654000 -- (-1117.939) (-1117.476) [-1119.172] (-1123.583) * (-1121.157) (-1118.328) [-1118.318] (-1118.565) -- 0:00:21
654500 -- (-1118.157) (-1117.406) [-1118.849] (-1123.640) * [-1120.179] (-1119.444) (-1118.526) (-1120.063) -- 0:00:21
655000 -- (-1117.736) [-1117.068] (-1122.388) (-1119.068) * (-1120.570) (-1118.899) [-1119.880] (-1118.371) -- 0:00:21
Average standard deviation of split frequencies: 0.008039
655500 -- [-1118.041] (-1118.818) (-1119.217) (-1121.090) * (-1120.503) (-1119.789) (-1117.309) [-1118.980] -- 0:00:21
656000 -- (-1117.164) (-1119.844) (-1117.290) [-1117.276] * [-1117.666] (-1120.544) (-1117.279) (-1117.731) -- 0:00:21
656500 -- (-1116.533) (-1117.816) [-1118.983] (-1119.041) * [-1122.609] (-1124.248) (-1120.286) (-1117.991) -- 0:00:21
657000 -- (-1117.439) [-1116.792] (-1118.315) (-1117.305) * [-1116.613] (-1124.943) (-1118.308) (-1116.979) -- 0:00:21
657500 -- (-1117.815) (-1118.103) (-1117.739) [-1117.037] * (-1117.153) (-1125.871) [-1119.408] (-1117.161) -- 0:00:21
658000 -- (-1116.983) (-1118.103) [-1119.418] (-1118.423) * (-1119.832) (-1125.585) (-1117.886) [-1118.628] -- 0:00:21
658500 -- (-1118.182) (-1127.344) [-1118.658] (-1118.655) * (-1118.231) (-1119.538) [-1116.780] (-1117.901) -- 0:00:21
659000 -- (-1118.639) (-1121.085) (-1118.583) [-1117.492] * (-1118.973) (-1120.893) [-1119.011] (-1119.284) -- 0:00:21
659500 -- (-1119.198) [-1123.741] (-1118.751) (-1124.861) * (-1126.617) [-1118.647] (-1117.516) (-1118.391) -- 0:00:21
660000 -- [-1117.165] (-1118.779) (-1118.659) (-1122.097) * (-1121.880) [-1118.221] (-1118.421) (-1121.375) -- 0:00:21
Average standard deviation of split frequencies: 0.007626
660500 -- (-1117.504) [-1117.622] (-1120.917) (-1117.900) * [-1119.252] (-1118.430) (-1121.492) (-1120.001) -- 0:00:21
661000 -- [-1118.462] (-1116.936) (-1119.208) (-1117.447) * (-1120.162) [-1118.854] (-1118.347) (-1118.982) -- 0:00:21
661500 -- (-1121.493) (-1117.622) (-1117.257) [-1121.103] * (-1118.005) (-1121.038) [-1119.152] (-1119.499) -- 0:00:20
662000 -- (-1123.748) [-1118.674] (-1117.331) (-1117.841) * (-1119.177) (-1118.155) (-1124.289) [-1119.050] -- 0:00:20
662500 -- (-1125.781) (-1118.538) (-1120.443) [-1117.546] * [-1117.956] (-1119.171) (-1121.119) (-1118.144) -- 0:00:20
663000 -- (-1119.036) [-1118.437] (-1117.300) (-1126.400) * (-1118.684) [-1117.148] (-1122.093) (-1117.305) -- 0:00:20
663500 -- (-1119.562) (-1118.820) [-1117.829] (-1118.579) * (-1119.084) [-1117.483] (-1119.107) (-1119.206) -- 0:00:20
664000 -- (-1119.058) (-1117.459) (-1119.231) [-1117.667] * (-1117.578) (-1118.034) [-1117.836] (-1118.596) -- 0:00:20
664500 -- (-1120.695) (-1119.191) (-1118.648) [-1118.318] * [-1118.326] (-1117.734) (-1120.888) (-1119.675) -- 0:00:20
665000 -- (-1120.226) [-1121.971] (-1118.305) (-1117.125) * (-1118.126) (-1117.290) [-1117.953] (-1118.066) -- 0:00:20
Average standard deviation of split frequencies: 0.007874
665500 -- [-1118.448] (-1119.999) (-1118.883) (-1119.101) * [-1116.834] (-1118.949) (-1116.848) (-1122.824) -- 0:00:20
666000 -- (-1120.069) [-1120.382] (-1118.882) (-1118.356) * (-1120.118) [-1119.764] (-1117.836) (-1117.973) -- 0:00:20
666500 -- [-1119.363] (-1120.173) (-1119.507) (-1120.477) * (-1118.596) (-1118.254) [-1117.655] (-1117.951) -- 0:00:20
667000 -- [-1117.486] (-1118.917) (-1119.328) (-1121.253) * (-1124.273) (-1118.049) [-1117.734] (-1116.232) -- 0:00:20
667500 -- (-1117.210) [-1118.071] (-1119.099) (-1120.343) * (-1119.771) (-1119.770) (-1120.306) [-1119.402] -- 0:00:20
668000 -- (-1117.364) (-1117.328) (-1118.209) [-1117.220] * (-1119.479) [-1118.354] (-1120.921) (-1116.959) -- 0:00:20
668500 -- (-1118.323) (-1121.161) (-1120.716) [-1119.076] * (-1118.734) (-1121.862) (-1117.390) [-1117.961] -- 0:00:20
669000 -- [-1120.833] (-1117.721) (-1121.600) (-1117.433) * (-1121.928) (-1120.270) (-1116.750) [-1119.647] -- 0:00:20
669500 -- (-1117.518) [-1119.246] (-1118.785) (-1118.606) * (-1121.341) (-1117.724) (-1117.812) [-1116.946] -- 0:00:20
670000 -- (-1116.927) [-1123.389] (-1117.230) (-1124.427) * (-1118.047) (-1119.934) [-1116.509] (-1117.891) -- 0:00:20
Average standard deviation of split frequencies: 0.007292
670500 -- (-1119.686) (-1118.045) [-1119.547] (-1126.605) * (-1118.690) (-1117.566) [-1116.822] (-1118.620) -- 0:00:20
671000 -- (-1118.226) [-1117.815] (-1118.470) (-1122.390) * (-1117.133) (-1116.711) [-1117.580] (-1116.246) -- 0:00:20
671500 -- (-1118.685) [-1117.505] (-1117.458) (-1118.482) * (-1116.991) [-1121.168] (-1118.741) (-1116.823) -- 0:00:20
672000 -- (-1118.729) (-1117.489) (-1122.709) [-1119.050] * (-1116.391) (-1119.095) [-1117.603] (-1119.489) -- 0:00:20
672500 -- (-1121.580) (-1117.795) [-1120.428] (-1122.508) * [-1116.674] (-1117.640) (-1118.920) (-1117.394) -- 0:00:20
673000 -- (-1121.645) (-1117.521) (-1117.864) [-1117.228] * (-1117.304) [-1117.218] (-1119.904) (-1117.364) -- 0:00:20
673500 -- (-1117.252) (-1117.669) (-1116.778) [-1117.223] * (-1117.010) [-1118.704] (-1119.276) (-1118.716) -- 0:00:20
674000 -- (-1118.787) [-1117.623] (-1118.556) (-1117.883) * (-1118.934) (-1119.109) (-1122.782) [-1118.814] -- 0:00:20
674500 -- (-1117.889) (-1118.317) (-1117.815) [-1122.415] * [-1117.072] (-1116.701) (-1117.339) (-1123.610) -- 0:00:20
675000 -- (-1121.577) [-1118.639] (-1120.168) (-1119.733) * (-1117.163) (-1116.639) [-1120.933] (-1122.854) -- 0:00:20
Average standard deviation of split frequencies: 0.007584
675500 -- (-1118.277) (-1117.007) (-1118.359) [-1117.926] * (-1119.024) [-1117.873] (-1117.833) (-1118.133) -- 0:00:20
676000 -- [-1121.137] (-1117.801) (-1118.016) (-1119.166) * [-1117.896] (-1118.347) (-1116.868) (-1118.578) -- 0:00:20
676500 -- (-1119.693) (-1118.219) [-1117.702] (-1120.689) * (-1119.528) [-1117.161] (-1127.056) (-1117.620) -- 0:00:20
677000 -- (-1121.741) (-1121.479) [-1119.002] (-1119.590) * (-1116.767) (-1116.832) (-1119.180) [-1117.754] -- 0:00:20
677500 -- (-1123.271) (-1118.787) (-1119.504) [-1118.312] * (-1117.552) [-1117.686] (-1116.769) (-1119.368) -- 0:00:19
678000 -- (-1116.481) (-1118.943) (-1117.708) [-1118.711] * (-1116.569) (-1116.901) (-1120.384) [-1120.386] -- 0:00:19
678500 -- (-1118.012) (-1118.937) (-1119.155) [-1117.554] * (-1121.806) (-1119.084) (-1121.707) [-1117.909] -- 0:00:19
679000 -- (-1121.126) (-1117.069) [-1118.413] (-1116.842) * [-1118.777] (-1122.388) (-1117.888) (-1118.217) -- 0:00:19
679500 -- (-1119.867) [-1116.156] (-1119.498) (-1117.858) * (-1116.813) (-1120.602) [-1117.148] (-1118.623) -- 0:00:19
680000 -- [-1117.989] (-1117.335) (-1121.126) (-1117.239) * (-1122.151) [-1117.616] (-1117.935) (-1116.639) -- 0:00:19
Average standard deviation of split frequencies: 0.008138
680500 -- (-1119.093) [-1116.577] (-1119.167) (-1116.829) * (-1119.193) [-1118.666] (-1119.045) (-1121.930) -- 0:00:19
681000 -- (-1117.073) (-1116.440) (-1117.060) [-1116.562] * (-1117.477) (-1119.404) [-1118.078] (-1123.858) -- 0:00:19
681500 -- [-1117.561] (-1118.431) (-1118.370) (-1117.659) * [-1119.876] (-1119.270) (-1116.348) (-1130.441) -- 0:00:19
682000 -- (-1117.088) (-1119.016) (-1119.040) [-1117.852] * (-1119.361) (-1119.125) [-1117.519] (-1118.580) -- 0:00:19
682500 -- (-1118.816) (-1117.352) (-1117.808) [-1116.749] * (-1119.363) [-1120.378] (-1118.083) (-1117.178) -- 0:00:19
683000 -- [-1122.406] (-1118.480) (-1117.915) (-1118.679) * (-1118.816) (-1118.245) [-1118.216] (-1118.837) -- 0:00:19
683500 -- (-1118.648) [-1118.384] (-1118.340) (-1118.926) * (-1120.980) (-1119.489) [-1118.273] (-1118.622) -- 0:00:19
684000 -- (-1116.496) (-1118.720) (-1120.930) [-1121.217] * (-1117.630) [-1121.021] (-1118.273) (-1117.437) -- 0:00:19
684500 -- (-1117.560) (-1119.253) (-1118.420) [-1118.675] * (-1118.962) (-1117.015) [-1119.289] (-1123.668) -- 0:00:19
685000 -- (-1118.808) [-1119.090] (-1118.706) (-1116.638) * (-1116.536) (-1116.972) [-1116.891] (-1123.514) -- 0:00:19
Average standard deviation of split frequencies: 0.007903
685500 -- [-1116.978] (-1116.608) (-1117.546) (-1116.730) * [-1119.548] (-1117.930) (-1119.235) (-1120.042) -- 0:00:19
686000 -- (-1125.926) (-1116.974) (-1117.922) [-1118.736] * (-1121.437) [-1120.098] (-1119.177) (-1117.965) -- 0:00:19
686500 -- (-1120.711) [-1120.224] (-1118.637) (-1116.730) * (-1117.971) (-1117.401) (-1120.063) [-1118.135] -- 0:00:19
687000 -- (-1119.000) (-1118.191) [-1117.901] (-1116.710) * [-1116.258] (-1117.865) (-1121.502) (-1121.274) -- 0:00:19
687500 -- [-1117.594] (-1116.782) (-1119.589) (-1122.228) * (-1118.233) (-1117.797) (-1119.975) [-1118.690] -- 0:00:19
688000 -- [-1120.579] (-1118.064) (-1118.149) (-1120.545) * (-1118.525) (-1118.565) [-1116.441] (-1117.223) -- 0:00:19
688500 -- (-1121.880) (-1118.365) [-1117.463] (-1118.201) * [-1119.562] (-1120.807) (-1116.907) (-1116.452) -- 0:00:19
689000 -- [-1120.337] (-1124.591) (-1119.943) (-1117.793) * (-1119.456) (-1120.493) [-1116.669] (-1116.452) -- 0:00:19
689500 -- (-1120.155) (-1122.627) (-1118.675) [-1117.246] * (-1120.662) (-1120.377) (-1116.656) [-1118.819] -- 0:00:19
690000 -- (-1116.669) [-1119.282] (-1116.989) (-1118.055) * [-1118.038] (-1118.595) (-1118.615) (-1123.310) -- 0:00:19
Average standard deviation of split frequencies: 0.007826
690500 -- (-1116.254) (-1121.476) [-1117.551] (-1120.434) * (-1118.575) (-1116.485) [-1116.837] (-1120.742) -- 0:00:19
691000 -- (-1116.634) [-1119.038] (-1117.760) (-1117.837) * (-1121.666) (-1118.792) (-1117.794) [-1118.431] -- 0:00:19
691500 -- (-1119.160) (-1119.501) (-1116.816) [-1118.058] * (-1118.136) (-1117.096) [-1118.757] (-1119.317) -- 0:00:19
692000 -- [-1119.898] (-1120.112) (-1120.535) (-1119.200) * [-1117.576] (-1116.897) (-1117.734) (-1118.252) -- 0:00:19
692500 -- (-1119.325) (-1117.139) [-1116.423] (-1117.075) * (-1118.098) (-1116.947) [-1117.734] (-1120.767) -- 0:00:19
693000 -- (-1116.469) [-1117.322] (-1116.618) (-1117.217) * (-1116.624) (-1116.529) [-1117.821] (-1117.445) -- 0:00:19
693500 -- (-1117.399) (-1117.935) (-1119.524) [-1121.261] * [-1116.398] (-1118.153) (-1119.291) (-1117.338) -- 0:00:19
694000 -- [-1116.800] (-1117.385) (-1116.797) (-1118.080) * (-1117.235) (-1117.564) (-1121.345) [-1117.629] -- 0:00:18
694500 -- (-1120.341) (-1119.247) [-1116.328] (-1117.986) * (-1118.214) [-1118.187] (-1121.913) (-1117.716) -- 0:00:18
695000 -- (-1117.994) [-1116.739] (-1119.780) (-1117.964) * (-1120.474) (-1118.087) (-1118.263) [-1120.292] -- 0:00:18
Average standard deviation of split frequencies: 0.007676
695500 -- (-1118.794) (-1119.587) (-1117.092) [-1118.435] * (-1117.981) (-1118.539) [-1121.072] (-1119.560) -- 0:00:18
696000 -- [-1119.614] (-1119.006) (-1117.882) (-1117.536) * (-1122.945) [-1117.356] (-1117.400) (-1119.829) -- 0:00:18
696500 -- (-1120.296) (-1117.129) (-1120.907) [-1116.494] * (-1116.983) (-1118.185) (-1117.676) [-1118.844] -- 0:00:18
697000 -- (-1120.161) (-1118.078) (-1119.379) [-1119.197] * (-1119.876) (-1117.721) [-1117.667] (-1120.942) -- 0:00:18
697500 -- (-1119.275) (-1117.942) [-1116.478] (-1119.003) * (-1123.761) (-1120.742) (-1117.087) [-1118.692] -- 0:00:18
698000 -- (-1119.789) (-1117.838) (-1117.020) [-1118.293] * [-1117.092] (-1119.196) (-1120.378) (-1122.791) -- 0:00:18
698500 -- [-1116.709] (-1118.558) (-1118.735) (-1120.390) * (-1117.319) [-1118.254] (-1119.418) (-1118.927) -- 0:00:18
699000 -- (-1121.774) [-1120.213] (-1116.897) (-1119.848) * (-1118.018) [-1118.160] (-1118.424) (-1120.670) -- 0:00:18
699500 -- (-1117.196) [-1118.194] (-1117.137) (-1119.795) * (-1118.789) [-1117.898] (-1118.031) (-1117.815) -- 0:00:18
700000 -- (-1118.830) (-1118.641) [-1116.744] (-1125.938) * (-1117.806) (-1116.572) [-1118.554] (-1118.805) -- 0:00:18
Average standard deviation of split frequencies: 0.008208
700500 -- [-1117.094] (-1120.101) (-1117.779) (-1126.915) * (-1116.912) [-1116.610] (-1118.872) (-1117.937) -- 0:00:18
701000 -- (-1119.123) (-1118.518) [-1117.471] (-1127.114) * [-1120.351] (-1117.652) (-1118.375) (-1117.974) -- 0:00:18
701500 -- [-1118.914] (-1116.919) (-1118.712) (-1118.491) * (-1117.263) (-1122.215) [-1120.686] (-1122.884) -- 0:00:18
702000 -- (-1117.251) [-1117.855] (-1116.934) (-1119.021) * (-1116.922) (-1117.432) [-1117.418] (-1118.869) -- 0:00:18
702500 -- (-1119.819) (-1119.414) (-1116.864) [-1118.146] * (-1116.341) [-1118.307] (-1117.343) (-1121.758) -- 0:00:18
703000 -- (-1116.584) [-1117.280] (-1118.262) (-1117.496) * (-1116.607) (-1119.116) [-1117.205] (-1118.330) -- 0:00:18
703500 -- (-1116.749) (-1117.162) (-1116.819) [-1117.748] * [-1116.560] (-1117.375) (-1116.983) (-1117.348) -- 0:00:18
704000 -- (-1117.476) (-1119.004) (-1117.178) [-1118.875] * (-1120.393) (-1116.841) [-1118.618] (-1119.435) -- 0:00:18
704500 -- (-1117.614) (-1118.749) [-1118.364] (-1120.375) * (-1117.117) (-1119.224) [-1117.699] (-1117.764) -- 0:00:18
705000 -- (-1116.764) (-1118.505) [-1119.998] (-1120.745) * [-1119.348] (-1118.343) (-1117.516) (-1120.846) -- 0:00:18
Average standard deviation of split frequencies: 0.008513
705500 -- (-1117.654) (-1119.947) (-1117.123) [-1121.454] * [-1117.901] (-1117.847) (-1118.436) (-1117.068) -- 0:00:18
706000 -- (-1116.755) (-1117.300) [-1116.369] (-1120.577) * (-1119.237) (-1119.416) [-1118.362] (-1121.219) -- 0:00:18
706500 -- (-1116.718) [-1119.547] (-1117.571) (-1119.043) * [-1118.966] (-1118.518) (-1117.218) (-1122.555) -- 0:00:18
707000 -- (-1117.541) (-1122.401) [-1117.390] (-1122.764) * [-1117.067] (-1119.943) (-1123.887) (-1121.695) -- 0:00:18
707500 -- [-1116.827] (-1118.402) (-1118.880) (-1119.903) * (-1118.859) (-1118.087) (-1123.560) [-1118.412] -- 0:00:18
708000 -- [-1117.161] (-1117.611) (-1119.109) (-1119.145) * (-1119.792) (-1119.897) (-1121.104) [-1117.790] -- 0:00:18
708500 -- [-1117.534] (-1118.356) (-1119.977) (-1117.832) * (-1119.226) (-1121.787) (-1117.984) [-1118.809] -- 0:00:18
709000 -- (-1117.275) (-1118.415) [-1119.509] (-1121.311) * (-1120.005) (-1116.774) [-1117.558] (-1116.828) -- 0:00:18
709500 -- (-1119.022) [-1118.439] (-1122.026) (-1119.054) * [-1117.521] (-1117.164) (-1123.694) (-1117.165) -- 0:00:18
710000 -- (-1121.242) (-1118.870) [-1119.545] (-1118.550) * (-1116.756) (-1116.405) [-1121.392] (-1123.848) -- 0:00:17
Average standard deviation of split frequencies: 0.007518
710500 -- (-1117.646) (-1121.266) [-1117.657] (-1117.722) * (-1118.564) (-1118.356) (-1120.687) [-1117.887] -- 0:00:17
711000 -- (-1117.690) (-1119.322) [-1122.617] (-1116.802) * (-1117.957) [-1119.470] (-1123.857) (-1117.997) -- 0:00:17
711500 -- (-1116.680) (-1119.382) (-1117.646) [-1119.164] * (-1118.104) [-1116.767] (-1118.726) (-1117.675) -- 0:00:17
712000 -- (-1116.967) (-1120.524) (-1117.862) [-1120.235] * (-1121.317) (-1119.355) (-1119.374) [-1117.974] -- 0:00:17
712500 -- (-1119.365) (-1119.181) [-1117.757] (-1121.971) * (-1118.394) (-1118.975) (-1119.145) [-1116.386] -- 0:00:17
713000 -- (-1116.686) (-1119.487) (-1121.302) [-1120.471] * (-1119.776) (-1118.189) [-1117.572] (-1119.005) -- 0:00:17
713500 -- [-1116.536] (-1116.246) (-1121.804) (-1119.364) * (-1117.555) (-1119.949) [-1117.323] (-1117.455) -- 0:00:17
714000 -- (-1117.976) [-1119.474] (-1118.524) (-1122.311) * (-1119.043) (-1120.095) (-1118.231) [-1118.474] -- 0:00:17
714500 -- (-1118.111) (-1120.062) [-1119.104] (-1121.130) * [-1120.122] (-1119.121) (-1117.809) (-1116.938) -- 0:00:17
715000 -- (-1117.645) [-1118.361] (-1121.565) (-1120.583) * [-1121.524] (-1117.275) (-1122.430) (-1117.023) -- 0:00:17
Average standard deviation of split frequencies: 0.007111
715500 -- (-1117.718) [-1117.762] (-1117.777) (-1120.464) * (-1120.790) (-1119.237) [-1117.065] (-1116.746) -- 0:00:17
716000 -- [-1118.128] (-1117.575) (-1118.756) (-1117.868) * [-1120.447] (-1120.644) (-1116.803) (-1117.366) -- 0:00:17
716500 -- (-1116.779) [-1118.405] (-1116.954) (-1116.862) * (-1119.346) (-1119.449) (-1116.769) [-1120.276] -- 0:00:17
717000 -- (-1117.322) (-1119.926) (-1117.543) [-1117.411] * (-1122.738) (-1119.353) [-1120.174] (-1119.595) -- 0:00:17
717500 -- (-1118.123) (-1119.668) [-1120.933] (-1118.529) * (-1119.755) [-1120.807] (-1121.378) (-1119.824) -- 0:00:17
718000 -- [-1116.239] (-1118.277) (-1119.172) (-1118.522) * (-1118.097) (-1117.390) (-1116.819) [-1117.830] -- 0:00:17
718500 -- [-1118.190] (-1119.579) (-1117.306) (-1121.081) * [-1117.029] (-1118.484) (-1117.623) (-1117.188) -- 0:00:17
719000 -- [-1118.607] (-1116.269) (-1119.904) (-1118.116) * (-1117.161) (-1118.847) [-1116.918] (-1117.181) -- 0:00:17
719500 -- (-1119.743) [-1117.656] (-1119.511) (-1119.886) * [-1116.663] (-1120.013) (-1117.296) (-1123.407) -- 0:00:17
720000 -- (-1120.289) [-1119.238] (-1116.917) (-1116.675) * (-1119.619) (-1117.898) [-1117.588] (-1120.558) -- 0:00:17
Average standard deviation of split frequencies: 0.006323
720500 -- (-1119.815) (-1118.609) (-1120.555) [-1120.867] * (-1118.603) (-1118.878) [-1119.545] (-1116.966) -- 0:00:17
721000 -- (-1117.122) (-1121.899) (-1119.669) [-1118.727] * [-1117.150] (-1123.075) (-1117.003) (-1117.891) -- 0:00:17
721500 -- (-1118.430) [-1116.809] (-1118.208) (-1125.791) * (-1118.409) [-1118.124] (-1117.595) (-1119.071) -- 0:00:17
722000 -- [-1118.806] (-1117.312) (-1122.728) (-1119.684) * (-1118.111) (-1117.837) [-1120.555] (-1118.703) -- 0:00:17
722500 -- (-1119.500) (-1116.791) [-1119.421] (-1120.720) * (-1117.638) (-1116.522) [-1119.364] (-1117.493) -- 0:00:17
723000 -- [-1117.203] (-1116.383) (-1117.037) (-1119.605) * (-1117.901) [-1117.532] (-1117.832) (-1117.575) -- 0:00:17
723500 -- (-1119.357) [-1117.551] (-1118.268) (-1119.069) * (-1117.967) (-1118.491) [-1117.918] (-1118.463) -- 0:00:17
724000 -- (-1119.890) (-1119.314) (-1118.065) [-1117.896] * (-1121.340) [-1117.961] (-1118.455) (-1120.829) -- 0:00:17
724500 -- (-1119.369) [-1117.515] (-1117.037) (-1120.160) * [-1117.668] (-1119.504) (-1117.192) (-1122.169) -- 0:00:17
725000 -- [-1121.190] (-1119.015) (-1116.879) (-1122.226) * (-1118.204) (-1117.318) [-1118.225] (-1118.488) -- 0:00:17
Average standard deviation of split frequencies: 0.007056
725500 -- (-1119.788) (-1118.496) [-1117.537] (-1120.427) * (-1123.744) (-1116.997) (-1122.912) [-1119.908] -- 0:00:17
726000 -- (-1120.885) [-1122.873] (-1119.547) (-1126.735) * [-1121.187] (-1116.738) (-1117.402) (-1118.521) -- 0:00:16
726500 -- (-1116.844) [-1118.346] (-1119.874) (-1128.555) * (-1122.802) (-1117.152) [-1120.023] (-1118.419) -- 0:00:16
727000 -- [-1117.480] (-1118.153) (-1119.908) (-1116.746) * (-1117.682) [-1119.773] (-1119.994) (-1121.908) -- 0:00:16
727500 -- (-1120.575) [-1122.568] (-1121.728) (-1122.131) * [-1119.580] (-1119.113) (-1121.560) (-1119.813) -- 0:00:16
728000 -- [-1116.660] (-1118.850) (-1117.617) (-1119.528) * (-1116.609) (-1122.971) (-1118.170) [-1117.299] -- 0:00:16
728500 -- [-1117.757] (-1120.012) (-1116.488) (-1118.413) * [-1120.234] (-1122.312) (-1118.822) (-1119.880) -- 0:00:16
729000 -- (-1117.744) (-1117.173) [-1116.288] (-1118.263) * (-1118.715) (-1119.791) [-1118.067] (-1117.650) -- 0:00:16
729500 -- (-1118.470) (-1119.095) (-1121.313) [-1119.035] * (-1119.299) (-1117.716) (-1116.879) [-1117.417] -- 0:00:16
730000 -- (-1120.232) [-1117.440] (-1118.829) (-1119.146) * [-1117.622] (-1118.487) (-1116.292) (-1120.706) -- 0:00:16
Average standard deviation of split frequencies: 0.007312
730500 -- [-1118.337] (-1119.702) (-1118.757) (-1117.755) * (-1119.136) [-1120.851] (-1121.189) (-1121.088) -- 0:00:16
731000 -- (-1122.242) (-1118.373) [-1116.865] (-1123.771) * (-1119.363) (-1117.903) (-1125.898) [-1119.773] -- 0:00:16
731500 -- (-1123.874) (-1117.362) [-1116.613] (-1123.711) * (-1116.223) (-1121.004) [-1121.585] (-1117.587) -- 0:00:16
732000 -- (-1118.710) [-1117.422] (-1117.282) (-1125.672) * (-1117.618) [-1120.006] (-1116.282) (-1117.613) -- 0:00:16
732500 -- (-1118.824) (-1119.493) [-1118.833] (-1117.218) * (-1118.641) (-1122.737) [-1118.657] (-1118.572) -- 0:00:16
733000 -- (-1119.567) (-1120.290) (-1118.463) [-1117.952] * [-1117.779] (-1120.807) (-1116.216) (-1118.942) -- 0:00:16
733500 -- (-1119.739) [-1121.706] (-1121.476) (-1121.657) * [-1119.445] (-1120.062) (-1116.908) (-1116.922) -- 0:00:16
734000 -- (-1120.301) (-1118.723) [-1117.348] (-1118.226) * (-1118.727) [-1118.634] (-1116.731) (-1119.039) -- 0:00:16
734500 -- [-1118.067] (-1121.450) (-1116.657) (-1119.318) * [-1119.246] (-1119.874) (-1116.717) (-1119.857) -- 0:00:16
735000 -- (-1117.997) (-1117.511) (-1121.129) [-1116.507] * (-1119.358) (-1121.531) [-1116.527] (-1121.209) -- 0:00:16
Average standard deviation of split frequencies: 0.008070
735500 -- (-1117.468) (-1118.259) [-1116.963] (-1117.067) * [-1118.253] (-1121.335) (-1117.553) (-1120.344) -- 0:00:16
736000 -- (-1117.641) (-1118.338) (-1119.300) [-1117.219] * (-1117.357) (-1121.806) [-1117.338] (-1117.585) -- 0:00:16
736500 -- (-1118.480) (-1118.305) [-1120.318] (-1122.714) * (-1117.357) [-1120.194] (-1116.956) (-1121.095) -- 0:00:16
737000 -- (-1120.331) [-1117.101] (-1119.177) (-1123.641) * (-1117.033) (-1117.732) [-1118.045] (-1118.129) -- 0:00:16
737500 -- [-1120.881] (-1119.066) (-1119.838) (-1117.998) * (-1117.156) [-1118.690] (-1119.180) (-1117.566) -- 0:00:16
738000 -- [-1118.687] (-1117.002) (-1120.443) (-1119.510) * (-1117.901) [-1117.326] (-1118.487) (-1116.211) -- 0:00:16
738500 -- (-1116.906) (-1117.672) [-1118.361] (-1120.945) * (-1118.693) (-1119.058) (-1119.613) [-1116.938] -- 0:00:16
739000 -- (-1123.762) (-1119.727) (-1118.492) [-1117.574] * (-1118.694) (-1121.755) (-1118.703) [-1117.647] -- 0:00:16
739500 -- (-1118.755) (-1119.751) (-1119.612) [-1118.099] * [-1116.733] (-1120.433) (-1118.521) (-1118.769) -- 0:00:16
740000 -- (-1117.339) [-1120.473] (-1118.488) (-1118.142) * (-1117.775) (-1118.923) (-1119.895) [-1116.722] -- 0:00:16
Average standard deviation of split frequencies: 0.007892
740500 -- [-1118.616] (-1118.400) (-1123.165) (-1126.569) * (-1116.953) [-1120.677] (-1117.907) (-1119.555) -- 0:00:16
741000 -- (-1117.470) (-1118.333) [-1119.928] (-1124.304) * (-1118.045) (-1120.098) [-1118.036] (-1118.913) -- 0:00:16
741500 -- (-1118.200) [-1118.236] (-1120.572) (-1117.234) * (-1117.426) [-1120.906] (-1122.887) (-1117.601) -- 0:00:16
742000 -- (-1118.107) [-1117.457] (-1119.431) (-1119.605) * [-1116.322] (-1119.032) (-1123.392) (-1119.553) -- 0:00:15
742500 -- (-1120.606) (-1118.735) [-1118.509] (-1119.483) * (-1117.755) (-1117.292) [-1118.085] (-1118.936) -- 0:00:15
743000 -- [-1116.891] (-1119.400) (-1119.200) (-1119.515) * [-1117.793] (-1116.287) (-1121.246) (-1120.684) -- 0:00:15
743500 -- [-1116.447] (-1122.059) (-1117.447) (-1119.813) * (-1116.973) (-1117.360) [-1118.425] (-1117.726) -- 0:00:15
744000 -- [-1119.307] (-1120.970) (-1121.333) (-1119.988) * (-1118.184) (-1118.923) (-1118.996) [-1119.327] -- 0:00:15
744500 -- (-1121.626) (-1120.536) [-1120.399] (-1117.659) * [-1117.415] (-1118.654) (-1117.673) (-1117.921) -- 0:00:15
745000 -- (-1119.650) [-1118.477] (-1120.184) (-1117.615) * (-1121.896) (-1116.880) [-1117.523] (-1118.064) -- 0:00:15
Average standard deviation of split frequencies: 0.007836
745500 -- (-1117.653) (-1120.448) [-1118.139] (-1117.198) * (-1116.338) (-1117.428) (-1118.140) [-1118.387] -- 0:00:15
746000 -- (-1122.404) (-1121.983) [-1117.983] (-1117.211) * (-1118.809) (-1118.969) [-1118.130] (-1116.978) -- 0:00:15
746500 -- (-1119.480) [-1117.612] (-1116.295) (-1117.959) * (-1125.559) (-1117.340) [-1118.078] (-1118.804) -- 0:00:15
747000 -- [-1120.851] (-1118.450) (-1117.294) (-1118.114) * (-1120.635) (-1122.654) [-1120.250] (-1118.246) -- 0:00:15
747500 -- (-1119.459) [-1120.339] (-1117.402) (-1118.331) * [-1119.965] (-1119.445) (-1117.210) (-1118.239) -- 0:00:15
748000 -- (-1117.886) (-1120.310) [-1117.662] (-1119.448) * (-1119.027) (-1117.323) (-1117.575) [-1118.761] -- 0:00:15
748500 -- (-1120.016) (-1117.657) [-1118.110] (-1120.295) * (-1118.065) [-1117.148] (-1121.276) (-1119.851) -- 0:00:15
749000 -- (-1118.213) [-1118.540] (-1118.260) (-1119.355) * [-1120.836] (-1119.513) (-1122.521) (-1118.250) -- 0:00:15
749500 -- (-1119.231) (-1119.060) (-1124.398) [-1118.900] * (-1118.964) (-1119.928) (-1119.596) [-1119.027] -- 0:00:15
750000 -- [-1118.218] (-1117.041) (-1121.090) (-1118.423) * [-1117.604] (-1118.966) (-1120.239) (-1116.967) -- 0:00:15
Average standard deviation of split frequencies: 0.007954
750500 -- (-1119.081) (-1118.885) (-1119.539) [-1118.336] * (-1118.309) (-1117.828) (-1119.981) [-1118.985] -- 0:00:15
751000 -- (-1119.232) (-1122.445) (-1118.727) [-1117.027] * (-1117.459) (-1122.107) (-1120.816) [-1119.305] -- 0:00:15
751500 -- (-1118.858) [-1118.580] (-1121.042) (-1119.381) * [-1119.464] (-1119.150) (-1119.812) (-1117.392) -- 0:00:15
752000 -- (-1120.455) [-1117.607] (-1118.159) (-1124.544) * (-1118.592) (-1119.974) [-1117.213] (-1122.081) -- 0:00:15
752500 -- (-1117.348) (-1117.798) (-1117.236) [-1118.574] * [-1118.711] (-1119.716) (-1120.776) (-1118.098) -- 0:00:15
753000 -- (-1116.573) (-1117.718) [-1116.918] (-1118.564) * (-1120.602) [-1118.333] (-1121.712) (-1117.903) -- 0:00:15
753500 -- (-1116.922) (-1121.030) (-1122.929) [-1123.054] * (-1118.736) (-1119.213) [-1117.064] (-1118.514) -- 0:00:15
754000 -- (-1117.406) (-1125.482) [-1119.528] (-1119.418) * (-1117.609) [-1119.431] (-1116.464) (-1118.115) -- 0:00:15
754500 -- [-1118.059] (-1116.866) (-1118.091) (-1118.078) * (-1116.838) (-1117.997) [-1118.321] (-1120.011) -- 0:00:15
755000 -- [-1117.621] (-1119.530) (-1117.196) (-1119.235) * (-1118.128) (-1121.425) (-1117.943) [-1121.270] -- 0:00:15
Average standard deviation of split frequencies: 0.008106
755500 -- (-1117.429) (-1119.684) [-1117.934] (-1116.999) * (-1117.877) [-1118.216] (-1117.314) (-1121.160) -- 0:00:15
756000 -- (-1118.919) [-1116.724] (-1117.374) (-1118.906) * (-1118.110) [-1118.051] (-1116.989) (-1123.883) -- 0:00:15
756500 -- [-1116.995] (-1118.436) (-1118.312) (-1117.396) * (-1118.803) (-1118.910) (-1118.231) [-1119.564] -- 0:00:15
757000 -- (-1116.728) [-1116.496] (-1117.975) (-1118.154) * (-1123.560) (-1118.881) (-1116.508) [-1120.195] -- 0:00:15
757500 -- (-1117.633) [-1120.307] (-1119.786) (-1118.668) * (-1118.509) [-1119.545] (-1119.542) (-1116.486) -- 0:00:15
758000 -- (-1118.012) [-1119.113] (-1119.801) (-1118.507) * (-1123.163) (-1122.421) [-1119.312] (-1116.625) -- 0:00:15
758500 -- (-1119.476) (-1121.463) (-1118.426) [-1121.067] * (-1118.455) (-1116.697) [-1117.495] (-1118.477) -- 0:00:14
759000 -- [-1118.098] (-1117.500) (-1120.864) (-1117.942) * (-1118.110) [-1118.952] (-1120.857) (-1118.325) -- 0:00:14
759500 -- (-1120.255) [-1118.490] (-1120.343) (-1121.510) * [-1117.967] (-1121.531) (-1117.105) (-1118.059) -- 0:00:14
760000 -- (-1116.951) (-1131.832) [-1118.836] (-1117.654) * [-1117.869] (-1118.175) (-1120.345) (-1117.009) -- 0:00:14
Average standard deviation of split frequencies: 0.007747
760500 -- (-1117.902) (-1129.846) (-1116.860) [-1116.748] * (-1118.426) [-1118.995] (-1116.965) (-1117.209) -- 0:00:14
761000 -- [-1121.074] (-1117.941) (-1116.890) (-1117.803) * (-1118.878) (-1117.501) [-1118.471] (-1116.670) -- 0:00:14
761500 -- (-1122.174) [-1119.406] (-1117.665) (-1117.786) * (-1117.218) (-1117.774) [-1118.359] (-1119.352) -- 0:00:14
762000 -- (-1120.677) [-1118.019] (-1117.133) (-1120.326) * [-1118.560] (-1118.636) (-1121.537) (-1117.633) -- 0:00:14
762500 -- (-1118.467) (-1117.057) (-1118.645) [-1117.459] * (-1118.297) (-1119.036) [-1117.456] (-1117.312) -- 0:00:14
763000 -- (-1117.949) [-1117.061] (-1118.200) (-1119.717) * (-1118.792) (-1123.151) [-1121.694] (-1116.947) -- 0:00:14
763500 -- [-1118.648] (-1121.935) (-1118.643) (-1121.032) * [-1119.222] (-1118.028) (-1118.614) (-1118.372) -- 0:00:14
764000 -- (-1117.048) [-1117.025] (-1118.018) (-1120.949) * (-1118.677) (-1122.842) (-1118.681) [-1120.077] -- 0:00:14
764500 -- (-1120.842) (-1120.535) (-1117.741) [-1118.721] * [-1116.676] (-1118.474) (-1118.360) (-1117.921) -- 0:00:14
765000 -- [-1119.498] (-1120.834) (-1120.442) (-1120.724) * [-1116.410] (-1118.911) (-1119.918) (-1118.933) -- 0:00:14
Average standard deviation of split frequencies: 0.007077
765500 -- (-1118.920) (-1120.561) (-1118.181) [-1124.136] * (-1116.994) (-1117.495) [-1118.063] (-1119.079) -- 0:00:14
766000 -- [-1117.553] (-1116.307) (-1118.905) (-1117.865) * [-1117.474] (-1117.739) (-1117.297) (-1116.621) -- 0:00:14
766500 -- (-1118.823) [-1117.271] (-1120.186) (-1118.217) * (-1116.726) [-1118.891] (-1119.506) (-1117.541) -- 0:00:14
767000 -- (-1123.150) [-1117.036] (-1122.206) (-1116.901) * (-1119.367) (-1119.046) (-1121.232) [-1117.530] -- 0:00:14
767500 -- [-1120.373] (-1117.597) (-1117.359) (-1120.283) * (-1117.779) [-1120.342] (-1121.331) (-1118.111) -- 0:00:14
768000 -- [-1118.671] (-1117.748) (-1117.161) (-1121.501) * [-1119.088] (-1116.844) (-1118.348) (-1118.686) -- 0:00:14
768500 -- [-1118.761] (-1119.128) (-1122.749) (-1121.386) * (-1118.238) (-1122.518) [-1118.069] (-1119.841) -- 0:00:14
769000 -- (-1119.403) (-1117.678) [-1116.879] (-1119.302) * (-1122.390) (-1119.743) (-1117.061) [-1118.668] -- 0:00:14
769500 -- (-1118.490) (-1117.400) [-1118.302] (-1118.740) * (-1117.250) (-1120.743) [-1118.685] (-1122.065) -- 0:00:14
770000 -- (-1122.472) (-1118.185) (-1117.334) [-1117.115] * (-1122.393) [-1119.949] (-1117.620) (-1119.664) -- 0:00:14
Average standard deviation of split frequencies: 0.007585
770500 -- (-1119.226) (-1119.466) (-1117.501) [-1118.221] * (-1119.913) (-1119.201) (-1118.689) [-1116.628] -- 0:00:14
771000 -- [-1116.703] (-1123.128) (-1118.669) (-1117.698) * (-1120.361) [-1118.595] (-1116.894) (-1116.810) -- 0:00:14
771500 -- [-1121.033] (-1119.660) (-1119.001) (-1118.903) * (-1120.449) [-1118.221] (-1119.943) (-1120.737) -- 0:00:14
772000 -- (-1118.228) [-1118.727] (-1117.312) (-1118.323) * (-1120.309) (-1119.418) [-1119.136] (-1117.200) -- 0:00:14
772500 -- [-1118.088] (-1119.230) (-1117.253) (-1117.200) * [-1117.078] (-1123.614) (-1120.829) (-1117.593) -- 0:00:14
773000 -- (-1118.846) [-1119.194] (-1121.653) (-1119.756) * [-1116.191] (-1118.035) (-1117.860) (-1118.105) -- 0:00:14
773500 -- (-1119.090) [-1116.623] (-1119.790) (-1119.176) * [-1116.494] (-1118.697) (-1122.025) (-1119.307) -- 0:00:14
774000 -- (-1123.174) (-1119.633) (-1120.196) [-1117.962] * (-1117.343) [-1118.947] (-1118.373) (-1124.034) -- 0:00:14
774500 -- (-1123.068) (-1118.572) (-1117.452) [-1118.237] * [-1119.697] (-1117.102) (-1120.497) (-1124.043) -- 0:00:13
775000 -- (-1118.397) (-1120.851) [-1118.918] (-1117.486) * (-1118.516) (-1118.192) (-1118.688) [-1120.525] -- 0:00:13
Average standard deviation of split frequencies: 0.007654
775500 -- (-1117.213) [-1116.906] (-1120.803) (-1117.819) * (-1118.998) (-1117.978) [-1120.005] (-1120.644) -- 0:00:13
776000 -- (-1119.217) (-1129.104) (-1120.483) [-1117.767] * [-1117.216] (-1117.654) (-1120.437) (-1117.323) -- 0:00:13
776500 -- (-1117.483) [-1119.492] (-1121.792) (-1118.221) * (-1116.603) [-1117.268] (-1117.777) (-1118.737) -- 0:00:13
777000 -- [-1118.189] (-1121.604) (-1119.851) (-1117.798) * (-1116.558) (-1117.600) [-1117.383] (-1121.104) -- 0:00:13
777500 -- (-1119.557) (-1117.162) (-1117.255) [-1117.800] * (-1117.257) (-1121.252) (-1117.385) [-1121.396] -- 0:00:13
778000 -- (-1121.672) [-1119.451] (-1118.045) (-1122.168) * (-1118.374) [-1119.923] (-1118.051) (-1118.765) -- 0:00:13
778500 -- (-1119.133) [-1117.801] (-1118.233) (-1119.955) * (-1117.917) (-1118.504) (-1119.061) [-1121.399] -- 0:00:13
779000 -- (-1120.647) [-1118.172] (-1121.552) (-1116.959) * [-1116.730] (-1117.692) (-1118.804) (-1122.261) -- 0:00:13
779500 -- (-1118.571) [-1117.186] (-1121.123) (-1124.030) * (-1120.590) [-1117.536] (-1120.539) (-1119.624) -- 0:00:13
780000 -- [-1118.589] (-1119.036) (-1120.329) (-1119.773) * (-1118.683) (-1129.161) [-1120.838] (-1119.372) -- 0:00:13
Average standard deviation of split frequencies: 0.006844
780500 -- (-1117.556) (-1116.764) (-1122.615) [-1119.029] * (-1117.223) (-1117.942) (-1118.154) [-1117.992] -- 0:00:13
781000 -- (-1120.005) (-1117.123) (-1116.963) [-1118.627] * [-1117.271] (-1120.318) (-1122.851) (-1117.516) -- 0:00:13
781500 -- (-1117.356) [-1116.923] (-1116.738) (-1120.090) * (-1117.054) [-1116.442] (-1118.906) (-1121.691) -- 0:00:13
782000 -- (-1120.102) [-1117.172] (-1116.722) (-1120.370) * (-1117.520) (-1116.600) [-1120.923] (-1117.126) -- 0:00:13
782500 -- [-1118.233] (-1117.701) (-1116.997) (-1116.901) * (-1118.278) (-1118.174) [-1118.253] (-1120.225) -- 0:00:13
783000 -- (-1118.241) (-1120.483) (-1116.988) [-1119.008] * (-1116.171) [-1117.138] (-1118.146) (-1121.517) -- 0:00:13
783500 -- (-1119.108) [-1117.713] (-1118.923) (-1117.886) * (-1116.584) (-1118.018) (-1119.022) [-1118.171] -- 0:00:13
784000 -- [-1117.817] (-1117.433) (-1118.157) (-1117.916) * [-1118.648] (-1118.679) (-1118.630) (-1116.720) -- 0:00:13
784500 -- (-1116.801) (-1126.094) [-1118.977] (-1117.690) * [-1118.107] (-1119.355) (-1120.289) (-1119.472) -- 0:00:13
785000 -- [-1117.335] (-1119.960) (-1117.868) (-1119.912) * (-1118.056) (-1117.259) (-1123.192) [-1120.026] -- 0:00:13
Average standard deviation of split frequencies: 0.007157
785500 -- (-1119.418) (-1117.970) (-1118.064) [-1116.998] * (-1117.839) (-1118.203) (-1117.279) [-1119.728] -- 0:00:13
786000 -- [-1118.526] (-1119.908) (-1121.577) (-1119.025) * (-1120.089) [-1118.380] (-1118.090) (-1120.789) -- 0:00:13
786500 -- [-1119.307] (-1118.145) (-1120.207) (-1120.163) * [-1121.388] (-1119.455) (-1116.835) (-1121.545) -- 0:00:13
787000 -- (-1119.214) (-1118.879) (-1122.570) [-1119.248] * [-1119.296] (-1118.434) (-1121.116) (-1120.665) -- 0:00:13
787500 -- [-1117.347] (-1118.699) (-1121.088) (-1119.251) * [-1119.684] (-1119.037) (-1121.869) (-1117.700) -- 0:00:13
788000 -- (-1122.619) (-1117.029) [-1116.990] (-1118.419) * (-1117.330) [-1117.077] (-1120.536) (-1117.191) -- 0:00:13
788500 -- (-1120.890) (-1119.387) (-1119.131) [-1118.625] * (-1117.736) (-1118.279) [-1118.679] (-1117.137) -- 0:00:13
789000 -- (-1120.481) (-1119.632) [-1119.932] (-1117.602) * [-1116.771] (-1121.629) (-1116.493) (-1117.652) -- 0:00:13
789500 -- (-1119.712) (-1118.639) (-1118.621) [-1116.232] * [-1117.488] (-1120.238) (-1117.137) (-1122.135) -- 0:00:13
790000 -- (-1118.395) (-1120.411) (-1116.899) [-1123.379] * (-1117.007) (-1118.746) [-1116.666] (-1119.608) -- 0:00:13
Average standard deviation of split frequencies: 0.006916
790500 -- (-1121.012) (-1119.804) (-1120.605) [-1118.693] * (-1116.371) (-1117.433) [-1116.659] (-1119.712) -- 0:00:12
791000 -- [-1116.844] (-1119.714) (-1118.066) (-1121.762) * (-1120.884) (-1118.726) [-1116.604] (-1117.446) -- 0:00:12
791500 -- (-1117.635) [-1119.045] (-1116.774) (-1116.754) * (-1117.638) [-1116.518] (-1118.261) (-1118.052) -- 0:00:12
792000 -- (-1118.558) (-1118.976) [-1117.072] (-1118.246) * (-1120.547) [-1119.804] (-1118.887) (-1117.818) -- 0:00:12
792500 -- (-1120.072) (-1119.082) (-1120.912) [-1116.986] * (-1118.391) (-1117.980) (-1117.656) [-1117.367] -- 0:00:12
793000 -- (-1122.311) (-1119.232) (-1118.230) [-1118.145] * [-1120.299] (-1118.006) (-1119.613) (-1117.080) -- 0:00:12
793500 -- (-1122.744) (-1121.092) (-1118.283) [-1119.093] * (-1121.784) [-1121.054] (-1120.855) (-1118.762) -- 0:00:12
794000 -- (-1126.483) (-1119.562) (-1119.445) [-1120.424] * (-1120.804) [-1118.054] (-1117.503) (-1118.926) -- 0:00:12
794500 -- (-1117.965) (-1119.027) [-1118.668] (-1119.628) * [-1119.630] (-1117.270) (-1116.974) (-1118.154) -- 0:00:12
795000 -- (-1118.341) (-1119.108) [-1118.540] (-1117.814) * (-1118.517) (-1118.487) [-1116.399] (-1118.261) -- 0:00:12
Average standard deviation of split frequencies: 0.007225
795500 -- (-1118.899) [-1118.101] (-1116.996) (-1116.500) * (-1120.144) [-1119.750] (-1117.711) (-1118.532) -- 0:00:12
796000 -- [-1117.280] (-1117.693) (-1118.784) (-1119.034) * (-1118.649) (-1119.200) [-1120.607] (-1116.765) -- 0:00:12
796500 -- (-1118.426) (-1118.436) (-1118.291) [-1119.955] * [-1117.552] (-1120.148) (-1119.410) (-1120.912) -- 0:00:12
797000 -- [-1117.247] (-1120.349) (-1121.456) (-1119.243) * [-1117.717] (-1122.155) (-1121.049) (-1116.954) -- 0:00:12
797500 -- (-1118.511) (-1116.952) [-1118.834] (-1118.610) * [-1119.433] (-1118.209) (-1119.705) (-1118.031) -- 0:00:12
798000 -- (-1118.094) (-1119.693) (-1119.688) [-1121.312] * (-1119.018) (-1117.842) [-1120.686] (-1118.031) -- 0:00:12
798500 -- (-1119.439) (-1118.752) (-1117.990) [-1117.047] * [-1119.085] (-1118.774) (-1118.903) (-1117.639) -- 0:00:12
799000 -- [-1118.373] (-1116.577) (-1117.594) (-1121.216) * (-1119.095) (-1116.681) (-1119.903) [-1119.506] -- 0:00:12
799500 -- (-1118.154) (-1119.145) [-1119.245] (-1119.455) * (-1116.963) [-1117.946] (-1116.990) (-1120.734) -- 0:00:12
800000 -- (-1117.573) (-1117.155) [-1116.511] (-1117.232) * (-1117.586) [-1117.959] (-1116.391) (-1126.746) -- 0:00:12
Average standard deviation of split frequencies: 0.007104
800500 -- [-1116.862] (-1120.001) (-1118.404) (-1119.365) * (-1124.346) [-1117.967] (-1117.796) (-1123.343) -- 0:00:12
801000 -- [-1117.035] (-1119.085) (-1118.777) (-1122.538) * (-1120.466) [-1119.396] (-1118.227) (-1122.471) -- 0:00:12
801500 -- (-1117.713) [-1118.635] (-1117.971) (-1118.014) * (-1121.876) [-1118.559] (-1120.439) (-1122.580) -- 0:00:12
802000 -- (-1118.372) (-1117.276) (-1119.621) [-1118.903] * (-1117.672) (-1128.723) [-1118.495] (-1118.447) -- 0:00:12
802500 -- [-1117.196] (-1117.534) (-1117.721) (-1120.177) * (-1119.030) [-1117.768] (-1116.838) (-1122.554) -- 0:00:12
803000 -- [-1120.079] (-1119.539) (-1117.206) (-1121.920) * (-1120.414) (-1118.741) [-1116.962] (-1117.859) -- 0:00:12
803500 -- (-1117.770) (-1118.152) (-1118.253) [-1119.061] * (-1117.805) (-1121.578) [-1120.345] (-1117.467) -- 0:00:12
804000 -- (-1120.067) (-1116.860) (-1118.010) [-1118.482] * (-1117.447) [-1120.116] (-1121.056) (-1118.440) -- 0:00:12
804500 -- (-1117.425) (-1123.606) [-1117.081] (-1121.104) * (-1116.962) (-1118.041) [-1117.493] (-1117.924) -- 0:00:12
805000 -- (-1119.592) (-1117.292) (-1116.834) [-1117.455] * (-1116.699) (-1117.106) (-1120.471) [-1116.690] -- 0:00:12
Average standard deviation of split frequencies: 0.006901
805500 -- (-1118.658) (-1118.341) (-1117.336) [-1117.290] * [-1120.546] (-1121.092) (-1121.501) (-1118.141) -- 0:00:12
806000 -- (-1118.637) (-1119.212) [-1122.923] (-1119.556) * [-1120.296] (-1125.549) (-1119.012) (-1117.087) -- 0:00:12
806500 -- (-1117.494) (-1119.854) [-1118.240] (-1117.846) * [-1118.019] (-1118.769) (-1117.359) (-1116.396) -- 0:00:11
807000 -- (-1120.078) (-1117.534) [-1118.494] (-1118.095) * (-1118.777) (-1119.181) [-1118.098] (-1116.757) -- 0:00:11
807500 -- [-1118.285] (-1116.892) (-1119.504) (-1117.962) * [-1117.813] (-1117.804) (-1117.912) (-1119.853) -- 0:00:11
808000 -- [-1118.048] (-1117.982) (-1119.676) (-1118.508) * (-1116.313) [-1118.243] (-1118.501) (-1122.813) -- 0:00:11
808500 -- (-1120.915) (-1122.733) (-1119.117) [-1121.180] * (-1118.740) [-1117.503] (-1117.521) (-1118.362) -- 0:00:11
809000 -- [-1119.315] (-1117.093) (-1116.883) (-1118.422) * [-1118.260] (-1117.592) (-1118.052) (-1118.616) -- 0:00:11
809500 -- (-1120.422) [-1117.633] (-1122.269) (-1118.219) * (-1118.784) (-1118.328) [-1118.570] (-1117.053) -- 0:00:11
810000 -- (-1120.488) (-1119.855) (-1118.729) [-1116.499] * [-1117.555] (-1117.158) (-1117.574) (-1122.164) -- 0:00:11
Average standard deviation of split frequencies: 0.007327
810500 -- [-1122.292] (-1120.693) (-1119.086) (-1119.762) * (-1118.808) (-1117.563) (-1118.182) [-1116.917] -- 0:00:11
811000 -- (-1119.584) (-1120.036) (-1116.732) [-1116.728] * (-1119.608) (-1116.858) (-1118.724) [-1116.935] -- 0:00:11
811500 -- (-1118.733) (-1116.587) [-1117.455] (-1122.381) * (-1123.385) (-1119.658) [-1117.396] (-1117.097) -- 0:00:11
812000 -- (-1117.380) (-1120.505) [-1117.352] (-1120.324) * (-1116.987) (-1117.416) (-1120.212) [-1119.585] -- 0:00:11
812500 -- (-1118.444) (-1117.453) [-1117.164] (-1117.772) * (-1125.764) (-1117.366) [-1118.481] (-1120.368) -- 0:00:11
813000 -- [-1119.223] (-1117.460) (-1120.409) (-1117.496) * (-1120.867) (-1118.049) [-1117.096] (-1121.104) -- 0:00:11
813500 -- (-1118.574) (-1119.714) (-1119.197) [-1117.691] * (-1120.631) (-1117.034) (-1120.221) [-1116.409] -- 0:00:11
814000 -- [-1119.903] (-1119.915) (-1118.322) (-1118.556) * (-1116.962) (-1122.187) [-1119.290] (-1116.711) -- 0:00:11
814500 -- (-1123.182) (-1117.527) [-1117.777] (-1119.108) * [-1116.918] (-1119.048) (-1119.949) (-1123.016) -- 0:00:11
815000 -- [-1121.176] (-1116.462) (-1118.772) (-1118.464) * (-1116.316) (-1120.122) [-1117.865] (-1124.715) -- 0:00:11
Average standard deviation of split frequencies: 0.007780
815500 -- (-1118.386) (-1119.276) [-1117.494] (-1120.250) * (-1117.970) [-1120.168] (-1118.051) (-1123.047) -- 0:00:11
816000 -- (-1118.203) (-1119.452) (-1121.430) [-1118.581] * (-1119.550) (-1117.002) (-1117.346) [-1125.663] -- 0:00:11
816500 -- [-1117.259] (-1122.284) (-1116.987) (-1119.057) * [-1123.301] (-1116.813) (-1117.564) (-1120.434) -- 0:00:11
817000 -- (-1117.023) (-1118.517) (-1118.714) [-1116.949] * (-1119.764) (-1120.120) [-1117.833] (-1120.628) -- 0:00:11
817500 -- (-1118.688) (-1116.693) [-1118.685] (-1119.033) * [-1119.384] (-1116.806) (-1121.678) (-1120.530) -- 0:00:11
818000 -- (-1117.324) [-1116.655] (-1119.601) (-1119.726) * (-1117.343) (-1117.132) (-1120.422) [-1116.930] -- 0:00:11
818500 -- [-1117.480] (-1117.362) (-1116.272) (-1117.997) * (-1117.700) (-1118.327) [-1117.437] (-1116.494) -- 0:00:11
819000 -- (-1118.228) (-1117.151) (-1120.496) [-1116.931] * [-1118.058] (-1121.689) (-1117.283) (-1118.992) -- 0:00:11
819500 -- (-1120.451) (-1121.577) (-1117.720) [-1118.658] * (-1122.878) [-1117.671] (-1116.724) (-1119.079) -- 0:00:11
820000 -- (-1118.059) (-1121.144) [-1119.220] (-1119.133) * [-1116.866] (-1117.447) (-1116.423) (-1116.575) -- 0:00:11
Average standard deviation of split frequencies: 0.007506
820500 -- (-1122.350) (-1118.208) (-1121.413) [-1117.206] * [-1116.956] (-1117.732) (-1117.252) (-1116.198) -- 0:00:11
821000 -- (-1123.380) [-1122.455] (-1118.419) (-1117.340) * [-1116.979] (-1118.354) (-1118.931) (-1118.857) -- 0:00:11
821500 -- (-1119.814) [-1121.416] (-1116.851) (-1116.385) * (-1119.894) (-1117.823) (-1120.515) [-1118.308] -- 0:00:11
822000 -- (-1118.791) (-1121.465) [-1116.720] (-1118.060) * (-1120.016) [-1116.870] (-1121.811) (-1116.940) -- 0:00:11
822500 -- [-1118.175] (-1118.162) (-1117.700) (-1116.612) * (-1118.450) (-1117.446) [-1119.699] (-1116.426) -- 0:00:11
823000 -- (-1119.344) (-1117.208) [-1118.794] (-1116.873) * (-1117.477) (-1117.214) (-1117.097) [-1117.493] -- 0:00:10
823500 -- (-1118.110) [-1117.185] (-1117.653) (-1120.026) * (-1117.562) (-1120.847) [-1116.748] (-1117.534) -- 0:00:10
824000 -- [-1118.005] (-1118.799) (-1117.327) (-1117.040) * (-1117.737) (-1119.516) (-1119.414) [-1118.627] -- 0:00:10
824500 -- [-1119.883] (-1118.237) (-1117.991) (-1117.244) * (-1118.001) [-1118.162] (-1118.443) (-1117.881) -- 0:00:10
825000 -- [-1118.189] (-1117.403) (-1120.164) (-1121.323) * (-1117.150) [-1116.892] (-1117.084) (-1117.726) -- 0:00:10
Average standard deviation of split frequencies: 0.007495
825500 -- (-1117.109) (-1118.667) [-1119.800] (-1117.182) * (-1123.456) (-1117.992) (-1118.034) [-1121.917] -- 0:00:10
826000 -- (-1119.875) [-1118.538] (-1117.551) (-1122.954) * (-1118.492) [-1118.880] (-1117.847) (-1118.958) -- 0:00:10
826500 -- [-1117.051] (-1116.684) (-1117.203) (-1119.004) * (-1117.553) (-1118.509) (-1116.937) [-1116.977] -- 0:00:10
827000 -- (-1117.948) (-1117.299) [-1117.591] (-1118.464) * [-1118.632] (-1117.838) (-1117.575) (-1119.391) -- 0:00:10
827500 -- (-1116.763) (-1117.330) (-1120.841) [-1117.063] * (-1117.358) [-1120.591] (-1118.372) (-1117.912) -- 0:00:10
828000 -- (-1117.532) (-1117.998) [-1119.418] (-1119.966) * (-1118.377) (-1119.829) [-1118.921] (-1117.026) -- 0:00:10
828500 -- (-1123.700) [-1119.667] (-1116.435) (-1118.018) * [-1118.245] (-1120.688) (-1120.679) (-1117.611) -- 0:00:10
829000 -- (-1118.693) (-1119.100) [-1117.227] (-1116.180) * [-1116.848] (-1117.243) (-1118.486) (-1117.997) -- 0:00:10
829500 -- (-1116.909) (-1118.672) (-1118.757) [-1116.360] * (-1117.480) [-1118.275] (-1117.821) (-1117.675) -- 0:00:10
830000 -- (-1117.090) (-1120.047) [-1118.222] (-1116.811) * (-1120.638) [-1117.278] (-1117.754) (-1118.171) -- 0:00:10
Average standard deviation of split frequencies: 0.007794
830500 -- (-1117.463) (-1124.812) [-1119.439] (-1118.378) * (-1118.845) (-1118.055) (-1121.079) [-1118.444] -- 0:00:10
831000 -- (-1117.180) [-1116.886] (-1118.587) (-1116.597) * [-1117.963] (-1118.793) (-1117.479) (-1121.872) -- 0:00:10
831500 -- (-1119.508) [-1117.216] (-1119.793) (-1116.581) * [-1117.312] (-1117.281) (-1118.142) (-1120.022) -- 0:00:10
832000 -- (-1118.469) [-1118.519] (-1121.376) (-1117.209) * (-1128.151) (-1122.327) (-1118.396) [-1118.408] -- 0:00:10
832500 -- (-1117.468) (-1120.646) [-1118.955] (-1122.212) * (-1120.239) (-1118.403) (-1117.977) [-1118.378] -- 0:00:10
833000 -- (-1118.233) (-1116.924) (-1117.708) [-1118.642] * (-1117.804) (-1116.781) [-1117.536] (-1118.444) -- 0:00:10
833500 -- (-1118.152) (-1118.816) [-1118.828] (-1119.391) * (-1118.172) (-1121.517) [-1120.774] (-1119.093) -- 0:00:10
834000 -- (-1117.559) [-1118.507] (-1119.553) (-1124.182) * (-1118.109) [-1119.056] (-1119.398) (-1118.768) -- 0:00:10
834500 -- (-1118.333) (-1120.949) (-1116.958) [-1120.801] * (-1120.047) (-1119.810) (-1120.294) [-1117.897] -- 0:00:10
835000 -- (-1117.776) [-1117.189] (-1118.765) (-1116.843) * [-1119.970] (-1124.194) (-1121.419) (-1116.955) -- 0:00:10
Average standard deviation of split frequencies: 0.007819
835500 -- (-1120.870) (-1117.789) [-1116.705] (-1117.657) * (-1118.625) (-1119.133) (-1119.977) [-1117.291] -- 0:00:10
836000 -- (-1121.414) [-1117.919] (-1117.154) (-1118.109) * [-1119.258] (-1118.250) (-1120.306) (-1120.729) -- 0:00:10
836500 -- [-1120.723] (-1118.744) (-1119.617) (-1117.126) * (-1116.967) (-1118.854) (-1117.551) [-1118.899] -- 0:00:10
837000 -- (-1118.488) (-1123.810) [-1117.138] (-1121.613) * (-1116.368) (-1118.853) [-1117.236] (-1120.218) -- 0:00:10
837500 -- (-1118.662) (-1121.119) [-1119.747] (-1121.352) * (-1118.108) (-1118.578) [-1117.908] (-1121.311) -- 0:00:10
838000 -- (-1120.093) (-1117.529) [-1117.009] (-1118.787) * (-1118.680) (-1116.980) [-1117.081] (-1117.382) -- 0:00:10
838500 -- (-1119.784) (-1119.018) [-1118.071] (-1119.389) * [-1121.822] (-1117.683) (-1121.955) (-1120.530) -- 0:00:10
839000 -- [-1120.196] (-1119.073) (-1118.654) (-1119.149) * (-1118.349) (-1117.403) (-1119.884) [-1122.941] -- 0:00:09
839500 -- [-1121.205] (-1116.838) (-1119.205) (-1118.696) * (-1117.716) (-1118.246) [-1116.990] (-1117.144) -- 0:00:09
840000 -- (-1125.980) (-1117.363) (-1118.956) [-1117.811] * (-1119.610) (-1119.026) [-1116.761] (-1117.661) -- 0:00:09
Average standard deviation of split frequencies: 0.007851
840500 -- (-1120.280) (-1117.554) [-1120.966] (-1119.163) * (-1118.672) (-1119.631) (-1116.935) [-1117.476] -- 0:00:09
841000 -- (-1123.480) [-1116.872] (-1119.500) (-1119.439) * (-1118.818) (-1120.720) [-1116.882] (-1118.438) -- 0:00:09
841500 -- (-1121.813) (-1118.376) [-1117.503] (-1119.987) * (-1116.428) (-1119.106) (-1116.291) [-1120.076] -- 0:00:09
842000 -- (-1118.877) (-1117.390) [-1118.723] (-1120.414) * (-1118.125) (-1117.478) [-1118.218] (-1118.106) -- 0:00:09
842500 -- (-1120.294) [-1116.552] (-1119.658) (-1121.034) * [-1118.959] (-1118.386) (-1118.479) (-1118.560) -- 0:00:09
843000 -- (-1124.399) [-1116.551] (-1117.664) (-1119.240) * [-1120.245] (-1119.890) (-1117.935) (-1119.748) -- 0:00:09
843500 -- (-1119.563) (-1119.628) (-1117.601) [-1119.541] * [-1120.525] (-1120.726) (-1118.276) (-1118.007) -- 0:00:09
844000 -- (-1116.809) (-1121.562) [-1117.093] (-1117.823) * [-1118.347] (-1123.380) (-1116.851) (-1118.230) -- 0:00:09
844500 -- (-1118.252) (-1117.255) [-1116.580] (-1117.603) * (-1119.456) (-1121.454) [-1116.973] (-1119.327) -- 0:00:09
845000 -- [-1122.685] (-1118.942) (-1117.859) (-1118.055) * (-1120.044) (-1123.671) (-1116.448) [-1119.555] -- 0:00:09
Average standard deviation of split frequencies: 0.008581
845500 -- [-1119.795] (-1117.820) (-1120.112) (-1119.360) * (-1117.887) [-1117.865] (-1121.108) (-1117.335) -- 0:00:09
846000 -- (-1119.225) (-1118.202) (-1120.362) [-1118.611] * (-1121.571) [-1118.124] (-1120.899) (-1120.083) -- 0:00:09
846500 -- [-1118.803] (-1117.344) (-1120.634) (-1118.273) * (-1120.221) [-1118.909] (-1121.788) (-1118.033) -- 0:00:09
847000 -- (-1117.683) [-1117.731] (-1117.971) (-1120.782) * (-1118.897) (-1119.205) (-1118.012) [-1118.657] -- 0:00:09
847500 -- (-1118.636) (-1118.511) [-1116.750] (-1116.510) * (-1118.942) (-1119.546) [-1118.382] (-1118.001) -- 0:00:09
848000 -- (-1120.968) [-1116.678] (-1117.424) (-1124.626) * (-1117.622) (-1119.052) [-1119.099] (-1118.803) -- 0:00:09
848500 -- [-1118.221] (-1116.613) (-1121.648) (-1122.849) * (-1119.173) [-1119.268] (-1117.535) (-1119.747) -- 0:00:09
849000 -- (-1117.001) [-1117.356] (-1117.747) (-1121.599) * [-1120.628] (-1117.453) (-1118.958) (-1117.800) -- 0:00:09
849500 -- (-1117.037) (-1119.237) (-1118.355) [-1118.738] * [-1118.703] (-1118.906) (-1117.505) (-1120.764) -- 0:00:09
850000 -- [-1117.523] (-1118.799) (-1118.199) (-1119.204) * (-1117.880) (-1123.255) (-1117.728) [-1117.076] -- 0:00:09
Average standard deviation of split frequencies: 0.008275
850500 -- (-1121.087) (-1120.601) (-1120.740) [-1116.819] * [-1117.944] (-1122.469) (-1117.055) (-1120.081) -- 0:00:09
851000 -- (-1119.869) [-1118.270] (-1118.256) (-1120.290) * (-1118.801) [-1120.488] (-1116.708) (-1122.233) -- 0:00:09
851500 -- (-1118.999) (-1117.295) (-1118.953) [-1116.705] * (-1118.257) (-1122.382) (-1118.629) [-1119.500] -- 0:00:09
852000 -- [-1118.690] (-1119.515) (-1118.304) (-1120.425) * (-1118.827) [-1116.559] (-1118.917) (-1121.798) -- 0:00:09
852500 -- (-1121.397) (-1118.386) (-1118.354) [-1119.220] * (-1117.982) [-1117.605] (-1117.123) (-1120.357) -- 0:00:09
853000 -- (-1118.920) [-1118.631] (-1118.794) (-1118.299) * (-1118.538) (-1117.023) (-1119.515) [-1119.371] -- 0:00:09
853500 -- [-1116.375] (-1117.552) (-1117.340) (-1118.334) * (-1118.460) [-1117.181] (-1119.141) (-1121.029) -- 0:00:09
854000 -- [-1116.332] (-1118.598) (-1118.138) (-1124.968) * (-1121.334) [-1117.225] (-1127.147) (-1120.536) -- 0:00:09
854500 -- (-1121.817) (-1123.567) [-1121.430] (-1121.707) * [-1118.041] (-1120.442) (-1118.867) (-1117.716) -- 0:00:09
855000 -- [-1117.499] (-1119.218) (-1120.234) (-1119.349) * (-1124.380) (-1120.644) [-1120.340] (-1120.975) -- 0:00:08
Average standard deviation of split frequencies: 0.007967
855500 -- (-1116.359) (-1121.730) [-1116.779] (-1121.910) * (-1123.959) (-1119.568) (-1120.549) [-1118.411] -- 0:00:08
856000 -- [-1116.445] (-1119.710) (-1117.015) (-1120.147) * (-1123.324) (-1120.213) [-1117.878] (-1119.016) -- 0:00:08
856500 -- (-1116.246) (-1118.277) [-1118.561] (-1118.255) * (-1116.786) [-1124.995] (-1117.638) (-1120.902) -- 0:00:08
857000 -- (-1121.131) [-1120.519] (-1129.144) (-1123.400) * (-1120.107) [-1120.155] (-1118.113) (-1119.539) -- 0:00:08
857500 -- [-1117.853] (-1116.997) (-1117.456) (-1121.313) * (-1117.376) (-1118.785) [-1123.717] (-1118.641) -- 0:00:08
858000 -- (-1117.967) (-1117.215) [-1116.686] (-1123.858) * (-1119.156) (-1119.045) (-1117.488) [-1118.699] -- 0:00:08
858500 -- (-1117.537) (-1120.004) [-1117.123] (-1119.119) * (-1119.184) (-1118.928) [-1120.532] (-1118.377) -- 0:00:08
859000 -- [-1117.300] (-1123.115) (-1117.139) (-1120.163) * [-1121.141] (-1123.161) (-1119.427) (-1119.122) -- 0:00:08
859500 -- (-1117.228) (-1122.003) (-1119.558) [-1118.190] * (-1117.746) [-1116.598] (-1123.601) (-1119.762) -- 0:00:08
860000 -- (-1118.312) (-1117.678) [-1119.283] (-1118.009) * (-1120.161) (-1118.775) (-1117.682) [-1118.844] -- 0:00:08
Average standard deviation of split frequencies: 0.007997
860500 -- (-1117.145) [-1116.982] (-1123.168) (-1118.124) * [-1117.787] (-1116.718) (-1126.793) (-1117.893) -- 0:00:08
861000 -- [-1118.670] (-1117.117) (-1122.643) (-1122.707) * [-1118.369] (-1118.116) (-1119.787) (-1118.858) -- 0:00:08
861500 -- (-1117.984) (-1119.711) [-1119.436] (-1119.891) * (-1117.940) [-1119.277] (-1121.078) (-1118.838) -- 0:00:08
862000 -- [-1119.407] (-1117.392) (-1116.721) (-1116.774) * (-1118.269) (-1124.818) (-1116.621) [-1118.139] -- 0:00:08
862500 -- (-1118.207) (-1116.993) (-1117.200) [-1121.551] * (-1117.839) [-1118.162] (-1126.294) (-1117.499) -- 0:00:08
863000 -- [-1116.520] (-1118.260) (-1118.776) (-1117.923) * (-1119.361) (-1118.405) (-1122.424) [-1118.483] -- 0:00:08
863500 -- (-1116.489) (-1120.430) (-1120.058) [-1119.389] * (-1119.822) [-1118.067] (-1120.296) (-1119.010) -- 0:00:08
864000 -- (-1118.552) (-1118.156) (-1120.578) [-1118.299] * (-1120.996) [-1116.579] (-1119.448) (-1118.466) -- 0:00:08
864500 -- (-1118.239) [-1119.321] (-1118.684) (-1119.613) * [-1118.666] (-1116.517) (-1121.217) (-1117.781) -- 0:00:08
865000 -- (-1123.244) (-1118.893) (-1116.957) [-1120.507] * (-1124.016) (-1117.069) (-1118.317) [-1117.113] -- 0:00:08
Average standard deviation of split frequencies: 0.007839
865500 -- (-1117.672) [-1117.377] (-1120.272) (-1118.971) * (-1117.964) (-1117.053) [-1117.658] (-1116.802) -- 0:00:08
866000 -- (-1123.259) [-1120.458] (-1122.247) (-1118.549) * (-1118.777) (-1123.023) (-1117.799) [-1116.823] -- 0:00:08
866500 -- [-1123.323] (-1119.599) (-1119.966) (-1121.292) * (-1117.343) [-1116.909] (-1120.149) (-1117.103) -- 0:00:08
867000 -- (-1125.625) (-1120.546) (-1124.736) [-1121.650] * [-1117.573] (-1117.036) (-1121.885) (-1120.154) -- 0:00:08
867500 -- (-1120.776) (-1119.708) (-1122.091) [-1123.264] * (-1117.558) (-1116.759) [-1119.056] (-1119.369) -- 0:00:08
868000 -- (-1120.928) (-1120.645) [-1117.148] (-1125.541) * (-1117.914) (-1121.086) [-1122.433] (-1119.322) -- 0:00:08
868500 -- (-1117.815) [-1119.175] (-1116.943) (-1118.899) * (-1117.067) (-1121.706) [-1116.533] (-1121.644) -- 0:00:08
869000 -- (-1118.649) [-1119.741] (-1118.053) (-1118.172) * (-1119.022) (-1119.997) [-1116.927] (-1121.024) -- 0:00:08
869500 -- (-1118.564) (-1117.197) [-1121.618] (-1122.625) * [-1118.917] (-1120.588) (-1118.293) (-1120.262) -- 0:00:08
870000 -- [-1119.903] (-1119.530) (-1122.794) (-1117.969) * (-1119.599) (-1116.806) [-1117.721] (-1119.832) -- 0:00:08
Average standard deviation of split frequencies: 0.007905
870500 -- [-1117.235] (-1118.943) (-1118.365) (-1119.302) * (-1118.829) (-1116.438) [-1116.951] (-1120.204) -- 0:00:08
871000 -- (-1120.258) [-1120.054] (-1117.666) (-1117.793) * [-1118.717] (-1120.281) (-1121.041) (-1117.051) -- 0:00:07
871500 -- (-1119.367) (-1118.792) (-1117.680) [-1118.074] * (-1118.474) [-1119.919] (-1119.405) (-1118.378) -- 0:00:07
872000 -- (-1118.127) [-1118.275] (-1118.000) (-1119.745) * (-1122.898) [-1118.535] (-1120.974) (-1121.779) -- 0:00:07
872500 -- (-1121.299) (-1119.353) [-1116.893] (-1121.916) * (-1119.561) [-1120.624] (-1117.132) (-1121.229) -- 0:00:07
873000 -- (-1118.532) (-1119.974) [-1116.884] (-1119.984) * [-1119.282] (-1120.864) (-1117.095) (-1119.509) -- 0:00:07
873500 -- [-1117.933] (-1119.916) (-1117.674) (-1120.077) * (-1119.989) (-1117.713) [-1120.008] (-1117.497) -- 0:00:07
874000 -- (-1119.221) (-1121.666) [-1119.627] (-1119.262) * (-1118.619) (-1119.902) [-1117.706] (-1121.386) -- 0:00:07
874500 -- (-1117.973) (-1117.031) (-1119.864) [-1118.122] * (-1119.472) (-1120.911) [-1117.857] (-1118.978) -- 0:00:07
875000 -- (-1116.925) [-1119.149] (-1116.722) (-1117.489) * (-1121.194) (-1119.615) (-1117.573) [-1117.433] -- 0:00:07
Average standard deviation of split frequencies: 0.007606
875500 -- (-1120.584) (-1123.573) [-1121.985] (-1117.647) * (-1118.579) (-1118.259) [-1119.846] (-1121.167) -- 0:00:07
876000 -- (-1117.534) (-1120.659) (-1119.877) [-1117.363] * [-1117.938] (-1119.637) (-1120.542) (-1120.534) -- 0:00:07
876500 -- [-1118.256] (-1118.760) (-1118.799) (-1117.094) * (-1118.314) (-1119.269) (-1117.945) [-1121.555] -- 0:00:07
877000 -- (-1119.167) (-1118.100) (-1117.980) [-1116.993] * (-1117.550) (-1117.259) [-1121.365] (-1125.047) -- 0:00:07
877500 -- (-1118.622) [-1117.208] (-1119.043) (-1119.443) * (-1118.590) (-1121.171) [-1118.092] (-1119.984) -- 0:00:07
878000 -- (-1119.943) (-1117.175) [-1121.675] (-1121.941) * (-1118.093) [-1117.831] (-1117.497) (-1118.104) -- 0:00:07
878500 -- (-1119.518) (-1120.717) (-1116.521) [-1121.711] * (-1118.011) (-1118.479) [-1118.305] (-1118.181) -- 0:00:07
879000 -- (-1117.067) [-1119.930] (-1118.768) (-1121.866) * [-1116.874] (-1119.156) (-1118.554) (-1119.056) -- 0:00:07
879500 -- [-1118.818] (-1118.819) (-1117.840) (-1120.903) * (-1122.493) (-1120.175) [-1118.738] (-1122.220) -- 0:00:07
880000 -- (-1121.653) (-1121.503) [-1117.137] (-1121.529) * (-1121.290) (-1123.406) [-1121.827] (-1117.832) -- 0:00:07
Average standard deviation of split frequencies: 0.007672
880500 -- [-1118.027] (-1118.981) (-1118.329) (-1118.646) * [-1117.401] (-1116.809) (-1122.451) (-1118.338) -- 0:00:07
881000 -- (-1116.955) (-1117.683) (-1118.394) [-1118.164] * (-1118.497) (-1118.659) (-1120.804) [-1117.237] -- 0:00:07
881500 -- (-1117.723) (-1120.171) (-1119.844) [-1117.473] * (-1122.459) (-1118.616) (-1121.077) [-1119.181] -- 0:00:07
882000 -- (-1120.202) [-1122.261] (-1120.088) (-1118.369) * (-1119.214) [-1116.844] (-1117.537) (-1116.709) -- 0:00:07
882500 -- (-1119.661) [-1121.128] (-1117.323) (-1118.298) * (-1119.146) (-1118.109) (-1118.368) [-1117.609] -- 0:00:07
883000 -- (-1120.202) (-1122.917) (-1117.562) [-1117.478] * (-1118.941) [-1119.838] (-1118.145) (-1119.327) -- 0:00:07
883500 -- (-1118.396) (-1121.377) [-1119.839] (-1117.585) * (-1120.095) [-1118.444] (-1119.062) (-1123.018) -- 0:00:07
884000 -- (-1117.886) (-1117.534) (-1117.205) [-1119.592] * (-1120.014) (-1116.756) [-1122.065] (-1117.947) -- 0:00:07
884500 -- (-1120.645) (-1118.320) [-1117.284] (-1120.001) * (-1122.446) (-1117.262) (-1118.340) [-1116.846] -- 0:00:07
885000 -- [-1119.436] (-1117.301) (-1118.023) (-1117.626) * (-1120.408) (-1118.313) [-1116.948] (-1117.713) -- 0:00:07
Average standard deviation of split frequencies: 0.007662
885500 -- (-1120.144) (-1117.729) (-1119.507) [-1117.245] * (-1119.339) [-1120.824] (-1118.096) (-1117.442) -- 0:00:07
886000 -- [-1118.521] (-1121.303) (-1118.904) (-1117.353) * (-1122.504) [-1117.504] (-1119.702) (-1119.896) -- 0:00:07
886500 -- (-1118.015) (-1116.344) (-1118.968) [-1119.051] * [-1117.153] (-1119.117) (-1118.341) (-1118.518) -- 0:00:07
887000 -- (-1118.213) (-1117.842) (-1122.999) [-1118.581] * (-1123.195) [-1118.574] (-1117.948) (-1120.195) -- 0:00:07
887500 -- [-1117.939] (-1119.214) (-1123.033) (-1119.187) * (-1117.065) (-1118.417) [-1117.432] (-1116.597) -- 0:00:06
888000 -- (-1118.879) [-1117.823] (-1123.121) (-1117.039) * (-1119.744) (-1118.365) (-1116.579) [-1116.472] -- 0:00:06
888500 -- (-1118.915) [-1120.360] (-1118.433) (-1118.396) * (-1118.868) (-1118.149) [-1117.188] (-1120.051) -- 0:00:06
889000 -- (-1119.371) [-1117.879] (-1119.506) (-1117.902) * [-1117.623] (-1118.049) (-1118.788) (-1120.690) -- 0:00:06
889500 -- [-1117.797] (-1121.626) (-1118.239) (-1117.328) * (-1126.103) (-1120.453) [-1120.760] (-1121.772) -- 0:00:06
890000 -- (-1117.718) (-1118.449) (-1122.466) [-1117.346] * [-1118.192] (-1124.579) (-1119.510) (-1119.354) -- 0:00:06
Average standard deviation of split frequencies: 0.007622
890500 -- (-1118.408) [-1116.823] (-1122.800) (-1117.308) * [-1118.745] (-1118.022) (-1119.177) (-1117.524) -- 0:00:06
891000 -- [-1117.362] (-1117.264) (-1120.966) (-1118.023) * [-1120.577] (-1119.159) (-1117.195) (-1117.493) -- 0:00:06
891500 -- (-1117.493) (-1118.485) (-1118.293) [-1117.933] * (-1119.959) [-1116.699] (-1118.541) (-1118.948) -- 0:00:06
892000 -- (-1118.333) [-1120.054] (-1121.351) (-1120.593) * [-1121.245] (-1117.193) (-1117.024) (-1119.003) -- 0:00:06
892500 -- (-1119.989) (-1118.385) (-1122.408) [-1117.476] * (-1122.476) [-1118.558] (-1117.506) (-1118.404) -- 0:00:06
893000 -- [-1117.440] (-1118.789) (-1119.155) (-1117.327) * (-1119.592) (-1117.469) [-1119.519] (-1117.309) -- 0:00:06
893500 -- [-1118.172] (-1117.540) (-1117.150) (-1117.474) * [-1117.064] (-1117.913) (-1117.353) (-1119.412) -- 0:00:06
894000 -- (-1121.161) (-1121.075) [-1118.290] (-1121.436) * [-1117.281] (-1119.509) (-1117.261) (-1120.185) -- 0:00:06
894500 -- (-1117.826) (-1116.936) (-1120.293) [-1117.165] * (-1116.831) [-1121.720] (-1118.110) (-1120.383) -- 0:00:06
895000 -- (-1120.224) (-1118.181) (-1117.963) [-1119.018] * (-1117.363) (-1116.891) [-1119.674] (-1117.832) -- 0:00:06
Average standard deviation of split frequencies: 0.007822
895500 -- (-1118.164) (-1117.395) [-1116.726] (-1117.754) * (-1120.295) (-1117.231) (-1118.287) [-1117.192] -- 0:00:06
896000 -- (-1122.207) (-1121.031) (-1116.801) [-1118.930] * (-1117.797) (-1120.634) [-1117.762] (-1119.440) -- 0:00:06
896500 -- (-1122.139) [-1119.153] (-1118.474) (-1121.289) * (-1117.218) (-1119.198) [-1117.704] (-1117.555) -- 0:00:06
897000 -- (-1116.939) (-1121.337) [-1119.471] (-1119.959) * (-1127.469) (-1117.179) [-1116.447] (-1118.496) -- 0:00:06
897500 -- (-1117.379) (-1121.064) (-1120.652) [-1117.246] * (-1118.884) (-1120.401) (-1116.825) [-1117.746] -- 0:00:06
898000 -- (-1120.895) (-1118.545) [-1117.740] (-1119.952) * [-1121.339] (-1118.561) (-1117.852) (-1118.108) -- 0:00:06
898500 -- (-1119.758) (-1123.682) [-1118.260] (-1119.011) * (-1117.885) (-1118.860) (-1118.950) [-1118.106] -- 0:00:06
899000 -- [-1120.868] (-1124.887) (-1117.483) (-1118.085) * (-1119.102) (-1116.307) (-1117.950) [-1118.396] -- 0:00:06
899500 -- [-1120.024] (-1117.895) (-1117.185) (-1118.923) * (-1117.491) [-1117.844] (-1117.061) (-1118.622) -- 0:00:06
900000 -- [-1117.210] (-1117.834) (-1119.227) (-1120.550) * (-1117.769) (-1121.864) [-1119.525] (-1119.007) -- 0:00:06
Average standard deviation of split frequencies: 0.007781
900500 -- (-1117.071) (-1120.177) (-1119.158) [-1116.919] * (-1118.809) [-1117.123] (-1118.886) (-1116.411) -- 0:00:06
901000 -- (-1121.247) (-1119.362) [-1117.061] (-1120.056) * (-1116.851) (-1118.250) [-1121.097] (-1117.321) -- 0:00:06
901500 -- (-1117.865) [-1118.242] (-1122.320) (-1117.570) * (-1117.963) (-1117.710) (-1119.007) [-1121.906] -- 0:00:06
902000 -- [-1118.104] (-1119.521) (-1118.809) (-1123.970) * (-1119.790) (-1118.115) (-1121.068) [-1118.927] -- 0:00:06
902500 -- (-1117.705) (-1119.893) [-1119.297] (-1120.658) * (-1117.642) (-1117.132) [-1117.662] (-1119.355) -- 0:00:06
903000 -- [-1118.580] (-1119.526) (-1120.025) (-1120.088) * (-1119.739) (-1117.562) [-1116.775] (-1118.795) -- 0:00:06
903500 -- [-1117.499] (-1118.417) (-1119.247) (-1118.153) * (-1118.957) (-1117.491) (-1117.163) [-1118.726] -- 0:00:05
904000 -- [-1125.242] (-1120.529) (-1117.624) (-1117.968) * (-1116.939) (-1117.884) [-1121.273] (-1121.377) -- 0:00:05
904500 -- [-1122.087] (-1119.011) (-1117.917) (-1117.689) * (-1122.077) (-1118.414) [-1118.333] (-1119.250) -- 0:00:05
905000 -- (-1119.203) [-1118.251] (-1121.223) (-1119.777) * [-1120.413] (-1117.707) (-1124.900) (-1118.237) -- 0:00:05
Average standard deviation of split frequencies: 0.007597
905500 -- (-1118.303) (-1117.802) [-1116.587] (-1123.754) * (-1117.147) (-1120.753) (-1117.708) [-1117.560] -- 0:00:05
906000 -- (-1117.121) (-1119.801) [-1117.316] (-1116.836) * (-1117.627) [-1121.526] (-1118.276) (-1117.818) -- 0:00:05
906500 -- (-1119.034) (-1121.142) [-1117.047] (-1117.038) * (-1118.364) [-1117.669] (-1117.009) (-1117.391) -- 0:00:05
907000 -- (-1117.980) (-1117.240) [-1117.465] (-1117.595) * (-1117.496) (-1119.010) [-1118.437] (-1119.952) -- 0:00:05
907500 -- [-1117.448] (-1117.289) (-1120.370) (-1118.191) * (-1118.508) [-1121.510] (-1118.934) (-1121.205) -- 0:00:05
908000 -- [-1119.109] (-1116.902) (-1116.986) (-1117.102) * [-1117.769] (-1118.577) (-1120.280) (-1123.109) -- 0:00:05
908500 -- (-1120.323) [-1117.590] (-1119.455) (-1117.687) * (-1119.868) [-1118.474] (-1124.287) (-1116.227) -- 0:00:05
909000 -- (-1117.075) [-1117.530] (-1119.078) (-1116.895) * (-1118.777) [-1118.205] (-1117.394) (-1117.245) -- 0:00:05
909500 -- [-1116.598] (-1116.887) (-1121.249) (-1120.519) * (-1120.036) (-1118.911) (-1120.150) [-1118.293] -- 0:00:05
910000 -- (-1124.954) [-1117.081] (-1118.708) (-1123.727) * (-1121.427) [-1120.873] (-1116.799) (-1119.800) -- 0:00:05
Average standard deviation of split frequencies: 0.007661
910500 -- (-1118.479) (-1120.209) (-1120.094) [-1117.141] * [-1118.485] (-1118.639) (-1117.997) (-1121.280) -- 0:00:05
911000 -- [-1118.738] (-1119.534) (-1117.895) (-1119.214) * [-1117.711] (-1116.669) (-1118.283) (-1118.209) -- 0:00:05
911500 -- [-1117.666] (-1117.840) (-1117.180) (-1116.946) * [-1118.152] (-1117.247) (-1117.661) (-1118.055) -- 0:00:05
912000 -- (-1116.881) (-1117.742) (-1119.707) [-1119.254] * (-1119.156) [-1117.908] (-1119.558) (-1120.305) -- 0:00:05
912500 -- (-1117.176) (-1117.717) (-1118.992) [-1117.781] * (-1117.021) [-1117.577] (-1118.426) (-1118.674) -- 0:00:05
913000 -- [-1119.586] (-1120.696) (-1118.491) (-1123.135) * (-1118.520) (-1117.943) [-1117.783] (-1124.899) -- 0:00:05
913500 -- [-1118.145] (-1118.470) (-1122.138) (-1123.448) * (-1118.454) [-1117.289] (-1119.698) (-1122.221) -- 0:00:05
914000 -- (-1118.449) (-1118.647) (-1116.719) [-1118.059] * (-1125.769) (-1118.048) [-1124.360] (-1117.660) -- 0:00:05
914500 -- [-1117.680] (-1118.905) (-1119.794) (-1117.035) * (-1125.057) (-1121.580) [-1120.203] (-1121.609) -- 0:00:05
915000 -- (-1120.395) (-1122.234) (-1118.031) [-1117.159] * [-1120.227] (-1121.100) (-1120.349) (-1118.696) -- 0:00:05
Average standard deviation of split frequencies: 0.007617
915500 -- [-1120.885] (-1118.105) (-1118.806) (-1119.846) * (-1119.590) (-1119.678) (-1117.444) [-1117.910] -- 0:00:05
916000 -- (-1118.583) [-1119.150] (-1122.886) (-1117.636) * (-1120.181) (-1118.182) (-1117.400) [-1119.639] -- 0:00:05
916500 -- [-1119.908] (-1118.349) (-1116.859) (-1123.912) * (-1119.119) (-1120.861) [-1117.433] (-1118.203) -- 0:00:05
917000 -- (-1121.378) (-1117.178) [-1117.023] (-1118.565) * (-1118.343) [-1118.952] (-1121.586) (-1119.480) -- 0:00:05
917500 -- (-1119.129) [-1117.314] (-1123.147) (-1117.445) * (-1117.354) (-1117.675) (-1118.734) [-1119.298] -- 0:00:05
918000 -- (-1120.566) (-1119.749) [-1117.046] (-1122.384) * (-1116.633) [-1117.134] (-1118.817) (-1117.033) -- 0:00:05
918500 -- (-1118.816) (-1120.308) (-1119.239) [-1119.577] * (-1118.063) (-1118.622) (-1122.859) [-1117.224] -- 0:00:05
919000 -- (-1120.534) (-1120.740) (-1118.011) [-1117.509] * (-1119.645) (-1116.752) (-1122.425) [-1117.062] -- 0:00:05
919500 -- (-1118.666) (-1119.981) (-1118.539) [-1116.729] * [-1119.186] (-1120.230) (-1117.726) (-1117.792) -- 0:00:04
920000 -- (-1121.640) (-1120.015) (-1118.143) [-1117.507] * (-1124.529) (-1119.371) [-1119.681] (-1118.179) -- 0:00:04
Average standard deviation of split frequencies: 0.007339
920500 -- [-1118.806] (-1118.390) (-1117.672) (-1120.025) * (-1123.013) [-1117.629] (-1118.531) (-1118.764) -- 0:00:04
921000 -- (-1118.669) [-1120.536] (-1118.107) (-1121.479) * (-1120.647) (-1116.970) [-1118.910] (-1119.152) -- 0:00:04
921500 -- (-1117.644) (-1120.237) (-1120.589) [-1118.116] * (-1120.423) (-1119.773) [-1118.535] (-1123.125) -- 0:00:04
922000 -- (-1116.945) (-1116.696) [-1119.106] (-1123.839) * (-1118.653) (-1119.952) (-1118.423) [-1121.007] -- 0:00:04
922500 -- (-1118.820) (-1119.349) [-1119.028] (-1118.177) * [-1120.475] (-1119.337) (-1119.661) (-1117.225) -- 0:00:04
923000 -- (-1118.870) (-1120.185) (-1116.458) [-1118.881] * (-1117.518) (-1119.122) [-1117.246] (-1118.068) -- 0:00:04
923500 -- (-1122.763) [-1120.181] (-1119.487) (-1117.241) * (-1121.426) (-1117.669) [-1119.656] (-1120.599) -- 0:00:04
924000 -- (-1118.357) (-1116.798) [-1117.595] (-1117.634) * (-1118.785) [-1117.846] (-1118.484) (-1121.218) -- 0:00:04
924500 -- (-1116.946) [-1120.189] (-1120.552) (-1119.991) * (-1120.379) (-1120.143) (-1118.132) [-1121.227] -- 0:00:04
925000 -- (-1116.811) [-1116.337] (-1121.891) (-1116.955) * (-1119.600) (-1117.802) [-1116.349] (-1120.407) -- 0:00:04
Average standard deviation of split frequencies: 0.007399
925500 -- (-1121.522) (-1120.138) (-1120.015) [-1116.946] * (-1117.254) (-1118.413) (-1118.123) [-1119.058] -- 0:00:04
926000 -- (-1118.078) (-1118.832) (-1119.429) [-1116.156] * [-1119.829] (-1118.766) (-1118.123) (-1119.336) -- 0:00:04
926500 -- (-1118.964) [-1118.427] (-1120.474) (-1118.230) * (-1118.104) [-1117.142] (-1117.284) (-1117.425) -- 0:00:04
927000 -- (-1119.205) (-1118.001) [-1122.089] (-1118.620) * (-1116.869) [-1117.233] (-1117.284) (-1118.911) -- 0:00:04
927500 -- (-1116.764) [-1117.330] (-1118.834) (-1119.264) * (-1119.572) [-1120.025] (-1117.202) (-1119.724) -- 0:00:04
928000 -- (-1118.816) (-1118.401) (-1120.540) [-1118.593] * (-1119.984) (-1121.851) (-1117.330) [-1117.399] -- 0:00:04
928500 -- (-1121.527) [-1118.503] (-1121.705) (-1118.724) * (-1122.784) (-1116.682) (-1118.014) [-1119.370] -- 0:00:04
929000 -- (-1122.424) (-1118.873) [-1118.275] (-1117.686) * (-1117.667) [-1117.291] (-1121.060) (-1120.523) -- 0:00:04
929500 -- (-1120.436) (-1118.404) (-1119.234) [-1117.619] * (-1118.793) [-1117.928] (-1120.499) (-1117.703) -- 0:00:04
930000 -- (-1118.167) (-1117.716) (-1117.756) [-1117.502] * (-1118.940) (-1118.100) [-1119.359] (-1123.082) -- 0:00:04
Average standard deviation of split frequencies: 0.007328
930500 -- [-1119.377] (-1119.596) (-1116.242) (-1116.416) * [-1117.072] (-1117.432) (-1119.230) (-1120.135) -- 0:00:04
931000 -- (-1117.657) (-1121.381) [-1118.100] (-1117.298) * (-1118.680) (-1117.517) (-1121.019) [-1116.712] -- 0:00:04
931500 -- (-1119.314) (-1118.545) [-1119.358] (-1116.652) * (-1117.108) [-1117.406] (-1116.960) (-1117.897) -- 0:00:04
932000 -- (-1119.265) [-1118.583] (-1118.650) (-1118.655) * (-1118.287) [-1118.888] (-1118.181) (-1117.415) -- 0:00:04
932500 -- (-1118.791) [-1120.328] (-1117.768) (-1116.350) * (-1118.635) [-1118.905] (-1123.282) (-1117.105) -- 0:00:04
933000 -- (-1120.148) [-1117.484] (-1120.511) (-1116.603) * (-1121.075) (-1117.569) (-1124.067) [-1116.623] -- 0:00:04
933500 -- (-1119.131) [-1118.832] (-1117.287) (-1116.367) * (-1119.425) (-1116.970) [-1121.309] (-1116.577) -- 0:00:04
934000 -- (-1123.376) (-1118.115) [-1119.850] (-1118.971) * (-1118.449) (-1117.010) [-1116.928] (-1120.312) -- 0:00:04
934500 -- [-1120.286] (-1119.588) (-1120.609) (-1120.769) * (-1121.266) [-1117.085] (-1117.975) (-1116.821) -- 0:00:04
935000 -- (-1117.370) [-1118.963] (-1120.627) (-1117.861) * (-1117.548) (-1118.734) (-1118.674) [-1117.662] -- 0:00:04
Average standard deviation of split frequencies: 0.007219
935500 -- (-1116.602) (-1121.241) [-1118.049] (-1119.726) * (-1117.728) (-1122.692) (-1117.384) [-1117.684] -- 0:00:03
936000 -- (-1117.362) (-1119.200) (-1118.459) [-1117.540] * [-1118.664] (-1118.059) (-1118.924) (-1116.985) -- 0:00:03
936500 -- (-1118.493) (-1121.339) (-1120.043) [-1116.808] * (-1118.075) [-1117.186] (-1121.014) (-1116.765) -- 0:00:03
937000 -- (-1117.568) [-1118.168] (-1124.906) (-1116.739) * (-1118.429) (-1118.951) (-1118.769) [-1116.450] -- 0:00:03
937500 -- (-1117.201) (-1117.640) (-1120.964) [-1117.328] * (-1119.594) [-1119.991] (-1118.350) (-1117.177) -- 0:00:03
938000 -- (-1116.937) (-1118.200) (-1123.383) [-1120.807] * (-1117.827) (-1121.161) [-1118.694] (-1117.054) -- 0:00:03
938500 -- (-1119.788) (-1127.950) (-1122.702) [-1120.489] * (-1117.402) (-1116.973) (-1116.907) [-1118.240] -- 0:00:03
939000 -- [-1117.850] (-1120.968) (-1121.567) (-1124.755) * [-1118.843] (-1117.583) (-1120.132) (-1120.591) -- 0:00:03
939500 -- [-1118.513] (-1119.478) (-1119.222) (-1118.090) * (-1118.785) (-1120.199) (-1118.989) [-1119.107] -- 0:00:03
940000 -- (-1116.859) (-1119.477) (-1121.945) [-1119.349] * (-1119.867) [-1118.643] (-1118.223) (-1119.411) -- 0:00:03
Average standard deviation of split frequencies: 0.007718
940500 -- (-1118.367) (-1117.567) [-1119.656] (-1117.964) * (-1117.690) (-1119.530) (-1119.395) [-1119.848] -- 0:00:03
941000 -- (-1116.661) (-1119.067) [-1118.797] (-1118.950) * (-1118.140) [-1119.844] (-1119.471) (-1118.592) -- 0:00:03
941500 -- (-1117.331) [-1118.087] (-1117.680) (-1120.553) * (-1118.319) (-1117.322) [-1118.511] (-1119.638) -- 0:00:03
942000 -- [-1117.973] (-1117.840) (-1116.341) (-1125.442) * [-1117.757] (-1117.520) (-1120.238) (-1120.217) -- 0:00:03
942500 -- [-1118.054] (-1119.496) (-1116.522) (-1122.453) * (-1117.151) (-1117.882) (-1119.888) [-1119.242] -- 0:00:03
943000 -- (-1120.897) (-1120.490) [-1117.952] (-1120.672) * (-1116.866) (-1117.899) [-1117.816] (-1124.653) -- 0:00:03
943500 -- (-1118.907) (-1121.633) (-1117.305) [-1120.397] * [-1118.428] (-1119.141) (-1118.540) (-1121.017) -- 0:00:03
944000 -- (-1118.188) (-1123.010) [-1118.848] (-1123.228) * (-1116.801) (-1119.092) (-1119.344) [-1116.464] -- 0:00:03
944500 -- (-1119.577) (-1124.760) (-1117.645) [-1118.606] * (-1116.970) (-1118.217) (-1118.579) [-1117.136] -- 0:00:03
945000 -- (-1119.395) (-1120.357) [-1117.301] (-1120.377) * (-1116.928) (-1119.405) (-1118.550) [-1116.942] -- 0:00:03
Average standard deviation of split frequencies: 0.007641
945500 -- [-1119.817] (-1119.711) (-1117.486) (-1121.686) * (-1118.296) (-1120.139) [-1119.392] (-1117.843) -- 0:00:03
946000 -- (-1119.969) (-1119.224) [-1118.110] (-1118.977) * [-1117.053] (-1117.896) (-1120.788) (-1117.496) -- 0:00:03
946500 -- [-1118.048] (-1118.704) (-1116.840) (-1121.416) * (-1116.687) (-1122.190) [-1124.329] (-1116.987) -- 0:00:03
947000 -- (-1119.406) [-1116.733] (-1117.233) (-1119.704) * [-1117.585] (-1121.722) (-1118.016) (-1117.710) -- 0:00:03
947500 -- (-1124.029) [-1116.991] (-1116.652) (-1119.049) * [-1116.676] (-1118.543) (-1118.446) (-1120.493) -- 0:00:03
948000 -- (-1118.389) [-1116.715] (-1120.875) (-1118.342) * (-1121.348) (-1118.160) [-1117.993] (-1120.524) -- 0:00:03
948500 -- (-1116.813) [-1118.053] (-1116.860) (-1119.159) * (-1124.262) (-1117.485) [-1119.175] (-1117.168) -- 0:00:03
949000 -- (-1117.464) (-1120.171) (-1116.860) [-1117.538] * (-1120.997) (-1116.683) [-1119.965] (-1118.767) -- 0:00:03
949500 -- (-1121.434) (-1117.546) (-1119.797) [-1117.158] * (-1119.249) [-1116.860] (-1120.644) (-1117.017) -- 0:00:03
950000 -- [-1121.684] (-1117.409) (-1118.309) (-1117.096) * (-1118.176) [-1116.694] (-1117.656) (-1117.886) -- 0:00:03
Average standard deviation of split frequencies: 0.007471
950500 -- (-1123.138) [-1118.741] (-1121.116) (-1119.152) * (-1121.479) (-1118.726) (-1118.375) [-1117.515] -- 0:00:03
951000 -- [-1117.826] (-1121.254) (-1119.435) (-1120.568) * (-1119.029) (-1118.155) [-1117.572] (-1118.764) -- 0:00:03
951500 -- (-1117.153) (-1118.537) [-1116.626] (-1120.298) * (-1119.101) (-1118.808) (-1117.081) [-1118.007] -- 0:00:03
952000 -- (-1116.984) (-1118.692) (-1117.333) [-1120.933] * (-1118.183) (-1119.803) (-1121.030) [-1120.119] -- 0:00:02
952500 -- (-1116.512) [-1118.135] (-1120.372) (-1117.260) * [-1116.953] (-1120.909) (-1118.042) (-1119.329) -- 0:00:02
953000 -- (-1117.559) (-1118.736) [-1118.737] (-1120.269) * (-1119.671) [-1118.669] (-1117.368) (-1121.910) -- 0:00:02
953500 -- [-1118.050] (-1121.173) (-1118.008) (-1122.656) * (-1116.990) (-1116.556) (-1116.642) [-1118.093] -- 0:00:02
954000 -- (-1119.772) [-1120.890] (-1121.314) (-1117.648) * [-1117.968] (-1117.574) (-1116.689) (-1120.311) -- 0:00:02
954500 -- (-1120.589) (-1118.054) [-1118.023] (-1120.204) * [-1117.909] (-1117.502) (-1121.141) (-1118.625) -- 0:00:02
955000 -- (-1120.629) [-1118.147] (-1117.718) (-1119.502) * (-1119.440) [-1118.822] (-1116.751) (-1118.765) -- 0:00:02
Average standard deviation of split frequencies: 0.007988
955500 -- (-1120.937) (-1118.598) [-1122.663] (-1117.612) * (-1121.746) (-1118.659) [-1116.870] (-1119.932) -- 0:00:02
956000 -- (-1122.386) [-1120.307] (-1120.220) (-1117.141) * [-1119.494] (-1121.177) (-1118.794) (-1119.151) -- 0:00:02
956500 -- (-1119.510) (-1123.002) [-1117.879] (-1116.654) * (-1118.170) [-1121.514] (-1121.047) (-1118.288) -- 0:00:02
957000 -- [-1118.530] (-1118.371) (-1117.505) (-1117.223) * (-1121.733) (-1119.571) [-1120.444] (-1119.426) -- 0:00:02
957500 -- (-1119.264) [-1118.096] (-1117.505) (-1117.344) * (-1123.098) (-1118.684) (-1119.537) [-1120.608] -- 0:00:02
958000 -- (-1117.388) (-1120.251) (-1119.028) [-1117.453] * (-1117.911) (-1121.319) (-1117.242) [-1116.781] -- 0:00:02
958500 -- (-1122.525) (-1120.664) (-1117.846) [-1117.460] * (-1119.491) (-1116.225) [-1118.366] (-1118.110) -- 0:00:02
959000 -- (-1121.398) (-1118.627) [-1117.656] (-1118.796) * [-1117.810] (-1118.656) (-1118.498) (-1120.762) -- 0:00:02
959500 -- (-1127.297) [-1116.960] (-1118.818) (-1121.958) * [-1118.743] (-1119.107) (-1122.885) (-1125.531) -- 0:00:02
960000 -- (-1117.967) (-1118.230) [-1118.734] (-1118.352) * (-1120.533) (-1117.436) (-1116.685) [-1116.370] -- 0:00:02
Average standard deviation of split frequencies: 0.007819
960500 -- (-1118.945) (-1118.500) (-1118.164) [-1117.806] * (-1117.783) (-1120.875) [-1118.016] (-1117.702) -- 0:00:02
961000 -- (-1117.157) (-1116.993) [-1117.465] (-1118.512) * [-1118.255] (-1118.529) (-1119.822) (-1120.159) -- 0:00:02
961500 -- (-1117.660) (-1117.478) [-1118.879] (-1118.215) * [-1118.081] (-1118.619) (-1118.483) (-1119.522) -- 0:00:02
962000 -- (-1117.936) (-1118.424) (-1119.079) [-1118.192] * (-1120.320) (-1116.786) (-1119.749) [-1119.720] -- 0:00:02
962500 -- (-1119.809) [-1117.669] (-1118.981) (-1118.422) * [-1117.574] (-1116.399) (-1121.374) (-1117.123) -- 0:00:02
963000 -- (-1120.571) (-1119.120) (-1118.071) [-1119.829] * (-1119.506) (-1120.025) (-1123.347) [-1119.168] -- 0:00:02
963500 -- (-1117.689) (-1119.100) [-1119.404] (-1121.025) * (-1119.852) [-1118.277] (-1117.366) (-1121.562) -- 0:00:02
964000 -- (-1117.390) (-1122.518) (-1120.254) [-1117.815] * [-1120.652] (-1117.189) (-1116.588) (-1119.082) -- 0:00:02
964500 -- (-1117.453) (-1118.197) [-1119.748] (-1117.304) * (-1117.318) [-1116.846] (-1116.956) (-1121.391) -- 0:00:02
965000 -- (-1121.024) (-1119.974) (-1119.337) [-1116.902] * [-1117.705] (-1116.821) (-1120.325) (-1121.465) -- 0:00:02
Average standard deviation of split frequencies: 0.007938
965500 -- (-1122.346) (-1119.171) [-1116.678] (-1119.060) * [-1119.273] (-1119.004) (-1117.553) (-1120.926) -- 0:00:02
966000 -- [-1118.633] (-1120.072) (-1119.690) (-1119.872) * (-1118.749) (-1116.922) [-1118.035] (-1121.678) -- 0:00:02
966500 -- (-1117.246) [-1118.815] (-1119.033) (-1116.858) * (-1120.530) (-1117.697) [-1120.104] (-1122.338) -- 0:00:02
967000 -- (-1118.668) (-1119.055) (-1116.683) [-1117.900] * (-1119.368) [-1119.640] (-1120.112) (-1117.482) -- 0:00:02
967500 -- (-1119.637) [-1124.067] (-1116.973) (-1117.844) * (-1119.173) [-1120.803] (-1119.684) (-1122.246) -- 0:00:02
968000 -- (-1117.466) [-1117.266] (-1121.211) (-1118.473) * (-1118.910) (-1121.141) [-1117.837] (-1121.815) -- 0:00:01
968500 -- [-1118.993] (-1117.396) (-1121.597) (-1117.692) * [-1117.043] (-1122.514) (-1121.813) (-1116.923) -- 0:00:01
969000 -- (-1121.692) (-1117.971) (-1120.929) [-1120.506] * (-1118.690) [-1117.606] (-1117.121) (-1116.708) -- 0:00:01
969500 -- (-1121.739) (-1116.657) [-1121.364] (-1118.317) * (-1122.879) (-1125.162) [-1119.935] (-1118.467) -- 0:00:01
970000 -- (-1118.697) (-1122.527) (-1120.023) [-1116.550] * (-1121.829) (-1118.816) (-1119.136) [-1118.029] -- 0:00:01
Average standard deviation of split frequencies: 0.008321
970500 -- (-1117.844) (-1119.252) [-1119.012] (-1120.377) * [-1116.919] (-1116.715) (-1118.818) (-1117.988) -- 0:00:01
971000 -- [-1117.818] (-1120.415) (-1116.879) (-1122.466) * (-1118.562) [-1117.948] (-1117.981) (-1117.824) -- 0:00:01
971500 -- (-1118.249) (-1118.335) (-1120.431) [-1119.099] * (-1118.556) (-1118.884) (-1117.899) [-1118.351] -- 0:00:01
972000 -- (-1116.783) (-1116.452) [-1119.961] (-1119.036) * (-1120.855) (-1122.605) [-1120.155] (-1119.258) -- 0:00:01
972500 -- [-1117.542] (-1118.030) (-1117.724) (-1117.777) * (-1119.579) [-1123.881] (-1117.446) (-1118.437) -- 0:00:01
973000 -- [-1117.022] (-1118.918) (-1117.804) (-1124.011) * (-1119.894) [-1119.286] (-1118.289) (-1117.250) -- 0:00:01
973500 -- (-1121.806) [-1120.428] (-1121.261) (-1120.883) * (-1118.980) [-1118.180] (-1117.954) (-1117.487) -- 0:00:01
974000 -- [-1122.811] (-1118.710) (-1120.685) (-1119.876) * (-1118.213) [-1118.157] (-1117.553) (-1119.111) -- 0:00:01
974500 -- (-1119.993) (-1119.979) [-1117.776] (-1119.713) * (-1119.856) [-1123.208] (-1116.532) (-1121.115) -- 0:00:01
975000 -- (-1122.232) (-1117.474) (-1116.640) [-1119.378] * (-1120.764) (-1121.546) (-1116.532) [-1121.073] -- 0:00:01
Average standard deviation of split frequencies: 0.008340
975500 -- (-1120.626) (-1122.219) [-1118.932] (-1117.509) * (-1120.449) (-1118.677) [-1117.707] (-1118.832) -- 0:00:01
976000 -- [-1119.768] (-1119.374) (-1118.404) (-1119.063) * (-1117.253) (-1121.162) (-1117.097) [-1118.905] -- 0:00:01
976500 -- [-1116.411] (-1118.821) (-1120.354) (-1118.542) * [-1120.222] (-1118.359) (-1118.481) (-1116.681) -- 0:00:01
977000 -- (-1117.021) [-1116.478] (-1118.152) (-1119.782) * (-1119.333) (-1117.316) (-1117.208) [-1116.622] -- 0:00:01
977500 -- [-1117.082] (-1116.808) (-1117.946) (-1118.613) * (-1122.795) [-1117.748] (-1119.175) (-1117.148) -- 0:00:01
978000 -- (-1116.734) (-1117.394) [-1119.577] (-1117.271) * (-1121.997) [-1117.518] (-1119.709) (-1117.044) -- 0:00:01
978500 -- (-1118.809) [-1117.837] (-1118.320) (-1118.945) * (-1121.393) (-1118.124) (-1119.654) [-1117.662] -- 0:00:01
979000 -- [-1117.493] (-1121.644) (-1119.694) (-1116.072) * (-1117.989) (-1116.525) (-1118.191) [-1117.418] -- 0:00:01
979500 -- (-1120.704) (-1117.601) (-1117.227) [-1117.170] * [-1120.363] (-1116.629) (-1117.697) (-1117.742) -- 0:00:01
980000 -- (-1117.366) (-1118.258) (-1120.988) [-1118.044] * (-1120.251) [-1121.392] (-1118.310) (-1118.254) -- 0:00:01
Average standard deviation of split frequencies: 0.008428
980500 -- (-1116.547) [-1118.143] (-1117.281) (-1120.613) * (-1117.887) [-1116.959] (-1120.939) (-1120.495) -- 0:00:01
981000 -- [-1117.515] (-1117.371) (-1118.218) (-1120.884) * [-1119.448] (-1119.584) (-1120.790) (-1118.194) -- 0:00:01
981500 -- (-1117.851) (-1119.889) [-1116.680] (-1120.739) * (-1118.377) [-1118.567] (-1117.347) (-1117.685) -- 0:00:01
982000 -- (-1118.240) (-1118.994) [-1117.679] (-1120.568) * (-1120.682) [-1118.354] (-1120.956) (-1119.686) -- 0:00:01
982500 -- [-1119.160] (-1117.620) (-1119.086) (-1117.787) * [-1122.865] (-1119.840) (-1119.290) (-1118.480) -- 0:00:01
983000 -- (-1119.125) [-1118.686] (-1117.751) (-1118.313) * (-1120.919) (-1119.774) (-1119.659) [-1117.544] -- 0:00:01
983500 -- (-1121.599) [-1116.987] (-1123.114) (-1117.237) * [-1119.966] (-1116.600) (-1121.661) (-1119.617) -- 0:00:01
984000 -- (-1120.403) (-1116.917) [-1118.768] (-1117.306) * [-1118.669] (-1116.923) (-1119.233) (-1118.936) -- 0:00:00
984500 -- (-1116.861) (-1117.374) [-1118.317] (-1117.059) * [-1119.114] (-1120.842) (-1118.164) (-1118.434) -- 0:00:00
985000 -- (-1124.423) (-1118.287) [-1118.041] (-1118.389) * (-1119.812) [-1117.728] (-1119.021) (-1118.176) -- 0:00:00
Average standard deviation of split frequencies: 0.008319
985500 -- (-1117.138) (-1117.374) [-1117.309] (-1120.977) * (-1119.464) [-1117.347] (-1117.916) (-1118.658) -- 0:00:00
986000 -- (-1123.716) (-1119.746) (-1120.663) [-1118.820] * (-1116.348) (-1117.348) (-1118.494) [-1116.240] -- 0:00:00
986500 -- (-1121.579) (-1117.520) (-1117.699) [-1116.809] * (-1116.637) (-1121.603) (-1117.858) [-1116.280] -- 0:00:00
987000 -- (-1116.344) (-1119.876) (-1122.050) [-1117.919] * (-1119.453) (-1117.854) [-1118.351] (-1118.641) -- 0:00:00
987500 -- (-1117.784) (-1117.088) (-1120.160) [-1118.373] * (-1122.401) (-1120.231) (-1118.172) [-1118.886] -- 0:00:00
988000 -- (-1117.534) (-1117.719) [-1117.143] (-1117.819) * [-1123.504] (-1117.815) (-1117.066) (-1118.304) -- 0:00:00
988500 -- (-1118.660) [-1117.415] (-1116.786) (-1119.565) * (-1123.646) [-1117.709] (-1117.430) (-1118.228) -- 0:00:00
989000 -- [-1117.775] (-1119.269) (-1118.183) (-1118.170) * (-1121.964) (-1117.767) (-1123.096) [-1118.485] -- 0:00:00
989500 -- [-1118.799] (-1118.400) (-1121.104) (-1117.147) * [-1117.945] (-1122.741) (-1120.027) (-1118.454) -- 0:00:00
990000 -- [-1119.260] (-1118.182) (-1117.260) (-1119.204) * (-1118.376) (-1121.578) [-1120.648] (-1117.990) -- 0:00:00
Average standard deviation of split frequencies: 0.008026
990500 -- (-1120.617) (-1117.967) [-1120.759] (-1117.127) * (-1116.896) [-1120.064] (-1119.373) (-1119.699) -- 0:00:00
991000 -- [-1120.706] (-1121.139) (-1116.398) (-1123.731) * (-1116.779) (-1117.856) (-1117.740) [-1117.944] -- 0:00:00
991500 -- (-1117.656) [-1118.739] (-1120.968) (-1119.153) * [-1117.296] (-1116.680) (-1117.937) (-1120.057) -- 0:00:00
992000 -- (-1119.444) (-1120.566) (-1117.188) [-1119.221] * (-1117.000) [-1117.093] (-1117.344) (-1119.235) -- 0:00:00
992500 -- [-1118.402] (-1122.910) (-1118.028) (-1116.495) * (-1117.422) (-1117.922) [-1117.138] (-1119.703) -- 0:00:00
993000 -- (-1117.206) (-1117.931) (-1119.562) [-1117.053] * [-1117.131] (-1117.292) (-1116.603) (-1119.990) -- 0:00:00
993500 -- (-1117.379) (-1120.130) [-1119.487] (-1116.571) * [-1119.107] (-1116.996) (-1119.042) (-1117.480) -- 0:00:00
994000 -- (-1118.948) [-1116.799] (-1118.043) (-1121.821) * (-1118.895) [-1116.652] (-1125.512) (-1119.954) -- 0:00:00
994500 -- (-1117.762) (-1120.815) (-1119.657) [-1119.203] * (-1119.289) (-1117.778) [-1118.485] (-1121.278) -- 0:00:00
995000 -- (-1118.192) (-1117.491) [-1117.601] (-1118.178) * (-1119.656) (-1122.377) (-1117.823) [-1117.487] -- 0:00:00
Average standard deviation of split frequencies: 0.008172
995500 -- (-1116.898) (-1117.042) [-1121.437] (-1118.434) * (-1117.272) [-1118.959] (-1122.935) (-1117.715) -- 0:00:00
996000 -- [-1118.219] (-1118.079) (-1117.803) (-1117.727) * [-1116.507] (-1119.854) (-1122.916) (-1119.448) -- 0:00:00
996500 -- (-1120.745) (-1117.766) (-1120.024) [-1119.533] * [-1119.215] (-1116.728) (-1120.423) (-1117.863) -- 0:00:00
997000 -- (-1118.795) (-1117.356) [-1121.853] (-1121.070) * [-1119.022] (-1119.826) (-1120.051) (-1118.210) -- 0:00:00
997500 -- [-1119.307] (-1116.747) (-1117.892) (-1118.757) * [-1120.073] (-1120.506) (-1118.611) (-1122.441) -- 0:00:00
998000 -- [-1117.151] (-1117.577) (-1117.628) (-1120.779) * [-1118.763] (-1120.964) (-1119.671) (-1116.622) -- 0:00:00
998500 -- [-1117.584] (-1117.927) (-1120.493) (-1119.616) * [-1117.218] (-1120.968) (-1120.388) (-1116.984) -- 0:00:00
999000 -- (-1118.083) [-1118.237] (-1117.089) (-1116.800) * (-1116.609) (-1119.442) (-1121.306) [-1116.986] -- 0:00:00
999500 -- (-1117.622) [-1117.286] (-1118.978) (-1118.731) * (-1120.137) (-1118.562) [-1117.697] (-1118.069) -- 0:00:00
1000000 -- (-1119.737) [-1117.754] (-1120.099) (-1118.188) * (-1118.532) (-1117.244) (-1121.811) [-1117.685] -- 0:00:00
Average standard deviation of split frequencies: 0.008260
Analysis completed in 1 mins 2 seconds
Analysis used 61.58 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1116.07
Likelihood of best state for "cold" chain of run 2 was -1116.07
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 55 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
26.7 % ( 23 %) Dirichlet(Pi{all})
28.7 % ( 23 %) Slider(Pi{all})
78.9 % ( 51 %) Multiplier(Alpha{1,2})
77.9 % ( 39 %) Multiplier(Alpha{3})
19.8 % ( 21 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 56 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 88 %) ParsSPR(Tau{all},V{all})
28.0 % ( 22 %) Multiplier(V{all})
97.5 % ( 93 %) Nodeslider(V{all})
30.4 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 61 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.0 % ( 27 %) Dirichlet(Pi{all})
29.0 % ( 26 %) Slider(Pi{all})
78.7 % ( 56 %) Multiplier(Alpha{1,2})
77.8 % ( 54 %) Multiplier(Alpha{3})
19.4 % ( 26 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.3 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166836 0.82 0.67
3 | 166135 166750 0.84
4 | 167384 166289 166606
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 167281 0.82 0.67
3 | 166320 166383 0.84
4 | 166889 165993 167134
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1117.96
| 2 1 2 1 2 1 |
| 2 1 21 1 1 2 2 |
| 1 1 1 11 2 2* 12 1 2 1 2 11 |
| 1 1 2 2 112 * 12 1 112 2|
|2 22 *2 2 2 2 1 1 1 12 1 2 12 2 |
| 2 2 1 1 2 1 1 21 2 |
|1 122 2 1 11 2 12 2 1|
| 2 2 2 1 2 2 |
| 1 1 1 1 1 2 1 22 * |
| 2 1 1 2 2 2 2 |
| 2 1 2 |
| 2 1 1 |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1119.67
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1117.79 -1124.14
2 -1117.79 -1120.83
--------------------------------------
TOTAL -1117.79 -1123.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893506 0.094200 0.328600 1.470156 0.850123 1501.00 1501.00 1.000
r(A<->C){all} 0.164466 0.018186 0.000007 0.432576 0.128872 202.98 242.93 1.000
r(A<->G){all} 0.180824 0.020527 0.000032 0.474038 0.150122 388.93 411.65 1.000
r(A<->T){all} 0.170615 0.019627 0.000077 0.440517 0.136420 264.13 274.50 1.000
r(C<->G){all} 0.157339 0.018998 0.000097 0.440972 0.118151 220.87 243.15 1.000
r(C<->T){all} 0.158332 0.017883 0.000001 0.431329 0.124216 322.36 347.70 1.000
r(G<->T){all} 0.168423 0.020478 0.000053 0.452856 0.126411 117.84 223.28 1.000
pi(A){all} 0.211129 0.000217 0.182985 0.240152 0.210779 1260.43 1278.73 1.000
pi(C){all} 0.316884 0.000271 0.283048 0.348360 0.316537 1361.56 1425.69 1.000
pi(G){all} 0.251949 0.000225 0.223052 0.281243 0.251893 1274.55 1328.87 1.000
pi(T){all} 0.220038 0.000206 0.192254 0.247846 0.219814 1312.80 1338.28 1.000
alpha{1,2} 0.416486 0.212900 0.000180 1.331599 0.256380 1115.14 1122.50 1.000
alpha{3} 0.450706 0.227310 0.000373 1.369512 0.292513 1133.21 1200.69 1.001
pinvar{all} 0.998235 0.000004 0.994605 0.999998 0.998881 1156.97 1163.58 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- ..*.*.
9 -- .*...*
10 -- ..**..
11 -- .***.*
12 -- ...*.*
13 -- .*..*.
14 -- ....**
15 -- .**...
16 -- ..*..*
17 -- .*.*..
18 -- .**.**
19 -- .*.***
20 -- ...**.
21 -- ..****
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 460 0.153231 0.007537 0.147901 0.158561 2
8 451 0.150233 0.016488 0.138574 0.161892 2
9 449 0.149567 0.010835 0.141905 0.157229 2
10 444 0.147901 0.013191 0.138574 0.157229 2
11 443 0.147568 0.008009 0.141905 0.153231 2
12 435 0.144903 0.005182 0.141239 0.148568 2
13 433 0.144237 0.005182 0.140573 0.147901 2
14 432 0.143904 0.006595 0.139241 0.148568 2
15 425 0.141572 0.002355 0.139907 0.143238 2
16 424 0.141239 0.017901 0.128581 0.153897 2
17 421 0.140240 0.001413 0.139241 0.141239 2
18 413 0.137575 0.007066 0.132578 0.142572 2
19 410 0.136576 0.015075 0.125916 0.147235 2
20 396 0.131912 0.004711 0.128581 0.135243 2
21 393 0.130913 0.002355 0.129247 0.132578 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100642 0.010071 0.000031 0.301026 0.068699 1.000 2
length{all}[2] 0.103249 0.011018 0.000030 0.308465 0.071178 1.000 2
length{all}[3] 0.097007 0.009547 0.000017 0.295501 0.067161 1.000 2
length{all}[4] 0.097053 0.009400 0.000066 0.294651 0.065531 1.000 2
length{all}[5] 0.097815 0.010008 0.000009 0.289219 0.066999 1.000 2
length{all}[6] 0.100524 0.009772 0.000025 0.297672 0.070224 1.000 2
length{all}[7] 0.096632 0.008372 0.000019 0.281104 0.064855 0.998 2
length{all}[8] 0.102189 0.009409 0.000108 0.305333 0.072158 1.040 2
length{all}[9] 0.099986 0.009545 0.000434 0.294386 0.073599 1.003 2
length{all}[10] 0.103813 0.010372 0.000218 0.310688 0.069261 1.001 2
length{all}[11] 0.098694 0.009240 0.000548 0.292192 0.067909 1.000 2
length{all}[12] 0.094476 0.009525 0.000138 0.298439 0.065087 1.001 2
length{all}[13] 0.101404 0.009893 0.000166 0.323245 0.070194 0.998 2
length{all}[14] 0.092515 0.008578 0.000242 0.287595 0.063856 0.998 2
length{all}[15] 0.098544 0.010739 0.000174 0.308434 0.060695 0.999 2
length{all}[16] 0.105063 0.012712 0.000092 0.344035 0.069582 0.999 2
length{all}[17] 0.100766 0.009286 0.000131 0.304079 0.069676 0.998 2
length{all}[18] 0.100646 0.009251 0.000482 0.278587 0.070572 0.999 2
length{all}[19] 0.095470 0.009598 0.000052 0.304768 0.063657 1.004 2
length{all}[20] 0.100097 0.011419 0.000019 0.315453 0.064938 0.998 2
length{all}[21] 0.090887 0.007904 0.000026 0.273970 0.064238 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008260
Maximum standard deviation of split frequencies = 0.017901
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.002
Maximum PSRF for parameter values = 1.040
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------ C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 813
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 271 / 271 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 271 / 271 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.014992 0.071036 0.075888 0.040153 0.043543 0.023858 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1156.832198
Iterating by ming2
Initial: fx= 1156.832198
x= 0.01499 0.07104 0.07589 0.04015 0.04354 0.02386 0.30000 1.30000
1 h-m-p 0.0000 0.0001 652.5454 ++ 1132.965124 m 0.0001 13 | 1/8
2 h-m-p 0.0011 0.0214 29.4110 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 596.5751 ++ 1121.152601 m 0.0000 44 | 2/8
4 h-m-p 0.0008 0.0411 22.8610 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 533.7761 ++ 1103.715293 m 0.0001 75 | 3/8
6 h-m-p 0.0016 0.1270 17.7038 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 463.0650 ++ 1100.986053 m 0.0000 106 | 4/8
8 h-m-p 0.0160 8.0000 13.4063 -------------.. | 4/8
9 h-m-p 0.0000 0.0001 377.6748 ++ 1086.167649 m 0.0001 139 | 5/8
10 h-m-p 0.0160 8.0000 9.2099 -------------.. | 5/8
11 h-m-p 0.0000 0.0000 268.1721 ++ 1084.850287 m 0.0000 172 | 6/8
12 h-m-p 0.0544 8.0000 0.0000 ++++ 1084.850287 m 8.0000 185 | 6/8
13 h-m-p 0.0160 8.0000 0.0008 ----Y 1084.850287 0 0.0000 202 | 6/8
14 h-m-p 0.0160 8.0000 0.0007 --------C 1084.850287 0 0.0000 223
Out..
lnL = -1084.850287
224 lfun, 224 eigenQcodon, 1344 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.065345 0.101504 0.098879 0.022101 0.082878 0.026265 0.300006 0.582622 0.391113
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.937607
np = 9
lnL0 = -1188.566167
Iterating by ming2
Initial: fx= 1188.566167
x= 0.06534 0.10150 0.09888 0.02210 0.08288 0.02627 0.30001 0.58262 0.39111
1 h-m-p 0.0000 0.0001 623.7704 ++ 1154.780644 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 368.8659 ++ 1149.271797 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0002 471.9625 ++ 1110.952862 m 0.0002 38 | 3/9
4 h-m-p 0.0001 0.0005 213.0826 ++ 1094.471051 m 0.0005 50 | 4/9
5 h-m-p 0.0000 0.0001 1267.5606 ++ 1085.490038 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0001 1073.5410 ++ 1084.850320 m 0.0001 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0010 ---------Y 1084.850320 0 0.0000 95 | 6/9
8 h-m-p 0.0160 8.0000 0.0001 +++++ 1084.850320 m 8.0000 113 | 6/9
9 h-m-p 0.0057 2.8512 0.2609 +++++ 1084.850295 m 2.8512 131 | 7/9
10 h-m-p 0.2745 1.3724 0.2003 ++ 1084.850291 m 1.3724 146 | 7/9
11 h-m-p 0.0000 0.0000 1.1119
h-m-p: 3.60083234e-19 1.80041617e-18 1.11185426e+00 1084.850291
.. | 7/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 1084.850291 m 8.0000 172 | 7/9
13 h-m-p 0.0425 0.2123 0.0005 ------Y 1084.850291 0 0.0000 192
Out..
lnL = -1084.850291
193 lfun, 579 eigenQcodon, 2316 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.090674 0.068650 0.084757 0.017347 0.087133 0.010251 0.302858 0.855732 0.259520 0.412958 1.341620
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.601159
np = 11
lnL0 = -1178.239353
Iterating by ming2
Initial: fx= 1178.239353
x= 0.09067 0.06865 0.08476 0.01735 0.08713 0.01025 0.30286 0.85573 0.25952 0.41296 1.34162
1 h-m-p 0.0000 0.0000 619.7332 ++ 1162.747997 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 298.6399 ++ 1153.331954 m 0.0001 30 | 2/11
3 h-m-p 0.0001 0.0005 234.3592 ++ 1102.034090 m 0.0005 44 | 3/11
4 h-m-p 0.0007 0.0034 51.3128 ++ 1086.551810 m 0.0034 58 | 4/11
5 h-m-p 0.0000 0.0001 516.0384 ++ 1085.604183 m 0.0001 72 | 5/11
6 h-m-p 0.0001 0.0003 377.2665 ++ 1085.597981 m 0.0003 86 | 5/11
7 h-m-p 0.0000 0.0000 227.4285
h-m-p: 9.51739341e-22 4.75869670e-21 2.27428479e+02 1085.597981
.. | 5/11
8 h-m-p 0.0000 0.0000 268.5704 ++ 1084.850306 m 0.0000 111 | 6/11
9 h-m-p 0.0160 8.0000 0.0000 +++++ 1084.850306 m 8.0000 128 | 6/11
10 h-m-p 0.0207 8.0000 0.0069 +++++ 1084.850305 m 8.0000 150 | 6/11
11 h-m-p 0.0734 1.1751 0.7556 +++ 1084.850296 m 1.1751 170 | 6/11
12 h-m-p -0.0000 -0.0000 0.5206
h-m-p: -0.00000000e+00 -0.00000000e+00 5.20571598e-01 1084.850296
.. | 6/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 1084.850296 m 8.0000 208 | 6/11
14 h-m-p 0.0005 0.2488 1.0509 +++++ 1084.850291 m 0.2488 230 | 7/11
15 h-m-p 0.2190 8.0000 1.0160 +++ 1084.850262 m 8.0000 245 | 7/11
16 h-m-p 1.6000 8.0000 0.5043 ++ 1084.850260 m 8.0000 259 | 7/11
17 h-m-p 1.1554 8.0000 3.4918 ++ 1084.850256 m 8.0000 277 | 7/11
18 h-m-p 1.6000 8.0000 4.1008 ++ 1084.850255 m 8.0000 291 | 7/11
19 h-m-p 1.6000 8.0000 0.2796 ---------------Y 1084.850255 0 0.0000 320 | 7/11
20 h-m-p 0.0160 8.0000 0.0000 -----C 1084.850255 0 0.0000 343
Out..
lnL = -1084.850255
344 lfun, 1376 eigenQcodon, 6192 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1084.849095 S = -1084.844733 -0.001666
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:02
did 20 / 55 patterns 0:03
did 30 / 55 patterns 0:03
did 40 / 55 patterns 0:03
did 50 / 55 patterns 0:03
did 55 / 55 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.025125 0.076641 0.059999 0.095353 0.046240 0.067450 70.935034 1.166426 1.095984
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.373194
np = 9
lnL0 = -1180.656955
Iterating by ming2
Initial: fx= 1180.656955
x= 0.02512 0.07664 0.06000 0.09535 0.04624 0.06745 70.93503 1.16643 1.09598
1 h-m-p 0.0000 0.0001 614.0762 ++ 1143.022268 m 0.0001 14 | 1/9
2 h-m-p 0.0013 0.0295 40.7882 +++ 1131.388082 m 0.0295 27 | 2/9
3 h-m-p 0.0001 0.0003 2829.5653 +
QuantileBeta(0.15, 0.00500, 2.23040) = 1.173694e-160 2000 rounds
+ 1100.372170 m 0.0003 39
QuantileBeta(0.15, 0.00500, 2.23040) = 1.173694e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23040) = 1.173694e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23040) = 1.173694e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23040) = 1.173694e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23040) = 1.173694e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23040) = 1.173694e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23040) = 1.173694e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23040) = 1.214667e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.23040) = 1.173693e-160 2000 rounds
| 3/9
4 h-m-p 0.0001 0.0004 669.3482
QuantileBeta(0.15, 0.00500, 2.28567) = 1.138292e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45146) = 1.043729e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.50673) = 1.015576e-160 2000 rounds
+ 1097.562306 m 0.0004 51
QuantileBeta(0.15, 0.00500, 2.50673) = 1.015576e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50673) = 1.015576e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50673) = 1.015576e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50673) = 1.015576e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50673) = 1.015576e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50673) = 1.015576e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50673) = 1.015576e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50673) = 1.051030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50673) = 1.015576e-160 2000 rounds
| 4/9
5 h-m-p 0.0000 0.0001 3169.4062
QuantileBeta(0.15, 0.00500, 2.45759) = 1.040533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.31017) = 1.123264e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.26103) = 1.153811e-160 2000 rounds
+ 1092.326922 m 0.0001 63
QuantileBeta(0.15, 0.00500, 2.26103) = 1.153811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26103) = 1.153811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26103) = 1.153811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26103) = 1.153811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26103) = 1.153811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26103) = 1.153811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26103) = 1.153811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26103) = 1.194090e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26103) = 1.153810e-160 2000 rounds
| 5/9
6 h-m-p 0.0001 0.0003 3316.6454 ++ 1088.432124 m 0.0003 75 | 6/9
7 h-m-p 0.0012 0.0058 229.8770 -----------.. | 6/9
8 h-m-p 0.0000 0.0001 263.4564 ++ 1084.850266 m 0.0001 108 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 Y 1084.850266 0 1.6000 120 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 C 1084.850266 0 1.6000 134
Out..
lnL = -1084.850266
135 lfun, 1485 eigenQcodon, 8100 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.061954 0.022429 0.094276 0.081294 0.028333 0.038642 70.935632 0.900000 0.746692 1.467030 1.300015
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.408595
np = 11
lnL0 = -1167.808113
Iterating by ming2
Initial: fx= 1167.808113
x= 0.06195 0.02243 0.09428 0.08129 0.02833 0.03864 70.93563 0.90000 0.74669 1.46703 1.30001
1 h-m-p 0.0000 0.0001 595.3827 ++ 1135.052783 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0005 145.9429 ++ 1126.332593 m 0.0005 30 | 2/11
3 h-m-p 0.0000 0.0001 573.2246 ++ 1114.233537 m 0.0001 44 | 3/11
4 h-m-p 0.0003 0.0015 129.7245 ++ 1103.917186 m 0.0015 58 | 4/11
5 h-m-p 0.0000 0.0001 2751.8175 ++ 1093.085323 m 0.0001 72 | 5/11
6 h-m-p 0.0000 0.0002 3808.3225 ++ 1085.602939 m 0.0002 86 | 5/11
7 h-m-p 0.0081 0.0403 35.9976 -------------.. | 5/11
8 h-m-p 0.0000 0.0000 266.7448 ++ 1084.850256 m 0.0000 125 | 6/11
9 h-m-p 0.0160 8.0000 0.0000 +++++ 1084.850256 m 8.0000 142 | 6/11
10 h-m-p 1.0840 8.0000 0.0000 ++ 1084.850256 m 8.0000 161 | 7/11
11 h-m-p 0.0160 8.0000 0.0190 -----Y 1084.850256 0 0.0000 185 | 7/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 1084.850256 m 8.0000 206 | 7/11
13 h-m-p 0.0091 4.3223 0.0808 +++++ 1084.850256 m 4.3223 227 | 8/11
14 h-m-p 0.3404 8.0000 1.0153 +++ 1084.850254 m 8.0000 246 | 8/11
15 h-m-p 1.1716 8.0000 6.9331 ++ 1084.850254 m 8.0000 260 | 8/11
16 h-m-p 1.6000 8.0000 1.2575 -------C 1084.850254 0 0.0000 281 | 8/11
17 h-m-p 0.9147 8.0000 0.0000 ---------------C 1084.850254 0 0.0000 310
Out..
lnL = -1084.850254
311 lfun, 3732 eigenQcodon, 20526 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1084.844202 S = -1084.843893 -0.000135
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:10
did 20 / 55 patterns 0:10
did 30 / 55 patterns 0:10
did 40 / 55 patterns 0:11
did 50 / 55 patterns 0:11
did 55 / 55 patterns 0:11
Time used: 0:11
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2649/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 271
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 5 5 5 5 5 5 | TCC 4 4 4 4 4 4 | TAC 7 7 7 7 7 7 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 6 6 6 6 6 6 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 7 7 7 7 7 7 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 6 6 6 6 6 6
CTC 6 6 6 6 6 6 | CCC 0 0 0 0 0 0 | CAC 5 5 5 5 5 5 | CGC 3 3 3 3 3 3
CTA 3 3 3 3 3 3 | CCA 5 5 5 5 5 5 | Gln CAA 5 5 5 5 5 5 | CGA 3 3 3 3 3 3
CTG 6 6 6 6 6 6 | CCG 14 14 14 14 14 14 | CAG 5 5 5 5 5 5 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 6 6 6 6 6 6 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 10 10 10 10 10 10 | ACC 12 12 12 12 12 12 | AAC 10 10 10 10 10 10 | AGC 2 2 2 2 2 2
ATA 2 2 2 2 2 2 | ACA 4 4 4 4 4 4 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 4 4 4 4 4 4 | AAG 5 5 5 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 2 2 2 2 2 2 | Asp GAT 6 6 6 6 6 6 | Gly GGT 6 6 6 6 6 6
GTC 10 10 10 10 10 10 | GCC 8 8 8 8 8 8 | GAC 11 11 11 11 11 11 | GGC 10 10 10 10 10 10
GTA 4 4 4 4 4 4 | GCA 4 4 4 4 4 4 | Glu GAA 1 1 1 1 1 1 | GGA 2 2 2 2 2 2
GTG 12 12 12 12 12 12 | GCG 6 6 6 6 6 6 | GAG 4 4 4 4 4 4 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010909011_1_2834_MLBR_RS13485
position 1: T:0.15498 C:0.27306 A:0.23985 G:0.33210
position 2: T:0.30996 C:0.29889 A:0.24723 G:0.14391
position 3: T:0.19557 C:0.38007 A:0.14391 G:0.28044
Average T:0.22017 C:0.31734 A:0.21033 G:0.25215
#2: NC_002677_1_NP_302692_1_1564_ML2649
position 1: T:0.15498 C:0.27306 A:0.23985 G:0.33210
position 2: T:0.30996 C:0.29889 A:0.24723 G:0.14391
position 3: T:0.19557 C:0.38007 A:0.14391 G:0.28044
Average T:0.22017 C:0.31734 A:0.21033 G:0.25215
#3: NZ_LVXE01000015_1_WP_010909011_1_545_A3216_RS06220
position 1: T:0.15498 C:0.27306 A:0.23985 G:0.33210
position 2: T:0.30996 C:0.29889 A:0.24723 G:0.14391
position 3: T:0.19557 C:0.38007 A:0.14391 G:0.28044
Average T:0.22017 C:0.31734 A:0.21033 G:0.25215
#4: NZ_LYPH01000020_1_WP_010909011_1_762_A8144_RS03620
position 1: T:0.15498 C:0.27306 A:0.23985 G:0.33210
position 2: T:0.30996 C:0.29889 A:0.24723 G:0.14391
position 3: T:0.19557 C:0.38007 A:0.14391 G:0.28044
Average T:0.22017 C:0.31734 A:0.21033 G:0.25215
#5: NZ_CP029543_1_WP_010909011_1_2866_DIJ64_RS14585
position 1: T:0.15498 C:0.27306 A:0.23985 G:0.33210
position 2: T:0.30996 C:0.29889 A:0.24723 G:0.14391
position 3: T:0.19557 C:0.38007 A:0.14391 G:0.28044
Average T:0.22017 C:0.31734 A:0.21033 G:0.25215
#6: NZ_AP014567_1_WP_010909011_1_2933_JK2ML_RS14920
position 1: T:0.15498 C:0.27306 A:0.23985 G:0.33210
position 2: T:0.30996 C:0.29889 A:0.24723 G:0.14391
position 3: T:0.19557 C:0.38007 A:0.14391 G:0.28044
Average T:0.22017 C:0.31734 A:0.21033 G:0.25215
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 18 | Tyr Y TAT 12 | Cys C TGT 0
TTC 30 | TCC 24 | TAC 42 | TGC 0
Leu L TTA 6 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 36 | TCG 24 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 42 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 36
CTC 36 | CCC 0 | CAC 30 | CGC 18
CTA 18 | CCA 30 | Gln Q CAA 30 | CGA 18
CTG 36 | CCG 84 | CAG 30 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 36 | Asn N AAT 12 | Ser S AGT 6
ATC 60 | ACC 72 | AAC 60 | AGC 12
ATA 12 | ACA 24 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 24 | ACG 24 | AAG 30 | AGG 0
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 12 | Asp D GAT 36 | Gly G GGT 36
GTC 60 | GCC 48 | GAC 66 | GGC 60
GTA 24 | GCA 24 | Glu E GAA 6 | GGA 12
GTG 72 | GCG 36 | GAG 24 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15498 C:0.27306 A:0.23985 G:0.33210
position 2: T:0.30996 C:0.29889 A:0.24723 G:0.14391
position 3: T:0.19557 C:0.38007 A:0.14391 G:0.28044
Average T:0.22017 C:0.31734 A:0.21033 G:0.25215
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1084.850287 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300006 1.300015
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909011_1_2834_MLBR_RS13485: 0.000004, NC_002677_1_NP_302692_1_1564_ML2649: 0.000004, NZ_LVXE01000015_1_WP_010909011_1_545_A3216_RS06220: 0.000004, NZ_LYPH01000020_1_WP_010909011_1_762_A8144_RS03620: 0.000004, NZ_CP029543_1_WP_010909011_1_2866_DIJ64_RS14585: 0.000004, NZ_AP014567_1_WP_010909011_1_2933_JK2ML_RS14920: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30001
omega (dN/dS) = 1.30001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 622.2 190.8 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 622.2 190.8 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 622.2 190.8 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 622.2 190.8 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 622.2 190.8 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 622.2 190.8 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1084.850291 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.302858 0.000010 0.000005
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909011_1_2834_MLBR_RS13485: 0.000004, NC_002677_1_NP_302692_1_1564_ML2649: 0.000004, NZ_LVXE01000015_1_WP_010909011_1_545_A3216_RS06220: 0.000004, NZ_LYPH01000020_1_WP_010909011_1_762_A8144_RS03620: 0.000004, NZ_CP029543_1_WP_010909011_1_2866_DIJ64_RS14585: 0.000004, NZ_AP014567_1_WP_010909011_1_2933_JK2ML_RS14920: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30286
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00001 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 622.1 190.9 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 622.1 190.9 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 622.1 190.9 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 622.1 190.9 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 622.1 190.9 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 622.1 190.9 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1084.850255 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 70.935034 0.015434 0.864449 1.000000 18.887484
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909011_1_2834_MLBR_RS13485: 0.000004, NC_002677_1_NP_302692_1_1564_ML2649: 0.000004, NZ_LVXE01000015_1_WP_010909011_1_545_A3216_RS06220: 0.000004, NZ_LYPH01000020_1_WP_010909011_1_762_A8144_RS03620: 0.000004, NZ_CP029543_1_WP_010909011_1_2866_DIJ64_RS14585: 0.000004, NZ_AP014567_1_WP_010909011_1_2933_JK2ML_RS14920: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 70.93503
MLEs of dN/dS (w) for site classes (K=3)
p: 0.01543 0.86445 0.12012
w: 1.00000 1.00000 18.88748
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 561.8 251.2 3.1486 0.0000 0.0000 0.0 0.0
7..2 0.000 561.8 251.2 3.1486 0.0000 0.0000 0.0 0.0
7..3 0.000 561.8 251.2 3.1486 0.0000 0.0000 0.0 0.0
7..4 0.000 561.8 251.2 3.1486 0.0000 0.0000 0.0 0.0
7..5 0.000 561.8 251.2 3.1486 0.0000 0.0000 0.0 0.0
7..6 0.000 561.8 251.2 3.1486 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909011_1_2834_MLBR_RS13485)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909011_1_2834_MLBR_RS13485)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1084.850266 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 70.935632 0.005000 1.344515
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909011_1_2834_MLBR_RS13485: 0.000004, NC_002677_1_NP_302692_1_1564_ML2649: 0.000004, NZ_LVXE01000015_1_WP_010909011_1_545_A3216_RS06220: 0.000004, NZ_LYPH01000020_1_WP_010909011_1_762_A8144_RS03620: 0.000004, NZ_CP029543_1_WP_010909011_1_2866_DIJ64_RS14585: 0.000004, NZ_AP014567_1_WP_010909011_1_2933_JK2ML_RS14920: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 70.93563
Parameters in M7 (beta):
p = 0.00500 q = 1.34452
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 561.8 251.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 561.8 251.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 561.8 251.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 561.8 251.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 561.8 251.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 561.8 251.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1084.850254 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 71.495578 0.000010 0.005000 1.700145 66.000055
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909011_1_2834_MLBR_RS13485: 0.000004, NC_002677_1_NP_302692_1_1564_ML2649: 0.000004, NZ_LVXE01000015_1_WP_010909011_1_545_A3216_RS06220: 0.000004, NZ_LYPH01000020_1_WP_010909011_1_762_A8144_RS03620: 0.000004, NZ_CP029543_1_WP_010909011_1_2866_DIJ64_RS14585: 0.000004, NZ_AP014567_1_WP_010909011_1_2933_JK2ML_RS14920: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 71.49558
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.70015
(p1 = 0.99999) w = 66.00005
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 66.00005
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 561.8 251.2 65.9994 0.0000 0.0000 0.0 0.0
7..2 0.000 561.8 251.2 65.9994 0.0000 0.0000 0.0 0.0
7..3 0.000 561.8 251.2 65.9994 0.0000 0.0000 0.0 0.0
7..4 0.000 561.8 251.2 65.9994 0.0000 0.0000 0.0 0.0
7..5 0.000 561.8 251.2 65.9994 0.0000 0.0000 0.0 0.0
7..6 0.000 561.8 251.2 65.9994 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909011_1_2834_MLBR_RS13485)
Pr(w>1) post mean +- SE for w
1 V 1.000** 65.999
2 S 1.000** 65.999
3 A 1.000** 65.999
4 L 1.000** 65.999
5 N 1.000** 65.999
6 R 1.000** 65.999
7 R 1.000** 65.999
8 S 1.000** 65.999
9 F 1.000** 65.999
10 L 1.000** 65.999
11 G 1.000** 65.999
12 A 1.000** 65.999
13 L 1.000** 65.999
14 A 1.000** 65.999
15 V 1.000** 65.999
16 S 1.000** 65.999
17 T 1.000** 65.999
18 V 1.000** 65.999
19 T 1.000** 65.999
20 G 1.000** 65.999
21 L 1.000** 65.999
22 G 1.000** 65.999
23 A 1.000** 65.999
24 V 1.000** 65.999
25 R 1.000** 65.999
26 L 1.000** 65.999
27 V 1.000** 65.999
28 V 1.000** 65.999
29 G 1.000** 65.999
30 P 1.000** 65.999
31 Q 1.000** 65.999
32 P 1.000** 65.999
33 R 1.000** 65.999
34 T 1.000** 65.999
35 F 1.000** 65.999
36 V 1.000** 65.999
37 Q 1.000** 65.999
38 A 1.000** 65.999
39 P 1.000** 65.999
40 V 1.000** 65.999
41 V 1.000** 65.999
42 A 1.000** 65.999
43 E 1.000** 65.999
44 L 1.000** 65.999
45 T 1.000** 65.999
46 P 1.000** 65.999
47 T 1.000** 65.999
48 P 1.000** 65.999
49 N 1.000** 65.999
50 A 1.000** 65.999
51 A 1.000** 65.999
52 G 1.000** 65.999
53 V 1.000** 65.999
54 L 1.000** 65.999
55 P 1.000** 65.999
56 P 1.000** 65.999
57 P 1.000** 65.999
58 P 1.000** 65.999
59 T 1.000** 65.999
60 S 1.000** 65.999
61 A 1.000** 65.999
62 R 1.000** 65.999
63 I 1.000** 65.999
64 P 1.000** 65.999
65 L 1.000** 65.999
66 P 1.000** 65.999
67 G 1.000** 65.999
68 G 1.000** 65.999
69 G 1.000** 65.999
70 V 1.000** 65.999
71 L 1.000** 65.999
72 S 1.000** 65.999
73 K 1.000** 65.999
74 I 1.000** 65.999
75 P 1.000** 65.999
76 G 1.000** 65.999
77 R 1.000** 65.999
78 G 1.000** 65.999
79 D 1.000** 65.999
80 L 1.000** 65.999
81 L 1.000** 65.999
82 A 1.000** 65.999
83 L 1.000** 65.999
84 T 1.000** 65.999
85 V 1.000** 65.999
86 D 1.000** 65.999
87 D 1.000** 65.999
88 G 1.000** 65.999
89 V 1.000** 65.999
90 N 1.000** 65.999
91 T 1.000** 65.999
92 E 1.000** 65.999
93 V 1.000** 65.999
94 V 1.000** 65.999
95 R 1.000** 65.999
96 S 1.000** 65.999
97 Y 1.000** 65.999
98 V 1.000** 65.999
99 Q 1.000** 65.999
100 F 1.000** 65.999
101 V 1.000** 65.999
102 K 1.000** 65.999
103 D 1.000** 65.999
104 T 1.000** 65.999
105 D 1.000** 65.999
106 I 1.000** 65.999
107 R 1.000** 65.999
108 L 1.000** 65.999
109 T 1.000** 65.999
110 F 1.000** 65.999
111 F 1.000** 65.999
112 V 1.000** 65.999
113 N 1.000** 65.999
114 G 1.000** 65.999
115 V 1.000** 65.999
116 Y 1.000** 65.999
117 D 1.000** 65.999
118 S 1.000** 65.999
119 W 1.000** 65.999
120 T 1.000** 65.999
121 D 1.000** 65.999
122 N 1.000** 65.999
123 M 1.000** 65.999
124 S 1.000** 65.999
125 M 1.000** 65.999
126 L 1.000** 65.999
127 R 1.000** 65.999
128 P 1.000** 65.999
129 L 1.000** 65.999
130 V 1.000** 65.999
131 E 1.000** 65.999
132 S 1.000** 65.999
133 G 1.000** 65.999
134 Q 1.000** 65.999
135 I 1.000** 65.999
136 Q 1.000** 65.999
137 L 1.000** 65.999
138 G 1.000** 65.999
139 N 1.000** 65.999
140 H 1.000** 65.999
141 T 1.000** 65.999
142 W 1.000** 65.999
143 S 1.000** 65.999
144 H 1.000** 65.999
145 P 1.000** 65.999
146 D 1.000** 65.999
147 L 1.000** 65.999
148 T 1.000** 65.999
149 A 1.000** 65.999
150 M 1.000** 65.999
151 T 1.000** 65.999
152 K 1.000** 65.999
153 S 1.000** 65.999
154 E 1.000** 65.999
155 I 1.000** 65.999
156 A 1.000** 65.999
157 T 1.000** 65.999
158 Q 1.000** 65.999
159 L 1.000** 65.999
160 N 1.000** 65.999
161 R 1.000** 65.999
162 N 1.000** 65.999
163 D 1.000** 65.999
164 D 1.000** 65.999
165 F 1.000** 65.999
166 L 1.000** 65.999
167 K 1.000** 65.999
168 K 1.000** 65.999
169 N 1.000** 65.999
170 Y 1.000** 65.999
171 G 1.000** 65.999
172 I 1.000** 65.999
173 A 1.000** 65.999
174 A 1.000** 65.999
175 Q 1.000** 65.999
176 P 1.000** 65.999
177 Y 1.000** 65.999
178 W 1.000** 65.999
179 R 1.000** 65.999
180 P 1.000** 65.999
181 P 1.000** 65.999
182 Y 1.000** 65.999
183 A 1.000** 65.999
184 K 1.000** 65.999
185 H 1.000** 65.999
186 N 1.000** 65.999
187 A 1.000** 65.999
188 T 1.000** 65.999
189 V 1.000** 65.999
190 D 1.000** 65.999
191 A 1.000** 65.999
192 V 1.000** 65.999
193 A 1.000** 65.999
194 V 1.000** 65.999
195 D 1.000** 65.999
196 L 1.000** 65.999
197 G 1.000** 65.999
198 Y 1.000** 65.999
199 T 1.000** 65.999
200 V 1.000** 65.999
201 P 1.000** 65.999
202 T 1.000** 65.999
203 L 1.000** 65.999
204 W 1.000** 65.999
205 S 1.000** 65.999
206 G 1.000** 65.999
207 S 1.000** 65.999
208 L 1.000** 65.999
209 S 1.000** 65.999
210 D 1.000** 65.999
211 S 1.000** 65.999
212 T 1.000** 65.999
213 L 1.000** 65.999
214 I 1.000** 65.999
215 T 1.000** 65.999
216 E 1.000** 65.999
217 D 1.000** 65.999
218 Y 1.000** 65.999
219 I 1.000** 65.999
220 V 1.000** 65.999
221 K 1.000** 65.999
222 M 1.000** 65.999
223 A 1.000** 65.999
224 D 1.000** 65.999
225 Q 1.000** 65.999
226 Y 1.000** 65.999
227 F 1.000** 65.999
228 T 1.000** 65.999
229 P 1.000** 65.999
230 Q 1.000** 65.999
231 A 1.000** 65.999
232 I 1.000** 65.999
233 V 1.000** 65.999
234 I 1.000** 65.999
235 G 1.000** 65.999
236 H 1.000** 65.999
237 L 1.000** 65.999
238 N 1.000** 65.999
239 H 1.000** 65.999
240 L 1.000** 65.999
241 P 1.000** 65.999
242 V 1.000** 65.999
243 T 1.000** 65.999
244 H 1.000** 65.999
245 V 1.000** 65.999
246 Y 1.000** 65.999
247 P 1.000** 65.999
248 Q 1.000** 65.999
249 L 1.000** 65.999
250 I 1.000** 65.999
251 D 1.000** 65.999
252 I 1.000** 65.999
253 I 1.000** 65.999
254 R 1.000** 65.999
255 S 1.000** 65.999
256 R 1.000** 65.999
257 H 1.000** 65.999
258 L 1.000** 65.999
259 R 1.000** 65.999
260 T 1.000** 65.999
261 V 1.000** 65.999
262 T 1.000** 65.999
263 L 1.000** 65.999
264 N 1.000** 65.999
265 D 1.000** 65.999
266 V 1.000** 65.999
267 F 1.000** 65.999
268 L 1.000** 65.999
269 T 1.000** 65.999
270 T 1.000** 65.999
271 S 1.000** 65.999
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909011_1_2834_MLBR_RS13485)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:11