--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:57:38 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/9res/ML2649/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1117.79 -1124.14 2 -1117.79 -1120.83 -------------------------------------- TOTAL -1117.79 -1123.49 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.893506 0.094200 0.328600 1.470156 0.850123 1501.00 1501.00 1.000 r(A<->C){all} 0.164466 0.018186 0.000007 0.432576 0.128872 202.98 242.93 1.000 r(A<->G){all} 0.180824 0.020527 0.000032 0.474038 0.150122 388.93 411.65 1.000 r(A<->T){all} 0.170615 0.019627 0.000077 0.440517 0.136420 264.13 274.50 1.000 r(C<->G){all} 0.157339 0.018998 0.000097 0.440972 0.118151 220.87 243.15 1.000 r(C<->T){all} 0.158332 0.017883 0.000001 0.431329 0.124216 322.36 347.70 1.000 r(G<->T){all} 0.168423 0.020478 0.000053 0.452856 0.126411 117.84 223.28 1.000 pi(A){all} 0.211129 0.000217 0.182985 0.240152 0.210779 1260.43 1278.73 1.000 pi(C){all} 0.316884 0.000271 0.283048 0.348360 0.316537 1361.56 1425.69 1.000 pi(G){all} 0.251949 0.000225 0.223052 0.281243 0.251893 1274.55 1328.87 1.000 pi(T){all} 0.220038 0.000206 0.192254 0.247846 0.219814 1312.80 1338.28 1.000 alpha{1,2} 0.416486 0.212900 0.000180 1.331599 0.256380 1115.14 1122.50 1.000 alpha{3} 0.450706 0.227310 0.000373 1.369512 0.292513 1133.21 1200.69 1.001 pinvar{all} 0.998235 0.000004 0.994605 0.999998 0.998881 1156.97 1163.58 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1084.850291 Model 2: PositiveSelection -1084.850255 Model 0: one-ratio -1084.850287 Model 7: beta -1084.850266 Model 8: beta&w>1 -1084.850254 Model 0 vs 1 7.999999979801942E-6 Model 2 vs 1 7.199999981821747E-5 Model 8 vs 7 2.3999999939405825E-5
>C1 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI DIIRSRHLRTVTLNDVFLTTS >C2 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI DIIRSRHLRTVTLNDVFLTTS >C3 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI DIIRSRHLRTVTLNDVFLTTS >C4 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI DIIRSRHLRTVTLNDVFLTTS >C5 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI DIIRSRHLRTVTLNDVFLTTS >C6 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI DIIRSRHLRTVTLNDVFLTTS CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=271 C1 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA C2 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA C3 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA C4 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA C5 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA C6 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA ************************************************** C1 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF C2 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF C3 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF C4 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF C5 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF C6 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF ************************************************** C1 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM C2 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM C3 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM C4 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM C5 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM C6 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM ************************************************** C1 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV C2 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV C3 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV C4 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV C5 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV C6 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV ************************************************** C1 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI C2 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI C3 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI C4 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI C5 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI C6 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI ************************************************** C1 DIIRSRHLRTVTLNDVFLTTS C2 DIIRSRHLRTVTLNDVFLTTS C3 DIIRSRHLRTVTLNDVFLTTS C4 DIIRSRHLRTVTLNDVFLTTS C5 DIIRSRHLRTVTLNDVFLTTS C6 DIIRSRHLRTVTLNDVFLTTS ********************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8130] Library Relaxation: Multi_proc [96] Relaxation Summary: [8130]--->[8130] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.499 Mb, Max= 30.827 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA C2 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA C3 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA C4 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA C5 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA C6 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA ************************************************** C1 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF C2 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF C3 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF C4 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF C5 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF C6 AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF ************************************************** C1 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM C2 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM C3 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM C4 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM C5 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM C6 VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM ************************************************** C1 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV C2 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV C3 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV C4 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV C5 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV C6 TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV ************************************************** C1 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI C2 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI C3 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI C4 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI C5 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI C6 PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI ************************************************** C1 DIIRSRHLRTVTLNDVFLTTS C2 DIIRSRHLRTVTLNDVFLTTS C3 DIIRSRHLRTVTLNDVFLTTS C4 DIIRSRHLRTVTLNDVFLTTS C5 DIIRSRHLRTVTLNDVFLTTS C6 DIIRSRHLRTVTLNDVFLTTS ********************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC C2 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC C3 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC C4 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC C5 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC C6 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC ************************************************** C1 TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA C2 TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA C3 TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA C4 TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA C5 TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA C6 TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA ************************************************** C1 CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC C2 CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC C3 CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC C4 CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC C5 CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC C6 CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC ************************************************** C1 GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG C2 GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG C3 GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG C4 GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG C5 GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG C6 GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG ************************************************** C1 CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA C2 CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA C3 CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA C4 CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA C5 CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA C6 CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA ************************************************** C1 CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT C2 CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT C3 CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT C4 CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT C5 CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT C6 CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT ************************************************** C1 GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA C2 GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA C3 GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA C4 GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA C5 GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA C6 GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA ************************************************** C1 CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC C2 CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC C3 CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC C4 CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC C5 CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC C6 CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC ************************************************** C1 AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG C2 AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG C3 AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG C4 AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG C5 AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG C6 AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG ************************************************** C1 ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA C2 ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA C3 ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA C4 ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA C5 ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA C6 ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA ************************************************** C1 GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA C2 GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA C3 GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA C4 GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA C5 GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA C6 GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA ************************************************** C1 AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT C2 AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT C3 AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT C4 AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT C5 AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT C6 AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT ************************************************** C1 CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA C2 CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA C3 CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA C4 CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA C5 CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA C6 CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA ************************************************** C1 TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA C2 TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA C3 TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA C4 TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA C5 TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA C6 TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA ************************************************** C1 TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC C2 TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC C3 TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC C4 TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC C5 TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC C6 TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC ************************************************** C1 GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT C2 GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT C3 GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT C4 GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT C5 GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT C6 GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT ************************************************** C1 CCTTACAACCTCA C2 CCTTACAACCTCA C3 CCTTACAACCTCA C4 CCTTACAACCTCA C5 CCTTACAACCTCA C6 CCTTACAACCTCA ************* >C1 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT CCTTACAACCTCA >C2 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT CCTTACAACCTCA >C3 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT CCTTACAACCTCA >C4 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT CCTTACAACCTCA >C5 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT CCTTACAACCTCA >C6 GTGTCAGCGCTAAACCGGCGTAGCTTTTTGGGCGCGCTTGCCGTGTCCAC TGTGACCGGCCTCGGCGCAGTACGCCTCGTGGTCGGCCCGCAACCGCGAA CATTCGTCCAAGCGCCGGTGGTTGCCGAGTTGACGCCGACTCCTAACGCC GCAGGTGTATTGCCGCCGCCACCAACGAGTGCACGCATTCCATTGCCTGG CGGTGGTGTGCTATCTAAGATCCCGGGTCGTGGCGATCTGCTTGCTCTTA CCGTCGACGACGGCGTCAATACCGAGGTAGTGCGTTCCTACGTGCAGTTT GTCAAAGACACCGACATACGGCTGACGTTTTTCGTCAACGGAGTCTACGA CTCCTGGACCGACAACATGTCGATGTTGCGACCGTTGGTGGAATCTGGCC AGATCCAACTCGGCAACCACACTTGGTCTCACCCGGATCTGACAGCAATG ACTAAAAGCGAGATAGCCACACAGCTTAACCGCAACGACGACTTCCTGAA GAAGAACTACGGTATCGCCGCGCAACCGTACTGGCGTCCACCGTATGCCA AGCACAACGCCACTGTTGATGCGGTGGCGGTCGATCTCGGCTACACCGTT CCAACCTTATGGTCGGGTTCGCTGTCGGATTCCACGCTGATCACCGAGGA TTACATCGTGAAGATGGCTGACCAGTATTTCACTCCGCAAGCCATCGTGA TCGGACATCTCAACCACCTACCGGTTACCCACGTCTACCCGCAGCTCATC GACATCATCCGTTCACGACATCTTCGTACCGTCACCCTTAATGACGTATT CCTTACAACCTCA >C1 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI DIIRSRHLRTVTLNDVFLTTS >C2 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI DIIRSRHLRTVTLNDVFLTTS >C3 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI DIIRSRHLRTVTLNDVFLTTS >C4 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI DIIRSRHLRTVTLNDVFLTTS >C5 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI DIIRSRHLRTVTLNDVFLTTS >C6 VSALNRRSFLGALAVSTVTGLGAVRLVVGPQPRTFVQAPVVAELTPTPNA AGVLPPPPTSARIPLPGGGVLSKIPGRGDLLALTVDDGVNTEVVRSYVQF VKDTDIRLTFFVNGVYDSWTDNMSMLRPLVESGQIQLGNHTWSHPDLTAM TKSEIATQLNRNDDFLKKNYGIAAQPYWRPPYAKHNATVDAVAVDLGYTV PTLWSGSLSDSTLITEDYIVKMADQYFTPQAIVIGHLNHLPVTHVYPQLI DIIRSRHLRTVTLNDVFLTTS MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 813 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579859780 Setting output file names to "/data/9res/ML2649/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1856861295 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5005490229 Seed = 944052553 Swapseed = 1579859780 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1819.532980 -- -24.965149 Chain 2 -- -1819.532876 -- -24.965149 Chain 3 -- -1819.532980 -- -24.965149 Chain 4 -- -1819.532980 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1819.532980 -- -24.965149 Chain 2 -- -1819.532980 -- -24.965149 Chain 3 -- -1819.532876 -- -24.965149 Chain 4 -- -1819.532980 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1819.533] (-1819.533) (-1819.533) (-1819.533) * [-1819.533] (-1819.533) (-1819.533) (-1819.533) 500 -- [-1129.136] (-1127.362) (-1127.701) (-1135.979) * [-1125.176] (-1137.879) (-1129.305) (-1133.846) -- 0:00:00 1000 -- [-1126.075] (-1137.934) (-1125.654) (-1127.806) * (-1128.454) (-1129.651) [-1120.309] (-1129.123) -- 0:00:00 1500 -- (-1133.688) [-1124.296] (-1125.181) (-1126.860) * (-1133.935) (-1140.483) [-1131.909] (-1130.232) -- 0:00:00 2000 -- (-1125.808) [-1129.543] (-1129.808) (-1126.267) * (-1128.638) (-1131.211) [-1128.209] (-1125.787) -- 0:00:00 2500 -- (-1123.341) (-1130.177) (-1132.891) [-1127.358] * [-1126.195] (-1129.909) (-1128.730) (-1131.170) -- 0:00:00 3000 -- (-1137.727) (-1129.357) (-1129.645) [-1127.957] * [-1123.143] (-1125.783) (-1126.449) (-1122.480) -- 0:00:00 3500 -- (-1124.006) (-1130.333) (-1129.109) [-1127.842] * (-1129.881) (-1132.205) (-1129.478) [-1125.832] -- 0:00:00 4000 -- (-1127.227) (-1133.724) (-1128.814) [-1129.192] * [-1128.781] (-1126.543) (-1130.006) (-1131.653) -- 0:00:00 4500 -- [-1126.394] (-1130.080) (-1128.335) (-1123.294) * (-1128.542) [-1122.971] (-1129.289) (-1134.977) -- 0:00:00 5000 -- (-1123.909) (-1127.740) (-1129.450) [-1120.067] * (-1129.163) (-1128.385) [-1124.197] (-1125.176) -- 0:00:00 Average standard deviation of split frequencies: 0.102138 5500 -- (-1125.123) (-1125.872) [-1126.447] (-1133.193) * (-1127.886) [-1125.261] (-1124.459) (-1131.882) -- 0:00:00 6000 -- [-1128.524] (-1128.693) (-1133.305) (-1127.200) * (-1132.460) (-1133.687) (-1127.918) [-1123.578] -- 0:00:00 6500 -- [-1124.635] (-1123.412) (-1124.618) (-1134.920) * (-1130.918) [-1123.682] (-1124.387) (-1128.499) -- 0:00:00 7000 -- (-1124.125) (-1139.744) [-1126.543] (-1139.417) * (-1131.294) (-1130.191) (-1131.834) [-1121.943] -- 0:00:00 7500 -- (-1125.034) (-1125.890) (-1131.611) [-1121.947] * (-1126.943) [-1123.464] (-1125.656) (-1138.660) -- 0:00:00 8000 -- [-1124.997] (-1124.209) (-1132.398) (-1139.074) * (-1130.949) [-1125.107] (-1128.801) (-1135.000) -- 0:00:00 8500 -- (-1127.961) (-1128.514) [-1127.685] (-1132.168) * (-1126.408) (-1130.780) [-1124.447] (-1129.897) -- 0:00:00 9000 -- [-1126.154] (-1125.992) (-1145.983) (-1123.154) * (-1131.888) [-1131.706] (-1131.995) (-1127.204) -- 0:00:00 9500 -- (-1128.954) (-1127.869) (-1129.673) [-1130.751] * (-1131.926) [-1130.457] (-1130.575) (-1124.886) -- 0:00:00 10000 -- [-1124.831] (-1126.194) (-1138.180) (-1126.340) * (-1123.750) (-1130.813) [-1132.020] (-1129.538) -- 0:00:00 Average standard deviation of split frequencies: 0.088388 10500 -- [-1126.477] (-1123.388) (-1130.591) (-1125.162) * (-1123.891) (-1127.538) (-1131.374) [-1124.131] -- 0:00:00 11000 -- [-1129.572] (-1125.361) (-1126.405) (-1128.293) * [-1123.892] (-1123.351) (-1130.214) (-1128.392) -- 0:00:00 11500 -- (-1131.995) [-1124.675] (-1128.787) (-1130.710) * [-1124.874] (-1126.417) (-1128.479) (-1127.666) -- 0:00:00 12000 -- (-1141.178) [-1125.829] (-1117.658) (-1127.107) * (-1133.959) (-1133.091) (-1133.072) [-1127.071] -- 0:00:00 12500 -- (-1128.559) (-1128.145) (-1118.286) [-1132.672] * (-1127.401) [-1132.983] (-1128.498) (-1126.737) -- 0:00:00 13000 -- (-1132.261) (-1131.674) [-1116.405] (-1130.395) * (-1131.341) (-1138.856) (-1128.613) [-1124.613] -- 0:00:00 13500 -- [-1126.333] (-1125.863) (-1120.806) (-1129.080) * (-1122.504) (-1125.475) (-1126.672) [-1129.854] -- 0:00:00 14000 -- [-1123.686] (-1132.879) (-1119.495) (-1125.893) * (-1126.480) (-1123.249) [-1122.045] (-1138.965) -- 0:00:00 14500 -- (-1123.059) (-1132.336) (-1118.200) [-1128.079] * [-1128.334] (-1133.724) (-1128.800) (-1130.538) -- 0:00:00 15000 -- (-1126.670) (-1124.170) (-1118.599) [-1122.125] * (-1130.344) (-1131.208) (-1131.685) [-1129.840] -- 0:00:00 Average standard deviation of split frequencies: 0.062027 15500 -- (-1128.294) [-1123.296] (-1117.527) (-1130.671) * (-1124.148) (-1124.269) (-1127.232) [-1127.825] -- 0:00:00 16000 -- [-1125.435] (-1133.850) (-1116.717) (-1132.413) * (-1124.860) (-1131.019) [-1124.581] (-1126.217) -- 0:01:01 16500 -- [-1126.847] (-1132.134) (-1119.804) (-1135.077) * (-1130.894) [-1127.842] (-1121.169) (-1127.748) -- 0:00:59 17000 -- [-1126.966] (-1128.076) (-1121.123) (-1127.472) * (-1125.070) [-1123.801] (-1117.487) (-1127.152) -- 0:00:57 17500 -- (-1127.070) [-1120.262] (-1118.686) (-1137.421) * (-1125.573) (-1121.305) (-1118.937) [-1123.513] -- 0:00:56 18000 -- (-1130.059) [-1125.840] (-1116.732) (-1131.837) * [-1126.122] (-1122.130) (-1117.851) (-1128.180) -- 0:00:54 18500 -- (-1126.312) (-1128.380) [-1117.844] (-1128.718) * (-1128.816) [-1119.826] (-1117.740) (-1126.949) -- 0:00:53 19000 -- (-1129.735) [-1122.396] (-1117.163) (-1127.067) * [-1122.049] (-1119.332) (-1118.063) (-1131.412) -- 0:00:51 19500 -- (-1126.129) (-1120.592) (-1119.106) [-1133.243] * (-1131.202) [-1119.990] (-1117.590) (-1127.637) -- 0:00:50 20000 -- (-1129.325) (-1128.032) (-1117.626) [-1126.084] * (-1129.850) (-1120.014) [-1119.477] (-1132.847) -- 0:00:49 Average standard deviation of split frequencies: 0.048303 20500 -- (-1133.664) (-1125.506) [-1116.917] (-1126.247) * (-1123.951) (-1118.384) (-1117.363) [-1126.563] -- 0:00:47 21000 -- (-1135.361) [-1123.009] (-1117.477) (-1125.957) * (-1126.047) (-1119.322) [-1117.194] (-1127.639) -- 0:00:46 21500 -- (-1126.812) (-1128.883) (-1118.504) [-1123.620] * (-1136.198) (-1117.543) (-1117.891) [-1121.935] -- 0:00:45 22000 -- (-1124.965) (-1129.951) (-1117.222) [-1129.725] * (-1137.875) (-1119.980) [-1118.063] (-1126.810) -- 0:00:44 22500 -- (-1130.301) [-1121.409] (-1119.155) (-1125.841) * (-1134.279) (-1122.345) [-1118.196] (-1131.928) -- 0:00:43 23000 -- (-1134.645) [-1130.599] (-1117.665) (-1128.585) * [-1128.899] (-1119.795) (-1120.099) (-1130.334) -- 0:00:42 23500 -- (-1124.139) (-1123.195) (-1117.937) [-1125.339] * (-1137.000) (-1118.125) (-1119.967) [-1130.327] -- 0:00:41 24000 -- [-1127.306] (-1132.532) (-1118.487) (-1123.810) * [-1126.955] (-1118.864) (-1118.153) (-1121.356) -- 0:00:40 24500 -- [-1127.070] (-1130.771) (-1119.580) (-1132.230) * (-1136.377) (-1119.323) [-1117.483] (-1117.487) -- 0:00:39 25000 -- (-1136.575) (-1124.911) [-1117.147] (-1134.620) * (-1128.802) [-1119.145] (-1131.268) (-1117.347) -- 0:00:39 Average standard deviation of split frequencies: 0.043896 25500 -- (-1132.359) (-1126.952) (-1116.858) [-1120.528] * (-1133.434) (-1119.532) [-1121.891] (-1116.526) -- 0:00:38 26000 -- (-1128.843) [-1131.186] (-1120.460) (-1132.179) * (-1127.882) [-1118.937] (-1118.238) (-1117.998) -- 0:00:37 26500 -- (-1125.131) (-1130.132) [-1117.164] (-1128.847) * (-1122.189) [-1117.351] (-1120.277) (-1118.578) -- 0:00:36 27000 -- (-1133.966) (-1126.670) (-1119.938) [-1129.598] * [-1123.116] (-1119.402) (-1119.426) (-1117.558) -- 0:00:36 27500 -- (-1132.623) [-1126.748] (-1118.291) (-1123.317) * (-1121.904) [-1119.804] (-1121.466) (-1118.044) -- 0:00:35 28000 -- (-1128.866) [-1126.347] (-1117.760) (-1120.424) * [-1136.291] (-1120.613) (-1118.479) (-1117.978) -- 0:00:34 28500 -- (-1127.410) [-1121.153] (-1117.592) (-1136.453) * (-1123.868) (-1120.862) (-1117.667) [-1117.088] -- 0:00:34 29000 -- [-1122.035] (-1131.236) (-1119.405) (-1125.281) * (-1129.011) (-1120.662) (-1117.294) [-1117.109] -- 0:00:33 29500 -- (-1131.955) (-1130.058) [-1119.967] (-1123.526) * (-1133.136) (-1121.162) (-1119.042) [-1118.194] -- 0:00:32 30000 -- (-1126.584) (-1123.431) [-1119.433] (-1135.075) * (-1129.729) (-1119.304) [-1120.058] (-1119.830) -- 0:00:32 Average standard deviation of split frequencies: 0.047734 30500 -- (-1130.537) (-1131.281) (-1125.961) [-1125.346] * [-1127.288] (-1119.005) (-1121.748) (-1118.272) -- 0:00:31 31000 -- (-1126.527) [-1124.737] (-1121.615) (-1132.970) * [-1126.755] (-1123.357) (-1124.494) (-1117.116) -- 0:00:31 31500 -- (-1124.995) (-1124.599) [-1119.834] (-1134.785) * [-1127.279] (-1119.747) (-1124.755) (-1117.221) -- 0:00:30 32000 -- (-1127.591) (-1121.702) [-1116.945] (-1127.278) * [-1125.465] (-1116.556) (-1121.886) (-1116.632) -- 0:00:30 32500 -- (-1130.700) (-1125.459) [-1117.453] (-1127.446) * (-1131.470) (-1123.053) [-1119.653] (-1117.981) -- 0:00:59 33000 -- [-1128.062] (-1126.053) (-1120.460) (-1134.633) * (-1133.572) [-1118.586] (-1121.165) (-1118.258) -- 0:00:58 33500 -- (-1128.711) (-1120.974) (-1118.690) [-1129.876] * (-1129.440) [-1117.764] (-1124.399) (-1121.326) -- 0:00:57 34000 -- (-1127.876) (-1134.027) (-1116.491) [-1126.609] * (-1131.621) (-1117.415) (-1117.413) [-1122.980] -- 0:00:56 34500 -- [-1126.573] (-1128.996) (-1118.683) (-1134.033) * [-1129.443] (-1117.324) (-1116.596) (-1121.970) -- 0:00:55 35000 -- (-1140.415) (-1129.880) [-1116.322] (-1127.065) * [-1124.522] (-1120.033) (-1117.245) (-1119.691) -- 0:00:55 Average standard deviation of split frequencies: 0.047286 35500 -- [-1122.550] (-1132.235) (-1116.458) (-1125.847) * [-1122.026] (-1118.592) (-1117.654) (-1117.882) -- 0:00:54 36000 -- (-1126.719) (-1123.875) (-1116.901) [-1126.692] * (-1131.868) (-1116.428) [-1116.550] (-1118.477) -- 0:00:53 36500 -- [-1127.034] (-1132.106) (-1117.953) (-1123.989) * [-1127.155] (-1116.438) (-1119.620) (-1118.957) -- 0:00:52 37000 -- [-1120.543] (-1131.527) (-1117.177) (-1129.852) * (-1131.810) [-1116.931] (-1116.654) (-1117.754) -- 0:00:52 37500 -- (-1129.183) (-1137.316) [-1117.739] (-1133.356) * (-1132.190) [-1117.484] (-1119.805) (-1117.936) -- 0:00:51 38000 -- (-1128.535) [-1125.471] (-1119.481) (-1131.877) * (-1126.256) (-1117.511) (-1117.002) [-1123.520] -- 0:00:50 38500 -- (-1124.456) (-1135.440) [-1117.957] (-1128.851) * (-1127.198) [-1116.664] (-1117.687) (-1121.950) -- 0:00:49 39000 -- (-1126.962) (-1123.927) [-1118.784] (-1118.428) * (-1130.691) (-1124.812) [-1116.814] (-1121.141) -- 0:00:49 39500 -- [-1123.914] (-1125.345) (-1118.423) (-1118.510) * (-1130.819) (-1119.012) [-1117.659] (-1121.471) -- 0:00:48 40000 -- (-1130.980) [-1126.067] (-1121.119) (-1120.629) * (-1127.315) [-1117.167] (-1119.505) (-1121.896) -- 0:00:48 Average standard deviation of split frequencies: 0.043148 40500 -- (-1125.124) [-1125.648] (-1120.159) (-1118.315) * [-1128.982] (-1117.172) (-1120.860) (-1121.566) -- 0:00:47 41000 -- (-1127.643) (-1132.495) (-1121.793) [-1116.208] * (-1133.322) (-1117.407) [-1118.104] (-1118.329) -- 0:00:46 41500 -- (-1130.411) [-1125.413] (-1117.027) (-1116.379) * (-1130.067) (-1119.057) (-1117.647) [-1116.614] -- 0:00:46 42000 -- [-1119.917] (-1128.272) (-1116.684) (-1117.392) * (-1131.905) (-1120.216) [-1117.879] (-1119.406) -- 0:00:45 42500 -- (-1124.575) [-1127.847] (-1116.935) (-1117.761) * (-1132.816) (-1122.463) (-1116.518) [-1119.808] -- 0:00:45 43000 -- [-1129.053] (-1134.566) (-1118.256) (-1116.729) * (-1127.888) (-1118.181) [-1118.788] (-1125.091) -- 0:00:44 43500 -- (-1126.022) (-1131.437) [-1122.282] (-1117.192) * (-1129.761) [-1116.873] (-1117.662) (-1125.404) -- 0:00:43 44000 -- [-1125.432] (-1128.695) (-1116.762) (-1117.482) * (-1134.019) [-1117.431] (-1118.301) (-1123.861) -- 0:00:43 44500 -- (-1126.988) [-1124.947] (-1118.265) (-1119.656) * (-1131.233) [-1116.680] (-1121.167) (-1117.809) -- 0:00:42 45000 -- (-1127.821) [-1125.289] (-1117.479) (-1118.507) * [-1126.313] (-1117.729) (-1116.530) (-1120.959) -- 0:00:42 Average standard deviation of split frequencies: 0.032696 45500 -- [-1127.957] (-1124.428) (-1121.717) (-1117.211) * [-1121.826] (-1117.478) (-1118.390) (-1116.385) -- 0:00:41 46000 -- (-1136.930) (-1127.147) (-1120.507) [-1119.192] * (-1127.853) [-1118.143] (-1118.129) (-1119.748) -- 0:00:41 46500 -- (-1127.765) [-1118.041] (-1126.234) (-1118.422) * (-1131.633) (-1117.613) [-1116.875] (-1116.682) -- 0:00:41 47000 -- (-1129.703) [-1117.514] (-1122.197) (-1118.099) * (-1129.486) (-1117.788) [-1117.071] (-1117.537) -- 0:00:40 47500 -- (-1126.876) (-1120.002) [-1119.443] (-1118.303) * (-1126.906) [-1117.788] (-1117.536) (-1116.520) -- 0:00:40 48000 -- (-1133.408) [-1117.345] (-1119.360) (-1119.795) * (-1141.612) (-1118.529) [-1119.441] (-1116.879) -- 0:00:39 48500 -- (-1127.672) [-1117.632] (-1117.314) (-1119.151) * (-1128.442) [-1117.944] (-1117.266) (-1116.729) -- 0:00:39 49000 -- [-1124.021] (-1118.690) (-1120.689) (-1117.291) * (-1136.939) (-1118.899) (-1119.477) [-1117.458] -- 0:00:58 49500 -- (-1134.038) [-1117.260] (-1121.894) (-1116.747) * [-1121.090] (-1119.683) (-1117.782) (-1119.734) -- 0:00:57 50000 -- (-1135.405) [-1120.085] (-1119.695) (-1119.019) * (-1117.527) (-1117.017) [-1117.480] (-1121.772) -- 0:00:57 Average standard deviation of split frequencies: 0.026982 50500 -- [-1125.111] (-1123.031) (-1119.966) (-1117.480) * [-1118.869] (-1119.069) (-1116.489) (-1121.177) -- 0:00:56 51000 -- (-1125.787) (-1121.522) [-1119.528] (-1118.587) * (-1120.174) (-1116.783) [-1119.000] (-1120.416) -- 0:00:55 51500 -- (-1125.152) (-1117.815) (-1121.725) [-1116.830] * (-1119.691) [-1116.598] (-1118.296) (-1121.517) -- 0:00:55 52000 -- (-1123.110) (-1119.043) (-1117.347) [-1116.442] * (-1119.143) [-1117.188] (-1118.986) (-1121.436) -- 0:00:54 52500 -- [-1133.346] (-1117.398) (-1118.784) (-1116.797) * (-1119.450) [-1116.546] (-1118.359) (-1121.019) -- 0:00:54 53000 -- (-1131.295) (-1117.443) (-1121.395) [-1116.798] * (-1121.575) [-1117.794] (-1118.534) (-1120.619) -- 0:00:53 53500 -- (-1138.351) [-1117.461] (-1117.672) (-1118.452) * (-1118.179) (-1118.861) (-1117.207) [-1117.576] -- 0:00:53 54000 -- [-1129.423] (-1118.522) (-1120.863) (-1120.188) * (-1119.159) (-1118.391) [-1120.120] (-1119.870) -- 0:00:52 54500 -- (-1136.480) (-1121.135) [-1121.110] (-1117.143) * (-1118.391) [-1117.176] (-1118.364) (-1121.048) -- 0:00:52 55000 -- (-1123.181) [-1120.500] (-1120.136) (-1117.515) * (-1117.480) (-1117.544) (-1118.845) [-1118.076] -- 0:00:51 Average standard deviation of split frequencies: 0.034115 55500 -- (-1123.220) (-1119.745) [-1119.067] (-1118.467) * (-1119.718) (-1118.743) [-1117.481] (-1117.032) -- 0:00:51 56000 -- (-1122.786) (-1118.454) [-1117.217] (-1118.506) * (-1123.702) (-1121.786) [-1117.612] (-1118.097) -- 0:00:50 56500 -- (-1117.993) [-1118.299] (-1119.910) (-1119.795) * (-1121.068) [-1118.475] (-1120.840) (-1118.682) -- 0:00:50 57000 -- (-1118.541) [-1117.777] (-1118.694) (-1120.066) * (-1121.117) (-1116.999) (-1117.758) [-1117.123] -- 0:00:49 57500 -- (-1123.768) [-1117.987] (-1119.525) (-1117.407) * (-1121.821) (-1119.953) [-1117.760] (-1118.123) -- 0:00:49 58000 -- (-1120.591) (-1117.390) [-1117.549] (-1117.808) * (-1118.018) (-1118.922) [-1116.140] (-1118.542) -- 0:00:48 58500 -- (-1117.488) (-1121.625) (-1119.097) [-1116.760] * (-1121.328) (-1117.164) (-1116.140) [-1117.584] -- 0:00:48 59000 -- [-1116.345] (-1118.202) (-1119.171) (-1117.065) * (-1122.996) (-1119.340) [-1117.777] (-1122.186) -- 0:00:47 59500 -- (-1116.278) (-1116.776) (-1125.338) [-1118.889] * (-1123.128) [-1116.941] (-1118.639) (-1119.927) -- 0:00:47 60000 -- (-1118.239) (-1118.770) (-1118.066) [-1117.235] * (-1122.818) (-1117.973) (-1116.904) [-1117.012] -- 0:00:47 Average standard deviation of split frequencies: 0.026333 60500 -- (-1116.657) [-1118.443] (-1117.428) (-1119.849) * (-1117.489) [-1119.785] (-1116.821) (-1119.174) -- 0:00:46 61000 -- (-1117.952) (-1117.535) [-1119.157] (-1117.876) * (-1117.091) [-1119.198] (-1116.134) (-1117.928) -- 0:00:46 61500 -- (-1118.283) (-1117.397) (-1118.217) [-1119.932] * (-1117.003) (-1116.684) [-1117.747] (-1118.129) -- 0:00:45 62000 -- (-1120.384) (-1118.243) [-1117.434] (-1118.855) * [-1117.997] (-1117.123) (-1117.234) (-1116.292) -- 0:00:45 62500 -- (-1120.433) (-1117.828) [-1117.648] (-1117.009) * [-1118.802] (-1118.453) (-1121.030) (-1116.509) -- 0:00:45 63000 -- (-1118.893) (-1123.225) [-1119.611] (-1118.238) * (-1119.777) (-1118.928) (-1117.584) [-1116.504] -- 0:00:44 63500 -- [-1120.660] (-1117.034) (-1118.338) (-1117.065) * (-1117.217) [-1118.719] (-1117.820) (-1116.934) -- 0:00:44 64000 -- (-1119.864) (-1119.878) [-1123.549] (-1116.763) * (-1117.657) (-1120.876) [-1117.345] (-1117.433) -- 0:00:58 64500 -- [-1118.825] (-1117.723) (-1118.926) (-1119.325) * (-1116.928) (-1117.708) [-1117.875] (-1117.657) -- 0:00:58 65000 -- [-1118.024] (-1118.390) (-1118.731) (-1119.585) * [-1116.372] (-1118.677) (-1116.973) (-1118.787) -- 0:00:57 Average standard deviation of split frequencies: 0.023683 65500 -- (-1117.614) (-1117.525) [-1118.363] (-1116.791) * (-1118.150) [-1120.607] (-1116.270) (-1117.263) -- 0:00:57 66000 -- (-1120.994) (-1117.919) (-1119.851) [-1118.145] * [-1117.589] (-1122.022) (-1116.895) (-1119.224) -- 0:00:56 66500 -- (-1117.538) [-1117.139] (-1118.760) (-1120.611) * [-1117.897] (-1118.637) (-1117.184) (-1120.173) -- 0:00:56 67000 -- (-1118.611) (-1122.943) (-1120.341) [-1120.154] * (-1116.649) [-1120.648] (-1117.275) (-1119.751) -- 0:00:55 67500 -- (-1117.485) (-1119.062) [-1119.174] (-1119.194) * (-1120.472) (-1119.101) (-1117.919) [-1118.127] -- 0:00:55 68000 -- (-1123.271) [-1119.601] (-1120.649) (-1117.740) * (-1119.353) (-1119.159) (-1117.530) [-1119.057] -- 0:00:54 68500 -- (-1121.899) [-1116.886] (-1121.654) (-1117.505) * (-1117.521) (-1118.005) [-1116.270] (-1118.119) -- 0:00:54 69000 -- [-1117.499] (-1118.483) (-1118.494) (-1116.815) * (-1117.716) (-1119.849) (-1116.647) [-1119.494] -- 0:00:53 69500 -- (-1122.148) [-1118.651] (-1125.092) (-1118.793) * (-1121.038) (-1121.198) [-1116.807] (-1119.221) -- 0:00:53 70000 -- (-1120.254) [-1117.002] (-1118.004) (-1119.858) * (-1121.645) [-1125.134] (-1119.203) (-1120.003) -- 0:00:53 Average standard deviation of split frequencies: 0.021347 70500 -- (-1118.062) (-1118.029) (-1119.706) [-1119.555] * (-1121.825) (-1118.555) (-1117.796) [-1119.577] -- 0:00:52 71000 -- (-1119.982) [-1117.425] (-1120.199) (-1116.730) * (-1116.917) (-1119.617) (-1119.121) [-1117.153] -- 0:00:52 71500 -- (-1119.115) [-1117.353] (-1120.543) (-1116.869) * (-1122.031) (-1119.991) (-1119.593) [-1118.163] -- 0:00:51 72000 -- (-1117.960) (-1117.951) (-1118.386) [-1117.674] * (-1122.842) (-1122.305) (-1117.803) [-1118.077] -- 0:00:51 72500 -- (-1118.888) [-1117.476] (-1117.921) (-1118.438) * (-1119.559) (-1122.454) [-1117.778] (-1118.998) -- 0:00:51 73000 -- [-1116.866] (-1117.202) (-1118.714) (-1118.313) * (-1122.023) (-1118.517) [-1117.243] (-1119.534) -- 0:00:50 73500 -- (-1116.466) (-1116.947) [-1117.410] (-1118.735) * (-1122.765) [-1119.503] (-1118.118) (-1125.269) -- 0:00:50 74000 -- (-1116.849) [-1117.043] (-1117.371) (-1117.517) * [-1117.764] (-1119.417) (-1117.951) (-1121.204) -- 0:00:50 74500 -- [-1117.716] (-1117.799) (-1118.622) (-1120.847) * [-1116.995] (-1119.936) (-1121.416) (-1121.857) -- 0:00:49 75000 -- (-1120.615) (-1119.019) (-1118.387) [-1118.684] * (-1116.728) (-1120.770) [-1117.868] (-1121.628) -- 0:00:49 Average standard deviation of split frequencies: 0.019538 75500 -- (-1121.411) (-1120.160) (-1119.118) [-1117.908] * (-1120.793) (-1117.115) (-1117.444) [-1120.924] -- 0:00:48 76000 -- (-1120.304) (-1118.541) [-1117.400] (-1117.347) * (-1117.886) (-1117.488) [-1119.315] (-1117.281) -- 0:00:48 76500 -- (-1118.957) [-1118.938] (-1116.665) (-1117.309) * [-1118.719] (-1117.617) (-1119.367) (-1117.308) -- 0:00:48 77000 -- (-1118.181) [-1117.661] (-1116.570) (-1118.471) * (-1118.801) (-1117.851) (-1119.399) [-1118.845] -- 0:00:47 77500 -- (-1122.589) (-1117.946) [-1117.719] (-1119.262) * (-1118.331) [-1116.355] (-1118.271) (-1121.439) -- 0:00:47 78000 -- [-1118.157] (-1118.476) (-1121.834) (-1118.063) * [-1118.644] (-1117.952) (-1116.852) (-1120.416) -- 0:00:47 78500 -- (-1121.937) [-1116.670] (-1122.040) (-1117.698) * (-1119.197) [-1119.823] (-1119.083) (-1121.154) -- 0:00:46 79000 -- (-1120.559) [-1116.951] (-1118.210) (-1119.238) * [-1118.098] (-1119.901) (-1116.950) (-1121.217) -- 0:00:46 79500 -- (-1120.193) [-1116.922] (-1117.972) (-1116.947) * [-1117.920] (-1119.512) (-1119.184) (-1119.764) -- 0:00:57 80000 -- (-1120.375) (-1117.743) (-1122.986) [-1117.000] * [-1118.891] (-1119.531) (-1116.689) (-1119.098) -- 0:00:57 Average standard deviation of split frequencies: 0.017856 80500 -- (-1120.475) (-1116.809) [-1116.979] (-1118.756) * (-1118.513) (-1117.946) [-1117.367] (-1119.444) -- 0:00:57 81000 -- (-1119.426) [-1116.845] (-1116.435) (-1120.628) * [-1117.320] (-1118.544) (-1121.742) (-1119.176) -- 0:00:56 81500 -- (-1118.738) [-1117.188] (-1117.331) (-1118.397) * (-1119.940) [-1117.939] (-1121.351) (-1119.226) -- 0:00:56 82000 -- [-1117.918] (-1117.253) (-1116.688) (-1118.148) * (-1119.028) (-1117.402) [-1119.847] (-1119.866) -- 0:00:55 82500 -- (-1118.938) [-1116.459] (-1118.642) (-1116.553) * [-1118.307] (-1117.406) (-1118.476) (-1120.003) -- 0:00:55 83000 -- [-1118.798] (-1116.978) (-1117.799) (-1118.228) * [-1118.366] (-1118.931) (-1119.908) (-1118.109) -- 0:00:55 83500 -- (-1118.453) (-1116.947) [-1118.912] (-1118.398) * (-1123.488) (-1117.512) [-1116.852] (-1120.231) -- 0:00:54 84000 -- [-1120.310] (-1118.449) (-1118.060) (-1124.736) * (-1118.296) (-1120.113) [-1117.633] (-1118.474) -- 0:00:54 84500 -- (-1120.857) (-1121.054) [-1117.861] (-1118.952) * (-1118.267) (-1117.774) (-1118.477) [-1117.973] -- 0:00:54 85000 -- (-1118.188) (-1117.386) [-1116.815] (-1117.380) * (-1119.197) [-1120.122] (-1117.888) (-1118.958) -- 0:00:53 Average standard deviation of split frequencies: 0.018363 85500 -- (-1116.863) [-1117.429] (-1118.520) (-1119.686) * [-1118.835] (-1117.707) (-1117.966) (-1118.255) -- 0:00:53 86000 -- (-1119.781) (-1118.127) [-1118.802] (-1120.190) * (-1122.221) [-1124.019] (-1120.141) (-1119.477) -- 0:00:53 86500 -- (-1118.941) (-1120.547) (-1117.936) [-1116.571] * [-1117.674] (-1124.104) (-1117.140) (-1117.358) -- 0:00:52 87000 -- [-1117.520] (-1123.767) (-1118.601) (-1116.574) * (-1117.438) (-1118.597) (-1118.765) [-1118.979] -- 0:00:52 87500 -- (-1119.465) (-1123.703) [-1119.836] (-1120.361) * (-1118.614) [-1119.525] (-1119.877) (-1124.389) -- 0:00:52 88000 -- (-1121.388) (-1118.670) (-1117.817) [-1119.861] * (-1118.875) [-1119.142] (-1118.415) (-1118.983) -- 0:00:51 88500 -- (-1122.239) [-1117.466] (-1116.894) (-1117.907) * [-1116.369] (-1117.410) (-1120.961) (-1122.632) -- 0:00:51 89000 -- [-1122.216] (-1116.340) (-1117.567) (-1117.210) * (-1119.182) (-1117.231) (-1118.234) [-1119.117] -- 0:00:51 89500 -- [-1120.282] (-1116.296) (-1117.955) (-1117.932) * [-1120.570] (-1118.045) (-1118.460) (-1116.774) -- 0:00:50 90000 -- (-1120.329) [-1116.102] (-1117.112) (-1116.940) * (-1121.379) (-1120.312) (-1120.627) [-1116.632] -- 0:00:50 Average standard deviation of split frequencies: 0.016145 90500 -- (-1123.651) [-1117.066] (-1116.367) (-1121.522) * (-1118.272) (-1119.088) (-1121.048) [-1117.417] -- 0:00:50 91000 -- (-1120.234) [-1118.177] (-1116.705) (-1117.610) * (-1120.400) (-1119.073) (-1117.464) [-1117.262] -- 0:00:49 91500 -- (-1119.783) (-1120.640) (-1116.646) [-1118.033] * [-1120.448] (-1117.402) (-1119.207) (-1117.907) -- 0:00:49 92000 -- (-1117.291) (-1119.733) [-1116.849] (-1118.116) * (-1121.166) (-1119.532) [-1118.556] (-1118.004) -- 0:00:49 92500 -- [-1118.312] (-1117.709) (-1118.200) (-1122.866) * [-1120.000] (-1117.187) (-1123.361) (-1118.407) -- 0:00:49 93000 -- (-1119.763) (-1119.586) (-1118.857) [-1120.937] * (-1117.880) (-1118.240) (-1118.244) [-1117.617] -- 0:00:48 93500 -- (-1118.279) (-1119.032) (-1117.437) [-1118.154] * (-1118.971) (-1118.542) [-1118.878] (-1117.939) -- 0:00:48 94000 -- [-1118.306] (-1121.272) (-1119.075) (-1119.741) * (-1117.418) (-1119.837) [-1119.462] (-1118.349) -- 0:00:48 94500 -- [-1119.698] (-1117.102) (-1118.647) (-1117.459) * (-1117.397) [-1120.593] (-1121.366) (-1119.702) -- 0:00:47 95000 -- [-1125.939] (-1117.110) (-1116.814) (-1119.078) * (-1116.833) (-1121.329) [-1121.726] (-1119.418) -- 0:00:47 Average standard deviation of split frequencies: 0.017732 95500 -- (-1122.452) (-1117.080) (-1118.084) [-1119.779] * (-1118.721) (-1117.790) [-1121.497] (-1120.446) -- 0:00:56 96000 -- (-1123.346) [-1118.318] (-1117.317) (-1118.500) * (-1123.991) (-1118.743) (-1118.642) [-1124.236] -- 0:00:56 96500 -- (-1122.582) (-1120.799) (-1120.821) [-1121.524] * [-1118.858] (-1118.735) (-1117.537) (-1122.376) -- 0:00:56 97000 -- (-1119.732) (-1117.718) (-1120.180) [-1121.531] * (-1121.543) (-1119.152) [-1120.205] (-1119.766) -- 0:00:55 97500 -- (-1117.523) (-1117.915) (-1117.293) [-1118.482] * (-1119.694) (-1119.187) (-1118.421) [-1117.548] -- 0:00:55 98000 -- (-1121.505) (-1116.739) [-1118.848] (-1119.758) * (-1118.154) (-1119.713) (-1117.878) [-1120.244] -- 0:00:55 98500 -- (-1121.532) (-1116.759) (-1118.492) [-1121.671] * (-1121.693) [-1117.060] (-1118.336) (-1117.386) -- 0:00:54 99000 -- (-1117.847) (-1118.311) (-1120.879) [-1120.771] * (-1116.688) (-1120.199) [-1119.599] (-1120.902) -- 0:00:54 99500 -- [-1116.979] (-1117.308) (-1117.401) (-1123.587) * (-1117.646) [-1117.461] (-1124.441) (-1121.980) -- 0:00:54 100000 -- (-1116.958) [-1116.729] (-1122.813) (-1117.710) * (-1120.609) (-1117.013) [-1117.664] (-1124.579) -- 0:00:54 Average standard deviation of split frequencies: 0.017431 100500 -- (-1116.400) (-1117.484) (-1116.771) [-1117.043] * [-1118.492] (-1117.671) (-1117.480) (-1121.294) -- 0:00:53 101000 -- (-1118.914) [-1117.811] (-1120.158) (-1118.198) * (-1120.586) [-1117.920] (-1117.058) (-1119.992) -- 0:00:53 101500 -- (-1118.310) [-1117.897] (-1120.752) (-1118.725) * (-1118.632) (-1119.831) [-1120.543] (-1117.217) -- 0:00:53 102000 -- [-1119.113] (-1118.450) (-1118.176) (-1120.532) * (-1118.581) [-1118.442] (-1120.623) (-1120.439) -- 0:00:52 102500 -- (-1120.452) (-1118.637) (-1119.133) [-1118.495] * (-1118.781) (-1119.250) [-1119.556] (-1122.115) -- 0:00:52 103000 -- [-1116.818] (-1117.617) (-1117.107) (-1121.870) * (-1122.762) (-1116.952) (-1117.847) [-1121.537] -- 0:00:52 103500 -- [-1116.825] (-1116.982) (-1116.795) (-1122.068) * (-1121.800) [-1118.109] (-1117.667) (-1120.965) -- 0:00:51 104000 -- (-1117.676) (-1117.460) [-1116.560] (-1120.603) * (-1118.917) (-1120.248) (-1118.709) [-1121.514] -- 0:00:51 104500 -- (-1116.805) [-1117.367] (-1117.071) (-1122.297) * [-1119.487] (-1116.931) (-1120.089) (-1121.581) -- 0:00:51 105000 -- (-1117.035) [-1116.958] (-1116.762) (-1117.466) * [-1118.260] (-1119.366) (-1119.946) (-1120.787) -- 0:00:51 Average standard deviation of split frequencies: 0.020235 105500 -- [-1117.915] (-1117.138) (-1117.240) (-1116.732) * [-1116.951] (-1117.649) (-1120.706) (-1124.014) -- 0:00:50 106000 -- (-1118.196) [-1118.981] (-1121.023) (-1118.667) * (-1118.347) [-1122.509] (-1122.006) (-1120.864) -- 0:00:50 106500 -- (-1121.595) (-1118.274) (-1120.823) [-1117.786] * (-1117.344) (-1120.844) [-1117.668] (-1119.664) -- 0:00:50 107000 -- (-1117.012) [-1120.027] (-1118.965) (-1118.518) * (-1116.945) (-1118.270) [-1120.079] (-1122.089) -- 0:00:50 107500 -- [-1119.301] (-1117.396) (-1116.970) (-1121.487) * (-1118.609) [-1118.248] (-1122.129) (-1119.210) -- 0:00:49 108000 -- [-1117.130] (-1117.964) (-1119.715) (-1118.191) * (-1118.097) [-1116.977] (-1121.127) (-1116.577) -- 0:00:49 108500 -- (-1116.963) (-1120.104) (-1116.867) [-1118.112] * (-1119.063) [-1117.693] (-1119.871) (-1118.450) -- 0:00:49 109000 -- [-1119.036] (-1117.409) (-1118.287) (-1118.207) * (-1127.310) (-1116.801) (-1122.833) [-1118.503] -- 0:00:49 109500 -- (-1116.465) (-1121.044) (-1120.448) [-1120.760] * (-1119.475) (-1117.823) [-1118.715] (-1122.282) -- 0:00:48 110000 -- [-1119.977] (-1116.911) (-1119.184) (-1120.676) * [-1119.356] (-1117.734) (-1117.968) (-1121.568) -- 0:00:48 Average standard deviation of split frequencies: 0.022955 110500 -- (-1120.557) (-1117.930) [-1117.217] (-1118.630) * [-1117.377] (-1122.204) (-1118.146) (-1121.197) -- 0:00:48 111000 -- (-1118.626) [-1117.221] (-1116.821) (-1121.513) * (-1118.506) [-1117.691] (-1117.902) (-1119.599) -- 0:00:48 111500 -- (-1121.934) (-1117.580) (-1119.978) [-1120.677] * (-1122.409) [-1117.959] (-1116.635) (-1120.728) -- 0:00:55 112000 -- (-1119.841) (-1117.122) (-1117.461) [-1121.631] * (-1121.262) [-1117.430] (-1118.236) (-1121.788) -- 0:00:55 112500 -- [-1117.525] (-1119.113) (-1117.115) (-1117.193) * (-1116.833) (-1120.153) (-1119.038) [-1117.897] -- 0:00:55 113000 -- (-1121.408) [-1121.538] (-1118.849) (-1118.215) * (-1119.535) (-1118.238) (-1117.289) [-1118.608] -- 0:00:54 113500 -- [-1117.576] (-1120.097) (-1121.600) (-1120.104) * (-1119.207) (-1120.114) [-1117.341] (-1117.561) -- 0:00:54 114000 -- [-1118.024] (-1117.697) (-1119.266) (-1116.671) * [-1120.375] (-1118.815) (-1116.580) (-1117.749) -- 0:00:54 114500 -- (-1119.683) [-1116.594] (-1117.976) (-1118.077) * (-1119.422) (-1120.111) (-1116.336) [-1117.445] -- 0:00:54 115000 -- (-1122.584) (-1118.616) [-1118.608] (-1117.633) * (-1118.817) (-1118.660) (-1116.667) [-1117.639] -- 0:00:53 Average standard deviation of split frequencies: 0.021602 115500 -- (-1120.310) (-1118.537) (-1119.775) [-1118.542] * (-1119.360) [-1120.245] (-1116.925) (-1118.797) -- 0:00:53 116000 -- (-1119.634) [-1116.367] (-1119.175) (-1117.695) * (-1117.957) [-1117.310] (-1117.378) (-1118.200) -- 0:00:53 116500 -- (-1119.646) (-1116.384) (-1117.818) [-1117.691] * (-1117.317) (-1120.054) (-1116.738) [-1118.101] -- 0:00:53 117000 -- (-1118.568) (-1116.875) [-1118.034] (-1130.161) * (-1119.153) (-1117.596) [-1119.538] (-1118.427) -- 0:00:52 117500 -- (-1120.341) (-1117.943) [-1116.852] (-1123.294) * (-1119.377) (-1120.041) [-1117.755] (-1118.439) -- 0:00:52 118000 -- (-1119.889) [-1116.738] (-1118.362) (-1120.399) * (-1118.366) [-1117.230] (-1117.060) (-1119.775) -- 0:00:52 118500 -- [-1119.005] (-1117.789) (-1118.341) (-1118.036) * [-1119.890] (-1120.298) (-1120.511) (-1122.680) -- 0:00:52 119000 -- (-1118.888) (-1117.441) (-1119.854) [-1118.215] * (-1122.332) (-1117.902) (-1118.056) [-1117.937] -- 0:00:51 119500 -- [-1117.999] (-1118.750) (-1120.278) (-1120.069) * (-1118.992) (-1118.159) [-1119.180] (-1119.223) -- 0:00:51 120000 -- (-1118.551) (-1118.807) (-1126.017) [-1117.670] * [-1117.891] (-1119.837) (-1126.149) (-1118.684) -- 0:00:51 Average standard deviation of split frequencies: 0.023029 120500 -- (-1116.286) (-1117.745) (-1120.429) [-1119.703] * [-1117.591] (-1122.124) (-1119.652) (-1122.075) -- 0:00:51 121000 -- (-1116.286) (-1118.197) [-1120.819] (-1117.562) * (-1118.985) (-1116.863) [-1118.126] (-1118.713) -- 0:00:50 121500 -- (-1118.944) (-1118.905) [-1122.951] (-1116.675) * (-1118.134) (-1117.341) [-1117.738] (-1116.534) -- 0:00:50 122000 -- [-1117.642] (-1118.565) (-1120.022) (-1119.033) * (-1117.605) (-1118.823) [-1118.298] (-1118.216) -- 0:00:50 122500 -- (-1117.933) [-1121.168] (-1119.305) (-1119.274) * [-1116.978] (-1118.510) (-1121.394) (-1119.640) -- 0:00:50 123000 -- (-1117.067) (-1122.982) (-1118.461) [-1119.104] * (-1119.059) [-1119.818] (-1118.306) (-1117.588) -- 0:00:49 123500 -- (-1118.176) (-1119.417) [-1119.145] (-1123.053) * (-1120.850) [-1118.918] (-1118.775) (-1119.356) -- 0:00:49 124000 -- (-1119.056) [-1120.346] (-1119.420) (-1119.006) * (-1118.485) [-1119.613] (-1120.719) (-1117.759) -- 0:00:49 124500 -- (-1118.348) [-1117.335] (-1116.859) (-1118.339) * (-1117.368) [-1121.270] (-1117.516) (-1118.735) -- 0:00:49 125000 -- (-1118.296) [-1120.180] (-1119.609) (-1120.164) * (-1116.339) (-1118.016) (-1117.410) [-1120.227] -- 0:00:49 Average standard deviation of split frequencies: 0.023196 125500 -- (-1121.111) (-1116.370) (-1118.900) [-1118.401] * (-1118.411) [-1119.634] (-1117.526) (-1118.138) -- 0:00:48 126000 -- (-1120.518) (-1116.406) (-1117.124) [-1118.291] * (-1118.167) [-1117.742] (-1118.335) (-1118.010) -- 0:00:48 126500 -- [-1119.164] (-1116.777) (-1118.557) (-1116.249) * [-1116.911] (-1118.742) (-1119.228) (-1121.381) -- 0:00:48 127000 -- [-1117.182] (-1118.969) (-1120.469) (-1116.893) * (-1116.779) (-1123.285) [-1120.132] (-1121.263) -- 0:00:48 127500 -- [-1117.356] (-1119.067) (-1118.581) (-1118.468) * (-1116.653) (-1125.279) (-1117.890) [-1118.597] -- 0:00:47 128000 -- (-1118.183) (-1123.336) (-1118.067) [-1117.450] * (-1117.986) [-1120.593] (-1118.056) (-1118.267) -- 0:00:54 128500 -- (-1117.152) [-1119.505] (-1118.527) (-1121.473) * (-1117.113) (-1116.989) [-1118.870] (-1116.746) -- 0:00:54 129000 -- (-1117.158) [-1117.095] (-1119.858) (-1120.142) * [-1117.629] (-1124.628) (-1117.048) (-1118.552) -- 0:00:54 129500 -- [-1117.075] (-1118.038) (-1119.805) (-1117.591) * [-1118.738] (-1122.502) (-1118.112) (-1117.623) -- 0:00:53 130000 -- (-1120.808) (-1118.036) (-1121.831) [-1117.164] * [-1116.839] (-1124.413) (-1120.906) (-1119.221) -- 0:00:53 Average standard deviation of split frequencies: 0.024115 130500 -- (-1123.550) [-1118.116] (-1117.072) (-1119.232) * (-1118.244) (-1118.465) [-1121.111] (-1118.542) -- 0:00:53 131000 -- (-1117.497) (-1119.371) [-1116.886] (-1118.112) * (-1119.935) (-1119.178) (-1121.064) [-1121.028] -- 0:00:53 131500 -- (-1116.297) (-1120.701) [-1116.348] (-1117.441) * (-1119.177) [-1120.820] (-1122.590) (-1120.959) -- 0:00:52 132000 -- [-1116.279] (-1118.850) (-1117.407) (-1117.710) * [-1118.933] (-1131.752) (-1118.085) (-1120.823) -- 0:00:52 132500 -- [-1118.381] (-1117.275) (-1116.753) (-1117.843) * (-1118.804) [-1122.728] (-1118.188) (-1117.459) -- 0:00:52 133000 -- (-1117.846) (-1117.659) (-1118.331) [-1117.744] * [-1118.820] (-1119.810) (-1119.368) (-1118.947) -- 0:00:52 133500 -- (-1120.496) (-1117.307) [-1120.456] (-1117.709) * (-1116.858) [-1118.638] (-1120.549) (-1118.692) -- 0:00:51 134000 -- (-1121.015) (-1117.747) (-1119.785) [-1118.746] * (-1118.224) [-1117.139] (-1119.927) (-1116.912) -- 0:00:51 134500 -- (-1121.660) (-1116.687) [-1118.038] (-1118.796) * (-1119.433) [-1117.197] (-1121.474) (-1120.242) -- 0:00:51 135000 -- (-1119.819) (-1117.644) (-1117.913) [-1119.398] * [-1117.385] (-1122.991) (-1119.541) (-1120.154) -- 0:00:51 Average standard deviation of split frequencies: 0.025034 135500 -- (-1119.433) [-1116.598] (-1117.353) (-1118.509) * (-1116.510) (-1118.636) [-1119.790] (-1117.877) -- 0:00:51 136000 -- (-1117.061) [-1119.674] (-1120.297) (-1117.402) * (-1117.744) [-1118.220] (-1117.164) (-1117.798) -- 0:00:50 136500 -- (-1117.128) [-1118.973] (-1120.025) (-1118.076) * (-1117.064) (-1116.620) [-1118.470] (-1119.562) -- 0:00:50 137000 -- (-1119.267) (-1121.011) [-1118.384] (-1117.969) * (-1119.139) [-1119.444] (-1117.223) (-1118.183) -- 0:00:50 137500 -- (-1116.881) (-1119.454) (-1117.303) [-1118.328] * [-1117.206] (-1117.403) (-1119.104) (-1122.738) -- 0:00:50 138000 -- (-1117.005) (-1118.224) (-1116.982) [-1118.116] * (-1117.674) [-1120.713] (-1117.744) (-1116.965) -- 0:00:49 138500 -- (-1120.226) (-1120.741) [-1117.712] (-1120.159) * [-1120.391] (-1121.400) (-1117.274) (-1118.957) -- 0:00:49 139000 -- [-1119.098] (-1119.179) (-1116.754) (-1118.150) * (-1121.343) [-1119.544] (-1116.642) (-1118.771) -- 0:00:49 139500 -- (-1121.555) (-1119.023) [-1118.513] (-1119.875) * (-1123.150) (-1117.746) (-1117.383) [-1118.879] -- 0:00:49 140000 -- (-1120.028) [-1119.338] (-1116.890) (-1119.091) * (-1124.384) (-1118.667) (-1116.602) [-1118.878] -- 0:00:49 Average standard deviation of split frequencies: 0.023811 140500 -- (-1121.443) [-1116.592] (-1116.241) (-1117.995) * (-1120.709) (-1120.280) (-1116.643) [-1117.543] -- 0:00:48 141000 -- (-1120.125) (-1117.735) [-1119.668] (-1117.444) * [-1119.133] (-1120.655) (-1116.697) (-1117.326) -- 0:00:48 141500 -- (-1118.390) (-1116.583) (-1118.582) [-1117.512] * (-1118.018) (-1119.826) [-1120.579] (-1118.938) -- 0:00:48 142000 -- (-1116.989) [-1116.428] (-1119.241) (-1117.749) * (-1118.328) [-1117.330] (-1118.337) (-1119.539) -- 0:00:48 142500 -- [-1116.292] (-1117.158) (-1119.966) (-1118.048) * (-1117.374) [-1119.091] (-1117.527) (-1117.324) -- 0:00:48 143000 -- [-1117.216] (-1117.990) (-1119.907) (-1116.310) * (-1117.138) (-1117.032) [-1116.287] (-1117.352) -- 0:00:47 143500 -- (-1117.387) [-1122.929] (-1118.612) (-1117.512) * (-1117.582) (-1118.679) [-1116.287] (-1117.987) -- 0:00:53 144000 -- (-1120.469) (-1122.846) (-1118.127) [-1119.423] * (-1120.006) (-1122.782) (-1116.225) [-1117.438] -- 0:00:53 144500 -- (-1119.634) (-1118.475) (-1118.787) [-1117.586] * (-1119.029) (-1119.904) [-1116.508] (-1120.244) -- 0:00:53 145000 -- (-1119.918) [-1118.987] (-1119.245) (-1117.912) * (-1117.751) (-1118.659) [-1116.883] (-1117.256) -- 0:00:53 Average standard deviation of split frequencies: 0.023961 145500 -- (-1126.504) (-1118.198) (-1117.831) [-1118.100] * (-1120.585) [-1122.854] (-1116.733) (-1118.692) -- 0:00:52 146000 -- (-1118.909) (-1117.447) [-1121.675] (-1116.446) * (-1117.143) (-1120.497) [-1116.994] (-1121.328) -- 0:00:52 146500 -- (-1117.069) [-1116.515] (-1118.827) (-1118.325) * (-1120.283) (-1118.670) [-1119.955] (-1121.665) -- 0:00:52 147000 -- (-1117.452) (-1119.125) (-1118.781) [-1117.790] * [-1116.651] (-1117.361) (-1121.355) (-1119.549) -- 0:00:52 147500 -- (-1116.710) (-1120.459) (-1118.875) [-1119.924] * [-1117.481] (-1120.133) (-1117.475) (-1123.679) -- 0:00:52 148000 -- (-1119.024) (-1119.319) (-1123.333) [-1117.439] * (-1119.301) (-1118.887) (-1116.796) [-1121.245] -- 0:00:51 148500 -- (-1120.178) [-1117.051] (-1123.228) (-1122.399) * (-1121.207) (-1117.617) [-1120.869] (-1121.951) -- 0:00:51 149000 -- (-1118.693) [-1118.553] (-1122.420) (-1120.355) * (-1121.930) (-1118.935) (-1118.335) [-1119.164] -- 0:00:51 149500 -- (-1119.263) (-1117.847) [-1124.327] (-1119.039) * (-1118.113) (-1119.740) (-1118.363) [-1120.025] -- 0:00:51 150000 -- (-1120.754) [-1117.875] (-1119.765) (-1121.772) * (-1117.338) (-1118.896) (-1120.039) [-1120.572] -- 0:00:51 Average standard deviation of split frequencies: 0.024536 150500 -- (-1118.747) (-1120.991) (-1117.537) [-1119.984] * (-1125.452) [-1117.503] (-1116.652) (-1121.285) -- 0:00:50 151000 -- (-1120.221) [-1117.777] (-1118.173) (-1119.473) * (-1119.037) (-1123.346) (-1117.108) [-1117.872] -- 0:00:50 151500 -- (-1117.504) (-1118.831) [-1119.934] (-1118.484) * (-1118.073) (-1120.264) [-1118.752] (-1117.431) -- 0:00:50 152000 -- (-1117.330) (-1120.174) [-1121.049] (-1117.860) * (-1118.672) (-1119.630) [-1119.626] (-1117.579) -- 0:00:50 152500 -- [-1117.274] (-1119.601) (-1118.990) (-1120.298) * (-1118.398) (-1117.534) [-1118.636] (-1118.082) -- 0:00:50 153000 -- [-1117.597] (-1122.316) (-1117.322) (-1116.672) * (-1118.518) (-1118.501) [-1117.939] (-1117.880) -- 0:00:49 153500 -- (-1117.502) (-1122.191) (-1116.969) [-1117.980] * (-1121.093) [-1122.162] (-1117.554) (-1117.341) -- 0:00:49 154000 -- [-1121.812] (-1117.956) (-1118.690) (-1118.456) * (-1121.344) [-1119.997] (-1118.857) (-1119.778) -- 0:00:49 154500 -- [-1117.539] (-1119.411) (-1118.137) (-1118.608) * (-1118.516) (-1119.475) [-1118.924] (-1121.362) -- 0:00:49 155000 -- (-1119.947) [-1119.001] (-1118.133) (-1118.474) * [-1117.920] (-1121.523) (-1117.680) (-1120.621) -- 0:00:49 Average standard deviation of split frequencies: 0.024175 155500 -- (-1122.549) (-1120.609) (-1119.554) [-1118.097] * (-1118.092) (-1122.568) [-1119.367] (-1122.765) -- 0:00:48 156000 -- (-1122.228) [-1117.135] (-1117.379) (-1118.749) * (-1120.639) (-1119.285) (-1120.104) [-1117.694] -- 0:00:48 156500 -- (-1117.614) [-1116.620] (-1117.303) (-1117.811) * [-1118.023] (-1118.269) (-1120.398) (-1116.882) -- 0:00:48 157000 -- (-1117.418) [-1118.119] (-1117.785) (-1120.975) * (-1122.746) (-1120.120) (-1118.442) [-1116.837] -- 0:00:48 157500 -- [-1120.924] (-1116.701) (-1117.699) (-1120.733) * (-1121.383) [-1118.425] (-1116.823) (-1117.412) -- 0:00:48 158000 -- [-1117.145] (-1118.696) (-1117.149) (-1120.183) * [-1119.375] (-1118.998) (-1120.146) (-1117.989) -- 0:00:47 158500 -- (-1118.617) [-1120.505] (-1117.397) (-1116.737) * [-1119.723] (-1119.255) (-1120.921) (-1117.425) -- 0:00:53 159000 -- [-1121.287] (-1121.723) (-1118.071) (-1117.436) * [-1118.106] (-1118.869) (-1120.501) (-1118.153) -- 0:00:52 159500 -- (-1117.435) (-1120.837) (-1117.983) [-1117.424] * (-1122.051) (-1118.606) [-1120.571] (-1117.119) -- 0:00:52 160000 -- (-1118.276) (-1120.104) [-1119.802] (-1117.079) * (-1119.795) (-1119.156) (-1119.377) [-1117.125] -- 0:00:52 Average standard deviation of split frequencies: 0.022983 160500 -- [-1117.969] (-1123.595) (-1118.523) (-1117.198) * (-1118.387) (-1123.694) (-1121.029) [-1121.024] -- 0:00:52 161000 -- (-1116.905) (-1117.516) (-1119.538) [-1117.184] * [-1116.135] (-1119.491) (-1118.792) (-1117.725) -- 0:00:52 161500 -- [-1117.159] (-1117.469) (-1119.772) (-1119.088) * (-1122.485) (-1120.505) (-1118.940) [-1116.625] -- 0:00:51 162000 -- (-1119.399) (-1119.139) [-1117.290] (-1122.406) * [-1117.064] (-1124.269) (-1118.938) (-1116.707) -- 0:00:51 162500 -- (-1118.571) [-1119.958] (-1117.437) (-1120.777) * (-1117.275) (-1121.442) (-1118.774) [-1116.578] -- 0:00:51 163000 -- [-1117.223] (-1120.416) (-1118.118) (-1118.989) * [-1120.046] (-1120.510) (-1117.844) (-1117.303) -- 0:00:51 163500 -- (-1119.203) [-1116.729] (-1119.746) (-1120.691) * (-1121.430) (-1119.061) [-1119.478] (-1119.181) -- 0:00:51 164000 -- [-1123.859] (-1116.655) (-1121.374) (-1118.046) * (-1123.543) [-1117.544] (-1117.544) (-1119.826) -- 0:00:50 164500 -- (-1119.668) (-1117.515) (-1118.031) [-1116.930] * (-1119.508) (-1117.001) (-1120.892) [-1117.031] -- 0:00:50 165000 -- (-1116.388) (-1119.719) (-1117.802) [-1117.753] * (-1120.294) [-1117.190] (-1118.008) (-1119.284) -- 0:00:50 Average standard deviation of split frequencies: 0.021373 165500 -- (-1116.832) (-1119.722) [-1116.660] (-1117.727) * [-1118.655] (-1117.196) (-1124.715) (-1118.071) -- 0:00:50 166000 -- [-1117.136] (-1121.883) (-1117.234) (-1118.312) * (-1118.891) (-1121.387) (-1117.867) [-1118.086] -- 0:00:50 166500 -- (-1116.887) [-1119.411] (-1119.515) (-1117.740) * (-1118.891) (-1119.050) (-1120.152) [-1118.473] -- 0:00:50 167000 -- (-1120.105) [-1118.363] (-1120.772) (-1118.230) * (-1118.891) [-1119.450] (-1119.050) (-1118.852) -- 0:00:49 167500 -- [-1122.162] (-1118.072) (-1118.350) (-1121.050) * (-1118.594) (-1119.835) (-1117.815) [-1118.852] -- 0:00:49 168000 -- [-1120.021] (-1116.474) (-1117.438) (-1120.674) * (-1118.478) (-1117.559) [-1117.023] (-1117.991) -- 0:00:49 168500 -- (-1119.549) [-1117.362] (-1117.208) (-1119.700) * (-1119.097) (-1117.568) (-1117.738) [-1116.599] -- 0:00:49 169000 -- (-1117.940) (-1121.669) [-1116.183] (-1119.969) * (-1117.675) (-1118.252) (-1118.863) [-1116.875] -- 0:00:49 169500 -- (-1116.935) (-1119.133) (-1117.838) [-1118.068] * (-1117.693) (-1117.729) (-1117.555) [-1119.960] -- 0:00:48 170000 -- (-1117.394) (-1123.539) (-1117.309) [-1117.564] * (-1121.200) (-1120.224) (-1117.250) [-1116.985] -- 0:00:48 Average standard deviation of split frequencies: 0.021370 170500 -- (-1117.424) (-1118.786) (-1120.508) [-1118.531] * [-1117.281] (-1118.521) (-1117.843) (-1118.818) -- 0:00:48 171000 -- (-1118.323) [-1119.452] (-1119.366) (-1117.814) * (-1118.439) (-1117.160) (-1119.217) [-1121.048] -- 0:00:48 171500 -- (-1120.052) [-1117.335] (-1117.429) (-1117.408) * (-1117.002) [-1118.553] (-1119.640) (-1118.587) -- 0:00:48 172000 -- (-1122.768) [-1117.607] (-1118.539) (-1117.518) * (-1118.249) [-1119.342] (-1117.951) (-1117.086) -- 0:00:48 172500 -- (-1121.629) [-1117.291] (-1118.079) (-1117.237) * (-1119.870) (-1122.557) (-1120.179) [-1117.752] -- 0:00:47 173000 -- [-1119.002] (-1117.034) (-1116.818) (-1118.707) * (-1117.725) (-1118.709) [-1117.244] (-1116.893) -- 0:00:47 173500 -- (-1119.259) (-1116.684) [-1116.781] (-1118.469) * (-1117.111) (-1118.685) [-1117.600] (-1118.031) -- 0:00:47 174000 -- [-1117.143] (-1116.708) (-1119.999) (-1118.561) * [-1117.422] (-1118.265) (-1119.282) (-1118.289) -- 0:00:52 174500 -- (-1117.963) (-1117.248) (-1118.197) [-1118.177] * [-1117.614] (-1120.255) (-1118.375) (-1118.306) -- 0:00:52 175000 -- (-1116.601) [-1117.135] (-1118.144) (-1119.560) * [-1118.108] (-1117.981) (-1117.367) (-1119.440) -- 0:00:51 Average standard deviation of split frequencies: 0.019493 175500 -- (-1117.608) (-1117.766) [-1118.062] (-1118.362) * (-1118.570) [-1117.611] (-1117.026) (-1123.087) -- 0:00:51 176000 -- [-1117.644] (-1117.078) (-1117.395) (-1118.595) * (-1117.588) [-1118.001] (-1118.594) (-1121.467) -- 0:00:51 176500 -- [-1118.128] (-1117.083) (-1120.253) (-1117.493) * [-1119.016] (-1118.911) (-1119.654) (-1119.744) -- 0:00:51 177000 -- (-1117.784) [-1117.009] (-1119.485) (-1117.749) * (-1118.448) (-1124.117) [-1118.826] (-1119.089) -- 0:00:51 177500 -- (-1119.451) (-1116.761) [-1123.628] (-1117.062) * (-1117.831) [-1118.558] (-1116.433) (-1119.107) -- 0:00:50 178000 -- (-1125.692) [-1118.973] (-1121.104) (-1116.681) * (-1121.129) (-1119.951) (-1117.491) [-1119.271] -- 0:00:50 178500 -- (-1117.159) [-1121.359] (-1118.369) (-1117.794) * [-1118.390] (-1117.023) (-1118.715) (-1119.559) -- 0:00:50 179000 -- (-1117.646) (-1124.725) [-1119.123] (-1118.088) * (-1118.458) (-1119.784) [-1118.836] (-1118.756) -- 0:00:50 179500 -- (-1120.275) (-1119.320) (-1118.183) [-1118.494] * [-1116.809] (-1116.858) (-1117.480) (-1122.024) -- 0:00:50 180000 -- (-1116.671) (-1119.402) (-1118.236) [-1119.142] * (-1116.587) [-1117.157] (-1117.961) (-1118.040) -- 0:00:50 Average standard deviation of split frequencies: 0.019800 180500 -- [-1116.753] (-1118.945) (-1121.249) (-1118.963) * (-1116.712) (-1118.566) [-1118.143] (-1118.158) -- 0:00:49 181000 -- (-1117.512) (-1121.267) (-1119.270) [-1118.400] * (-1117.623) [-1117.806] (-1118.407) (-1119.703) -- 0:00:49 181500 -- [-1117.809] (-1118.844) (-1118.409) (-1117.494) * (-1116.966) [-1117.692] (-1116.329) (-1119.477) -- 0:00:49 182000 -- (-1119.396) (-1118.760) [-1118.160] (-1123.137) * (-1117.757) (-1117.935) (-1124.743) [-1119.088] -- 0:00:49 182500 -- (-1118.152) (-1118.250) (-1119.708) [-1119.796] * [-1118.821] (-1116.296) (-1118.753) (-1118.814) -- 0:00:49 183000 -- (-1119.694) [-1117.435] (-1120.553) (-1119.206) * (-1118.065) (-1119.022) [-1119.105] (-1121.236) -- 0:00:49 183500 -- [-1119.825] (-1117.897) (-1119.027) (-1121.010) * [-1117.470] (-1125.789) (-1117.768) (-1119.701) -- 0:00:48 184000 -- (-1118.945) (-1117.344) (-1118.897) [-1119.846] * (-1117.229) [-1118.877] (-1121.870) (-1124.892) -- 0:00:48 184500 -- (-1119.522) (-1118.489) (-1117.910) [-1118.185] * (-1116.894) [-1117.387] (-1117.153) (-1123.722) -- 0:00:48 185000 -- [-1119.118] (-1116.753) (-1118.451) (-1118.002) * (-1116.760) [-1123.125] (-1117.153) (-1118.804) -- 0:00:48 Average standard deviation of split frequencies: 0.019679 185500 -- (-1120.800) [-1116.872] (-1116.776) (-1119.297) * (-1116.584) (-1121.885) [-1117.054] (-1120.980) -- 0:00:48 186000 -- [-1118.405] (-1121.718) (-1116.927) (-1118.049) * (-1119.407) (-1119.136) [-1117.251] (-1126.060) -- 0:00:48 186500 -- (-1116.588) (-1121.730) [-1119.037] (-1118.978) * (-1119.478) (-1118.944) [-1116.884] (-1121.093) -- 0:00:47 187000 -- (-1116.413) [-1121.717] (-1120.590) (-1119.452) * (-1116.818) (-1116.756) [-1118.289] (-1121.002) -- 0:00:47 187500 -- (-1119.230) (-1123.168) (-1120.331) [-1118.360] * [-1116.914] (-1117.899) (-1120.554) (-1121.247) -- 0:00:47 188000 -- (-1118.936) (-1118.612) (-1120.542) [-1119.277] * (-1119.018) (-1118.026) (-1121.835) [-1117.437] -- 0:00:47 188500 -- (-1120.455) (-1122.272) [-1117.210] (-1118.976) * (-1119.428) (-1119.124) [-1116.710] (-1116.480) -- 0:00:47 189000 -- (-1122.037) [-1121.390] (-1119.067) (-1121.329) * (-1117.770) [-1117.241] (-1117.504) (-1117.618) -- 0:00:47 189500 -- (-1117.546) (-1120.887) [-1119.802] (-1122.568) * (-1118.424) (-1117.147) [-1117.719] (-1117.467) -- 0:00:51 190000 -- [-1118.931] (-1123.622) (-1120.598) (-1118.745) * (-1120.362) (-1116.899) (-1120.060) [-1117.031] -- 0:00:51 Average standard deviation of split frequencies: 0.018034 190500 -- (-1116.896) (-1119.460) [-1119.363] (-1118.593) * (-1119.614) (-1116.886) (-1119.457) [-1117.247] -- 0:00:50 191000 -- [-1116.916] (-1119.829) (-1118.877) (-1122.242) * (-1119.091) (-1118.703) (-1123.031) [-1117.897] -- 0:00:50 191500 -- [-1116.876] (-1118.697) (-1120.566) (-1118.993) * (-1120.484) (-1118.940) (-1121.330) [-1118.633] -- 0:00:50 192000 -- (-1116.840) (-1118.335) [-1117.799] (-1118.536) * (-1117.374) (-1120.112) [-1122.319] (-1118.556) -- 0:00:50 192500 -- (-1119.069) (-1117.371) (-1120.111) [-1117.587] * (-1117.313) (-1122.697) (-1123.074) [-1120.017] -- 0:00:50 193000 -- (-1118.059) (-1122.031) (-1119.687) [-1117.046] * [-1117.550] (-1119.393) (-1123.432) (-1118.159) -- 0:00:50 193500 -- [-1116.425] (-1117.692) (-1119.167) (-1117.101) * (-1119.640) (-1117.232) [-1117.944] (-1120.568) -- 0:00:50 194000 -- (-1116.640) (-1117.087) (-1118.002) [-1118.450] * (-1119.341) [-1118.579] (-1118.447) (-1120.460) -- 0:00:49 194500 -- (-1119.504) (-1118.065) [-1121.168] (-1119.171) * (-1118.691) (-1118.596) (-1121.339) [-1117.538] -- 0:00:49 195000 -- (-1119.961) (-1118.837) [-1119.374] (-1119.092) * [-1118.519] (-1119.134) (-1117.991) (-1116.407) -- 0:00:49 Average standard deviation of split frequencies: 0.017119 195500 -- (-1119.395) [-1119.510] (-1119.788) (-1118.362) * (-1119.847) (-1128.762) [-1118.025] (-1116.687) -- 0:00:49 196000 -- (-1117.216) [-1117.877] (-1119.603) (-1117.758) * (-1117.358) [-1120.425] (-1118.331) (-1118.512) -- 0:00:49 196500 -- (-1116.906) (-1117.486) [-1117.489] (-1116.604) * (-1116.955) (-1119.150) [-1118.882] (-1119.035) -- 0:00:49 197000 -- (-1118.324) (-1116.511) [-1119.056] (-1116.397) * (-1119.163) (-1121.941) [-1116.938] (-1118.182) -- 0:00:48 197500 -- [-1116.553] (-1116.948) (-1119.980) (-1117.807) * (-1119.530) (-1117.098) (-1117.290) [-1118.857] -- 0:00:48 198000 -- [-1117.101] (-1118.664) (-1125.707) (-1117.789) * (-1117.297) [-1118.132] (-1118.219) (-1118.113) -- 0:00:48 198500 -- (-1117.195) (-1117.389) [-1118.482] (-1119.389) * [-1117.518] (-1117.087) (-1118.916) (-1117.200) -- 0:00:48 199000 -- (-1117.970) (-1119.236) [-1124.913] (-1117.992) * (-1118.148) (-1116.786) [-1117.257] (-1119.034) -- 0:00:48 199500 -- (-1117.927) (-1118.680) (-1118.744) [-1118.912] * [-1120.727] (-1120.337) (-1118.258) (-1117.816) -- 0:00:48 200000 -- (-1116.927) (-1119.909) [-1118.834] (-1118.826) * (-1117.103) (-1119.601) [-1117.806] (-1116.616) -- 0:00:48 Average standard deviation of split frequencies: 0.018141 200500 -- (-1117.380) (-1118.331) (-1116.819) [-1117.561] * [-1117.019] (-1117.650) (-1116.492) (-1117.208) -- 0:00:47 201000 -- (-1120.354) [-1118.274] (-1117.298) (-1117.978) * (-1120.197) [-1117.069] (-1118.375) (-1120.888) -- 0:00:47 201500 -- [-1119.885] (-1121.557) (-1116.299) (-1118.394) * (-1118.927) [-1117.057] (-1118.105) (-1120.981) -- 0:00:47 202000 -- [-1119.731] (-1118.137) (-1121.627) (-1118.019) * (-1118.147) [-1117.784] (-1116.756) (-1119.409) -- 0:00:47 202500 -- [-1119.350] (-1117.936) (-1117.289) (-1118.593) * (-1117.693) (-1118.647) [-1117.847] (-1118.858) -- 0:00:47 203000 -- [-1119.479] (-1117.652) (-1117.090) (-1117.624) * (-1117.488) [-1119.557] (-1118.740) (-1119.981) -- 0:00:47 203500 -- (-1124.156) (-1118.232) (-1118.315) [-1118.088] * (-1118.920) (-1118.219) [-1122.543] (-1118.678) -- 0:00:46 204000 -- (-1119.105) (-1117.987) [-1118.644] (-1117.001) * [-1118.182] (-1119.174) (-1119.641) (-1117.812) -- 0:00:46 204500 -- [-1117.690] (-1118.540) (-1119.843) (-1118.343) * [-1119.314] (-1117.462) (-1117.481) (-1119.383) -- 0:00:46 205000 -- [-1117.710] (-1117.366) (-1121.736) (-1119.565) * (-1117.450) [-1118.532] (-1118.511) (-1118.030) -- 0:00:50 Average standard deviation of split frequencies: 0.016909 205500 -- [-1117.080] (-1119.446) (-1119.466) (-1117.650) * (-1117.450) (-1117.988) (-1119.611) [-1118.707] -- 0:00:50 206000 -- (-1117.074) (-1117.883) [-1118.602] (-1118.496) * [-1117.368] (-1117.802) (-1117.774) (-1117.648) -- 0:00:50 206500 -- (-1119.990) [-1117.849] (-1118.857) (-1117.404) * (-1117.621) [-1117.783] (-1122.761) (-1118.441) -- 0:00:49 207000 -- (-1120.931) (-1120.450) (-1119.318) [-1117.785] * (-1118.752) (-1119.588) (-1120.499) [-1120.468] -- 0:00:49 207500 -- (-1120.301) (-1118.490) [-1118.129] (-1118.263) * [-1116.838] (-1117.157) (-1124.750) (-1117.337) -- 0:00:49 208000 -- (-1118.067) (-1119.493) [-1116.519] (-1118.630) * (-1121.788) (-1117.295) (-1122.165) [-1116.942] -- 0:00:49 208500 -- (-1118.516) [-1121.666] (-1120.737) (-1117.415) * [-1119.585] (-1117.662) (-1118.470) (-1116.853) -- 0:00:49 209000 -- (-1118.770) (-1120.206) [-1117.928] (-1118.010) * (-1119.919) (-1117.723) [-1116.986] (-1120.951) -- 0:00:49 209500 -- (-1119.012) (-1122.784) [-1116.833] (-1117.719) * [-1121.736] (-1119.446) (-1116.609) (-1118.206) -- 0:00:49 210000 -- (-1118.198) (-1118.638) [-1116.873] (-1118.990) * [-1117.524] (-1117.101) (-1117.168) (-1117.169) -- 0:00:48 Average standard deviation of split frequencies: 0.016841 210500 -- (-1117.751) (-1118.607) (-1118.564) [-1121.134] * [-1117.384] (-1119.152) (-1117.470) (-1119.281) -- 0:00:48 211000 -- [-1117.470] (-1116.944) (-1121.941) (-1116.842) * (-1118.378) [-1117.733] (-1118.155) (-1118.562) -- 0:00:48 211500 -- (-1118.344) (-1123.978) [-1117.803] (-1119.256) * (-1122.615) (-1118.053) [-1119.945] (-1122.433) -- 0:00:48 212000 -- (-1118.552) (-1121.877) (-1118.606) [-1119.422] * (-1121.472) (-1117.317) [-1121.935] (-1118.319) -- 0:00:48 212500 -- (-1117.721) (-1118.398) (-1117.591) [-1118.914] * (-1119.926) (-1116.681) (-1117.967) [-1117.676] -- 0:00:48 213000 -- [-1121.392] (-1117.616) (-1117.103) (-1119.013) * [-1120.509] (-1116.511) (-1117.244) (-1121.450) -- 0:00:48 213500 -- (-1118.853) [-1121.129] (-1116.964) (-1119.228) * [-1120.748] (-1118.965) (-1119.352) (-1117.333) -- 0:00:47 214000 -- (-1117.361) (-1121.264) [-1118.124] (-1121.741) * (-1119.094) (-1120.347) (-1118.124) [-1117.334] -- 0:00:47 214500 -- (-1117.771) [-1116.677] (-1119.184) (-1117.010) * [-1116.839] (-1119.268) (-1122.995) (-1121.235) -- 0:00:47 215000 -- (-1116.478) (-1118.156) (-1121.548) [-1117.096] * [-1117.859] (-1117.483) (-1116.879) (-1122.256) -- 0:00:47 Average standard deviation of split frequencies: 0.016885 215500 -- [-1117.023] (-1118.873) (-1119.138) (-1118.573) * (-1117.852) [-1117.467] (-1119.216) (-1121.951) -- 0:00:47 216000 -- (-1117.290) (-1123.547) (-1121.611) [-1117.047] * (-1121.523) (-1116.990) (-1120.598) [-1120.662] -- 0:00:47 216500 -- [-1120.834] (-1120.464) (-1119.798) (-1116.470) * [-1118.891] (-1119.199) (-1123.987) (-1117.780) -- 0:00:47 217000 -- [-1116.505] (-1117.999) (-1121.177) (-1116.522) * (-1118.357) (-1118.263) [-1119.575] (-1119.929) -- 0:00:46 217500 -- (-1117.270) [-1117.634] (-1120.805) (-1117.374) * [-1117.328] (-1119.937) (-1118.096) (-1117.490) -- 0:00:46 218000 -- [-1117.948] (-1118.649) (-1124.908) (-1122.439) * (-1116.963) (-1117.620) (-1123.182) [-1116.393] -- 0:00:46 218500 -- (-1120.460) (-1119.287) (-1121.114) [-1117.450] * (-1116.883) [-1118.192] (-1116.974) (-1117.512) -- 0:00:46 219000 -- (-1116.843) [-1118.140] (-1119.363) (-1117.577) * (-1118.324) [-1116.918] (-1116.966) (-1117.985) -- 0:00:46 219500 -- (-1117.400) [-1116.231] (-1121.464) (-1117.671) * (-1117.783) [-1121.884] (-1117.659) (-1119.890) -- 0:00:46 220000 -- [-1116.815] (-1118.491) (-1119.112) (-1119.200) * (-1117.069) [-1117.422] (-1118.005) (-1119.763) -- 0:00:46 Average standard deviation of split frequencies: 0.016853 220500 -- [-1118.567] (-1123.285) (-1119.675) (-1122.642) * (-1118.767) [-1117.408] (-1121.214) (-1120.084) -- 0:00:49 221000 -- (-1116.443) (-1118.443) (-1119.142) [-1121.946] * (-1119.063) (-1118.092) [-1119.015] (-1117.613) -- 0:00:49 221500 -- (-1118.877) (-1119.312) (-1116.988) [-1118.264] * [-1118.809] (-1117.666) (-1116.942) (-1116.905) -- 0:00:49 222000 -- (-1117.362) [-1118.450] (-1121.630) (-1117.573) * [-1119.752] (-1123.060) (-1121.109) (-1119.765) -- 0:00:49 222500 -- (-1120.344) [-1119.118] (-1121.219) (-1118.794) * [-1118.956] (-1117.797) (-1116.885) (-1120.669) -- 0:00:48 223000 -- (-1117.558) [-1119.197] (-1123.547) (-1117.745) * (-1118.398) (-1123.506) [-1118.673] (-1120.335) -- 0:00:48 223500 -- [-1120.237] (-1119.364) (-1117.241) (-1118.834) * [-1118.671] (-1122.277) (-1120.761) (-1118.301) -- 0:00:48 224000 -- (-1120.315) (-1123.820) (-1116.799) [-1119.720] * [-1117.402] (-1121.577) (-1117.296) (-1118.174) -- 0:00:48 224500 -- [-1117.442] (-1117.760) (-1116.290) (-1117.722) * (-1117.496) (-1119.234) [-1117.918] (-1118.265) -- 0:00:48 225000 -- (-1116.479) [-1118.138] (-1118.580) (-1120.932) * (-1116.393) [-1116.437] (-1117.463) (-1120.787) -- 0:00:48 Average standard deviation of split frequencies: 0.015876 225500 -- (-1118.369) (-1117.689) (-1116.148) [-1118.232] * (-1117.033) (-1117.729) (-1121.961) [-1120.918] -- 0:00:48 226000 -- (-1119.212) (-1118.315) [-1116.149] (-1118.283) * (-1116.965) (-1117.318) (-1120.130) [-1118.528] -- 0:00:47 226500 -- [-1118.847] (-1118.297) (-1116.384) (-1121.660) * (-1116.619) (-1119.064) (-1121.020) [-1118.214] -- 0:00:47 227000 -- (-1119.451) [-1118.526] (-1120.978) (-1120.111) * (-1117.179) (-1119.425) (-1119.119) [-1118.898] -- 0:00:47 227500 -- (-1119.587) [-1120.404] (-1117.493) (-1116.865) * (-1117.845) (-1118.221) (-1117.919) [-1116.311] -- 0:00:47 228000 -- (-1118.699) (-1118.457) (-1125.012) [-1120.157] * (-1116.341) (-1119.066) [-1118.308] (-1117.099) -- 0:00:47 228500 -- (-1118.192) [-1117.901] (-1124.309) (-1121.182) * (-1120.456) (-1116.898) [-1118.355] (-1118.375) -- 0:00:47 229000 -- (-1118.487) [-1121.740] (-1119.079) (-1124.382) * [-1120.317] (-1120.993) (-1121.339) (-1118.375) -- 0:00:47 229500 -- (-1122.968) (-1120.847) (-1118.373) [-1117.687] * (-1117.853) (-1119.187) [-1119.469] (-1117.598) -- 0:00:47 230000 -- [-1118.940] (-1118.129) (-1120.852) (-1117.409) * [-1118.583] (-1118.393) (-1117.319) (-1119.291) -- 0:00:46 Average standard deviation of split frequencies: 0.014987 230500 -- (-1121.512) (-1116.912) (-1118.210) [-1119.538] * [-1118.563] (-1118.433) (-1118.917) (-1121.343) -- 0:00:46 231000 -- (-1121.920) [-1117.874] (-1116.877) (-1119.640) * (-1118.892) (-1119.039) (-1120.694) [-1118.492] -- 0:00:46 231500 -- (-1119.861) (-1117.865) [-1117.182] (-1118.220) * (-1117.591) (-1120.198) [-1117.083] (-1119.980) -- 0:00:46 232000 -- (-1122.579) (-1117.811) (-1116.871) [-1118.353] * (-1116.972) [-1118.878] (-1118.009) (-1118.407) -- 0:00:46 232500 -- [-1118.347] (-1120.811) (-1117.104) (-1117.123) * (-1119.016) (-1118.955) (-1117.708) [-1119.578] -- 0:00:46 233000 -- (-1118.266) (-1121.393) (-1119.025) [-1118.317] * (-1121.666) (-1118.577) [-1118.641] (-1121.912) -- 0:00:46 233500 -- [-1116.732] (-1121.087) (-1118.554) (-1119.006) * [-1117.779] (-1119.495) (-1117.696) (-1125.180) -- 0:00:45 234000 -- (-1118.216) (-1119.355) [-1118.489] (-1121.101) * (-1117.839) [-1116.661] (-1118.605) (-1119.610) -- 0:00:45 234500 -- [-1119.948] (-1118.732) (-1118.959) (-1118.032) * [-1117.511] (-1116.399) (-1117.138) (-1118.961) -- 0:00:45 235000 -- [-1120.507] (-1117.309) (-1119.579) (-1119.209) * (-1120.048) (-1121.076) [-1117.325] (-1118.154) -- 0:00:45 Average standard deviation of split frequencies: 0.014805 235500 -- (-1121.153) (-1117.850) (-1123.067) [-1116.967] * (-1120.861) [-1123.619] (-1118.529) (-1118.831) -- 0:00:48 236000 -- [-1116.293] (-1117.119) (-1118.420) (-1121.131) * [-1120.557] (-1121.612) (-1120.793) (-1121.724) -- 0:00:48 236500 -- [-1116.406] (-1117.684) (-1116.834) (-1116.630) * (-1119.637) [-1118.918] (-1117.798) (-1121.000) -- 0:00:48 237000 -- [-1116.427] (-1117.986) (-1117.858) (-1117.646) * (-1119.566) [-1122.251] (-1117.594) (-1120.758) -- 0:00:48 237500 -- [-1118.732] (-1117.665) (-1117.222) (-1124.841) * (-1118.499) (-1121.328) (-1118.191) [-1118.133] -- 0:00:48 238000 -- (-1118.536) (-1117.439) (-1118.113) [-1119.322] * (-1118.170) [-1120.993] (-1119.937) (-1119.608) -- 0:00:48 238500 -- [-1118.189] (-1116.518) (-1119.886) (-1119.708) * (-1119.385) (-1122.783) (-1117.714) [-1118.789] -- 0:00:47 239000 -- (-1117.641) (-1117.660) (-1121.251) [-1116.881] * (-1121.367) (-1122.841) (-1118.517) [-1118.572] -- 0:00:47 239500 -- [-1116.958] (-1118.743) (-1120.166) (-1121.951) * (-1122.350) (-1120.134) (-1118.151) [-1118.305] -- 0:00:47 240000 -- (-1123.950) [-1118.998] (-1118.346) (-1120.608) * (-1120.721) [-1121.488] (-1120.595) (-1118.115) -- 0:00:47 Average standard deviation of split frequencies: 0.015209 240500 -- (-1121.892) (-1118.770) [-1118.806] (-1120.101) * [-1118.248] (-1120.171) (-1119.654) (-1119.239) -- 0:00:47 241000 -- (-1121.148) (-1117.988) (-1119.581) [-1117.744] * (-1118.224) (-1120.612) [-1117.794] (-1124.655) -- 0:00:47 241500 -- (-1118.240) (-1119.315) [-1119.740] (-1116.923) * (-1117.338) [-1121.775] (-1118.080) (-1119.780) -- 0:00:47 242000 -- (-1119.258) (-1118.567) [-1116.736] (-1116.661) * (-1118.161) [-1118.890] (-1119.782) (-1119.434) -- 0:00:46 242500 -- (-1119.389) (-1118.028) [-1116.490] (-1117.589) * [-1117.113] (-1118.434) (-1116.639) (-1117.064) -- 0:00:46 243000 -- (-1120.580) [-1119.047] (-1117.877) (-1118.481) * [-1121.396] (-1119.909) (-1119.006) (-1116.751) -- 0:00:46 243500 -- (-1123.273) (-1116.493) (-1119.051) [-1120.393] * [-1120.078] (-1120.390) (-1116.461) (-1117.377) -- 0:00:46 244000 -- (-1118.201) (-1116.929) (-1118.478) [-1119.130] * (-1119.325) (-1116.601) [-1116.918] (-1117.407) -- 0:00:46 244500 -- (-1118.139) (-1117.569) [-1117.541] (-1121.275) * [-1119.096] (-1116.500) (-1119.015) (-1117.721) -- 0:00:46 245000 -- (-1117.390) (-1117.172) (-1117.223) [-1123.064] * (-1116.858) [-1116.289] (-1121.361) (-1116.225) -- 0:00:46 Average standard deviation of split frequencies: 0.014479 245500 -- [-1119.394] (-1117.071) (-1116.916) (-1117.610) * (-1118.859) (-1116.289) [-1119.216] (-1116.652) -- 0:00:46 246000 -- (-1119.187) [-1116.637] (-1118.208) (-1118.949) * (-1118.280) (-1117.213) (-1119.258) [-1116.424] -- 0:00:45 246500 -- (-1117.457) (-1117.142) [-1121.090] (-1123.994) * (-1116.774) (-1118.124) (-1119.495) [-1117.200] -- 0:00:45 247000 -- [-1117.303] (-1120.221) (-1118.249) (-1118.551) * (-1118.671) (-1118.152) (-1118.382) [-1117.127] -- 0:00:45 247500 -- (-1117.303) [-1119.455] (-1120.220) (-1122.660) * (-1119.051) (-1121.189) (-1117.488) [-1116.825] -- 0:00:45 248000 -- (-1118.345) [-1120.433] (-1119.132) (-1117.598) * (-1117.980) (-1117.660) (-1118.263) [-1117.844] -- 0:00:45 248500 -- (-1118.901) (-1120.937) [-1117.994] (-1118.584) * [-1118.703] (-1117.367) (-1117.359) (-1118.844) -- 0:00:45 249000 -- [-1117.934] (-1118.217) (-1120.464) (-1117.383) * (-1118.996) (-1118.508) (-1119.736) [-1119.413] -- 0:00:45 249500 -- (-1119.559) (-1118.035) [-1119.826] (-1117.870) * (-1121.088) (-1120.343) [-1121.144] (-1119.582) -- 0:00:45 250000 -- (-1119.131) [-1118.240] (-1122.022) (-1117.170) * (-1122.707) [-1117.846] (-1120.267) (-1117.693) -- 0:00:45 Average standard deviation of split frequencies: 0.015567 250500 -- (-1120.276) [-1118.296] (-1120.237) (-1119.737) * (-1121.858) (-1117.734) (-1117.682) [-1118.596] -- 0:00:44 251000 -- [-1120.652] (-1118.564) (-1121.091) (-1119.248) * (-1121.096) [-1118.300] (-1116.371) (-1124.009) -- 0:00:47 251500 -- [-1116.892] (-1118.196) (-1118.775) (-1119.986) * (-1117.025) (-1120.782) [-1118.309] (-1121.961) -- 0:00:47 252000 -- (-1116.615) [-1119.509] (-1118.204) (-1118.887) * [-1119.798] (-1116.979) (-1119.649) (-1121.444) -- 0:00:47 252500 -- [-1119.724] (-1116.853) (-1118.181) (-1120.274) * [-1119.617] (-1116.715) (-1118.941) (-1119.040) -- 0:00:47 253000 -- (-1120.432) [-1118.682] (-1119.477) (-1117.981) * (-1118.163) (-1117.306) (-1122.571) [-1119.525] -- 0:00:47 253500 -- (-1116.832) [-1118.433] (-1120.327) (-1116.619) * (-1116.567) [-1117.027] (-1121.816) (-1120.571) -- 0:00:47 254000 -- (-1119.086) [-1117.944] (-1119.711) (-1116.847) * [-1117.062] (-1116.940) (-1123.134) (-1117.080) -- 0:00:46 254500 -- (-1121.803) (-1119.114) (-1117.882) [-1118.152] * (-1117.083) [-1117.607] (-1117.537) (-1124.805) -- 0:00:46 255000 -- [-1117.845] (-1118.094) (-1118.501) (-1118.497) * (-1119.592) (-1120.816) [-1116.763] (-1119.772) -- 0:00:46 Average standard deviation of split frequencies: 0.014731 255500 -- [-1117.071] (-1118.348) (-1118.625) (-1119.107) * (-1121.701) [-1118.171] (-1120.351) (-1118.287) -- 0:00:46 256000 -- (-1117.113) [-1117.567] (-1119.085) (-1119.315) * (-1118.852) (-1121.923) [-1118.002] (-1119.006) -- 0:00:46 256500 -- (-1117.524) [-1122.579] (-1118.576) (-1119.182) * (-1118.869) (-1119.023) (-1116.717) [-1116.936] -- 0:00:46 257000 -- (-1116.947) (-1118.893) (-1117.550) [-1117.559] * (-1117.648) (-1119.511) [-1119.033] (-1118.263) -- 0:00:46 257500 -- (-1118.446) (-1119.702) (-1120.420) [-1117.130] * (-1117.082) [-1119.951] (-1118.752) (-1116.940) -- 0:00:46 258000 -- (-1120.280) (-1122.649) (-1117.344) [-1116.898] * [-1117.204] (-1119.429) (-1122.551) (-1117.690) -- 0:00:46 258500 -- (-1121.198) [-1118.850] (-1121.409) (-1117.439) * (-1117.461) (-1119.792) [-1119.689] (-1117.339) -- 0:00:45 259000 -- (-1118.218) (-1119.455) (-1118.558) [-1123.077] * (-1116.410) (-1119.813) [-1119.549] (-1118.569) -- 0:00:45 259500 -- (-1119.303) (-1120.364) [-1119.285] (-1116.830) * [-1116.127] (-1117.738) (-1119.623) (-1119.795) -- 0:00:45 260000 -- [-1116.775] (-1120.374) (-1119.058) (-1120.746) * [-1117.178] (-1116.734) (-1119.197) (-1120.310) -- 0:00:45 Average standard deviation of split frequencies: 0.016075 260500 -- [-1118.835] (-1119.133) (-1123.344) (-1118.404) * (-1118.247) (-1116.915) [-1118.376] (-1120.687) -- 0:00:45 261000 -- [-1119.850] (-1120.330) (-1118.837) (-1119.236) * (-1120.730) [-1118.428] (-1118.973) (-1123.465) -- 0:00:45 261500 -- [-1119.963] (-1120.525) (-1121.746) (-1117.660) * (-1121.840) [-1119.117] (-1117.703) (-1118.757) -- 0:00:45 262000 -- (-1119.719) (-1117.991) [-1117.776] (-1118.010) * [-1124.928] (-1119.805) (-1117.827) (-1122.102) -- 0:00:45 262500 -- (-1121.191) (-1120.235) [-1118.338] (-1120.492) * (-1125.969) (-1119.941) (-1117.078) [-1120.684] -- 0:00:44 263000 -- (-1116.948) [-1118.018] (-1120.151) (-1118.554) * (-1120.184) [-1120.146] (-1116.909) (-1119.975) -- 0:00:44 263500 -- (-1118.078) [-1117.664] (-1117.525) (-1121.027) * (-1118.140) (-1119.076) [-1117.104] (-1119.424) -- 0:00:44 264000 -- (-1117.435) [-1116.902] (-1117.320) (-1121.927) * (-1117.378) (-1117.934) (-1117.516) [-1119.207] -- 0:00:44 264500 -- (-1116.907) [-1117.378] (-1119.909) (-1120.439) * (-1118.543) [-1120.991] (-1120.384) (-1119.136) -- 0:00:44 265000 -- [-1116.575] (-1118.547) (-1120.078) (-1117.647) * [-1118.172] (-1119.521) (-1118.238) (-1117.493) -- 0:00:44 Average standard deviation of split frequencies: 0.015162 265500 -- (-1117.088) (-1119.882) (-1118.523) [-1117.761] * (-1118.301) (-1120.158) [-1123.664] (-1117.496) -- 0:00:44 266000 -- (-1116.586) (-1117.355) [-1118.823] (-1121.512) * (-1120.094) (-1118.072) [-1118.518] (-1118.421) -- 0:00:44 266500 -- (-1117.281) (-1121.529) [-1119.060] (-1118.860) * [-1123.086] (-1121.018) (-1120.594) (-1118.043) -- 0:00:44 267000 -- (-1119.820) (-1117.936) (-1119.693) [-1117.759] * [-1122.090] (-1118.060) (-1118.561) (-1117.048) -- 0:00:46 267500 -- (-1121.333) (-1118.967) (-1119.906) [-1120.982] * (-1122.054) (-1119.040) (-1118.208) [-1117.056] -- 0:00:46 268000 -- [-1117.022] (-1117.512) (-1120.496) (-1118.325) * [-1121.825] (-1117.929) (-1121.170) (-1122.959) -- 0:00:46 268500 -- (-1116.977) (-1116.520) [-1118.505] (-1123.686) * [-1118.324] (-1116.744) (-1120.642) (-1117.769) -- 0:00:46 269000 -- (-1118.143) (-1117.039) (-1117.738) [-1117.271] * (-1117.283) (-1117.465) [-1118.311] (-1119.241) -- 0:00:46 269500 -- [-1119.124] (-1119.354) (-1119.169) (-1119.780) * [-1117.416] (-1120.227) (-1118.132) (-1117.045) -- 0:00:46 270000 -- [-1116.922] (-1120.887) (-1117.503) (-1119.613) * (-1118.706) (-1119.598) [-1117.025] (-1119.198) -- 0:00:45 Average standard deviation of split frequencies: 0.015578 270500 -- (-1118.784) [-1117.832] (-1116.871) (-1118.879) * [-1117.580] (-1119.936) (-1122.059) (-1121.738) -- 0:00:45 271000 -- (-1116.786) (-1120.056) [-1117.305] (-1119.552) * (-1117.595) (-1118.481) (-1119.399) [-1120.341] -- 0:00:45 271500 -- (-1116.688) (-1121.545) [-1119.094] (-1118.035) * [-1118.620] (-1119.865) (-1118.242) (-1122.306) -- 0:00:45 272000 -- (-1116.592) [-1119.459] (-1119.993) (-1123.302) * [-1116.416] (-1118.081) (-1118.695) (-1121.098) -- 0:00:45 272500 -- (-1116.558) [-1117.913] (-1118.539) (-1117.715) * [-1118.493] (-1120.116) (-1125.258) (-1119.917) -- 0:00:45 273000 -- (-1116.961) (-1117.790) [-1119.714] (-1119.922) * (-1117.277) [-1117.519] (-1119.739) (-1117.957) -- 0:00:45 273500 -- (-1119.552) (-1119.181) [-1117.595] (-1119.938) * (-1116.548) (-1117.515) (-1118.921) [-1117.641] -- 0:00:45 274000 -- [-1120.971] (-1116.419) (-1118.821) (-1119.567) * (-1118.666) [-1117.281] (-1119.942) (-1119.888) -- 0:00:45 274500 -- (-1120.060) (-1116.162) [-1121.134] (-1117.940) * (-1116.260) [-1117.600] (-1122.323) (-1119.942) -- 0:00:44 275000 -- (-1120.036) (-1116.742) (-1119.110) [-1117.535] * (-1116.430) (-1118.336) [-1125.238] (-1119.345) -- 0:00:44 Average standard deviation of split frequencies: 0.017459 275500 -- (-1121.288) (-1121.071) (-1117.219) [-1118.393] * (-1116.540) (-1117.409) [-1118.798] (-1118.548) -- 0:00:44 276000 -- [-1119.085] (-1117.308) (-1117.518) (-1118.658) * (-1117.836) [-1121.297] (-1120.374) (-1117.773) -- 0:00:44 276500 -- [-1117.626] (-1118.131) (-1117.601) (-1117.539) * (-1116.383) [-1118.077] (-1121.032) (-1117.136) -- 0:00:44 277000 -- [-1118.756] (-1117.340) (-1117.760) (-1118.294) * (-1117.313) [-1118.356] (-1121.675) (-1118.440) -- 0:00:44 277500 -- (-1121.604) (-1117.227) (-1121.450) [-1118.389] * (-1116.561) [-1118.324] (-1117.005) (-1119.622) -- 0:00:44 278000 -- (-1117.193) (-1119.355) (-1121.105) [-1117.606] * (-1117.465) (-1117.804) [-1117.328] (-1119.473) -- 0:00:44 278500 -- [-1117.592] (-1117.360) (-1120.939) (-1117.023) * (-1118.300) (-1122.362) [-1119.960] (-1120.318) -- 0:00:44 279000 -- (-1120.353) (-1117.385) (-1117.506) [-1116.865] * (-1126.219) [-1120.828] (-1117.269) (-1122.066) -- 0:00:43 279500 -- (-1117.490) (-1119.471) (-1117.512) [-1121.609] * (-1122.761) [-1119.327] (-1117.012) (-1120.548) -- 0:00:43 280000 -- (-1118.932) (-1119.778) (-1118.374) [-1120.441] * (-1118.699) (-1116.877) [-1119.895] (-1121.696) -- 0:00:43 Average standard deviation of split frequencies: 0.017449 280500 -- [-1117.099] (-1120.402) (-1117.239) (-1121.502) * (-1118.370) (-1120.680) (-1117.559) [-1118.123] -- 0:00:43 281000 -- (-1116.897) (-1118.300) (-1117.672) [-1117.396] * (-1118.154) [-1118.468] (-1118.471) (-1118.062) -- 0:00:43 281500 -- (-1116.882) [-1118.182] (-1119.031) (-1119.053) * (-1119.224) [-1117.684] (-1118.373) (-1116.923) -- 0:00:43 282000 -- [-1116.297] (-1119.761) (-1119.462) (-1122.722) * (-1117.055) [-1117.239] (-1119.086) (-1116.923) -- 0:00:43 282500 -- [-1117.601] (-1116.349) (-1118.394) (-1119.127) * (-1119.859) (-1118.450) (-1118.114) [-1117.550] -- 0:00:43 283000 -- (-1118.365) (-1117.724) (-1118.750) [-1118.960] * [-1117.143] (-1119.159) (-1119.676) (-1117.872) -- 0:00:45 283500 -- [-1118.914] (-1118.929) (-1116.842) (-1120.639) * (-1118.858) [-1119.274] (-1120.123) (-1119.524) -- 0:00:45 284000 -- (-1120.698) (-1117.939) (-1119.686) [-1118.535] * [-1120.711] (-1118.012) (-1119.040) (-1120.062) -- 0:00:45 284500 -- [-1121.047] (-1119.097) (-1118.836) (-1118.166) * (-1118.124) (-1120.796) (-1117.456) [-1122.883] -- 0:00:45 285000 -- (-1118.476) [-1118.128] (-1117.124) (-1120.526) * (-1117.807) (-1121.188) [-1117.705] (-1120.515) -- 0:00:45 Average standard deviation of split frequencies: 0.017307 285500 -- (-1118.987) (-1117.732) [-1117.232] (-1118.981) * (-1118.808) (-1121.251) (-1117.557) [-1117.897] -- 0:00:45 286000 -- [-1117.314] (-1118.993) (-1119.953) (-1119.424) * [-1116.605] (-1118.240) (-1121.324) (-1118.091) -- 0:00:44 286500 -- [-1116.841] (-1119.544) (-1121.200) (-1118.195) * (-1122.796) [-1119.790] (-1117.448) (-1116.536) -- 0:00:44 287000 -- (-1120.422) (-1118.229) (-1118.003) [-1119.503] * (-1120.420) (-1116.575) [-1119.740] (-1118.551) -- 0:00:44 287500 -- [-1122.923] (-1118.932) (-1123.813) (-1118.669) * (-1119.424) [-1116.671] (-1123.285) (-1118.338) -- 0:00:44 288000 -- (-1122.612) [-1119.646] (-1119.668) (-1117.323) * [-1119.864] (-1116.479) (-1117.932) (-1121.086) -- 0:00:44 288500 -- (-1117.129) (-1124.446) [-1121.007] (-1118.460) * [-1117.688] (-1117.065) (-1117.925) (-1121.321) -- 0:00:44 289000 -- (-1117.318) [-1119.404] (-1119.368) (-1118.824) * [-1116.652] (-1122.567) (-1124.425) (-1118.796) -- 0:00:44 289500 -- [-1118.009] (-1118.509) (-1121.381) (-1119.779) * [-1118.781] (-1126.417) (-1117.798) (-1117.715) -- 0:00:44 290000 -- (-1118.938) (-1118.363) (-1118.244) [-1119.095] * (-1119.669) [-1118.813] (-1118.460) (-1119.575) -- 0:00:44 Average standard deviation of split frequencies: 0.017029 290500 -- (-1117.144) [-1116.982] (-1118.436) (-1117.668) * (-1121.670) [-1120.330] (-1117.852) (-1117.395) -- 0:00:43 291000 -- (-1120.906) (-1118.118) [-1116.972] (-1119.405) * (-1121.437) [-1119.996] (-1117.345) (-1126.040) -- 0:00:43 291500 -- (-1116.481) (-1120.072) (-1116.187) [-1117.448] * (-1120.036) (-1118.847) [-1118.005] (-1118.381) -- 0:00:43 292000 -- (-1117.429) (-1116.383) [-1116.879] (-1117.218) * (-1118.942) (-1117.986) [-1118.790] (-1116.922) -- 0:00:43 292500 -- [-1117.260] (-1116.683) (-1119.615) (-1116.999) * [-1117.348] (-1118.770) (-1119.301) (-1117.175) -- 0:00:43 293000 -- (-1117.798) (-1116.766) (-1122.025) [-1117.029] * (-1117.771) (-1116.888) (-1117.892) [-1117.478] -- 0:00:43 293500 -- (-1118.410) [-1118.721] (-1119.452) (-1116.852) * (-1117.385) (-1118.210) [-1118.630] (-1119.971) -- 0:00:43 294000 -- (-1118.734) (-1120.342) (-1119.563) [-1118.451] * [-1119.192] (-1118.136) (-1122.082) (-1116.153) -- 0:00:43 294500 -- (-1118.098) (-1116.377) [-1118.057] (-1120.867) * (-1121.172) (-1117.783) (-1122.068) [-1117.850] -- 0:00:43 295000 -- (-1118.902) (-1119.063) [-1117.805] (-1119.957) * (-1118.048) (-1117.039) (-1118.933) [-1117.741] -- 0:00:43 Average standard deviation of split frequencies: 0.017076 295500 -- (-1120.501) (-1118.175) (-1117.418) [-1119.672] * [-1117.319] (-1118.128) (-1117.295) (-1116.950) -- 0:00:42 296000 -- [-1120.123] (-1118.683) (-1118.139) (-1119.501) * (-1116.875) (-1120.330) [-1117.802] (-1117.867) -- 0:00:42 296500 -- (-1118.345) (-1117.873) [-1118.160] (-1122.382) * (-1118.348) (-1117.636) (-1118.510) [-1117.530] -- 0:00:45 297000 -- [-1117.474] (-1117.726) (-1118.549) (-1118.167) * (-1117.935) (-1118.003) (-1119.118) [-1117.660] -- 0:00:44 297500 -- (-1123.719) [-1121.253] (-1120.348) (-1118.881) * (-1116.739) [-1118.811] (-1117.613) (-1116.528) -- 0:00:44 298000 -- (-1121.284) (-1123.437) [-1120.925] (-1116.884) * [-1118.210] (-1119.455) (-1119.743) (-1116.166) -- 0:00:44 298500 -- (-1120.188) (-1119.518) (-1121.776) [-1117.885] * (-1121.245) (-1119.325) (-1119.081) [-1116.205] -- 0:00:44 299000 -- [-1117.932] (-1120.454) (-1120.217) (-1117.856) * (-1118.662) (-1118.367) (-1120.136) [-1118.236] -- 0:00:44 299500 -- [-1119.630] (-1118.071) (-1119.604) (-1116.660) * (-1117.823) [-1117.880] (-1119.723) (-1119.170) -- 0:00:44 300000 -- (-1120.079) (-1118.157) (-1118.514) [-1118.379] * (-1119.903) [-1118.264] (-1119.806) (-1118.144) -- 0:00:44 Average standard deviation of split frequencies: 0.016999 300500 -- (-1120.266) [-1118.882] (-1116.727) (-1120.678) * (-1122.355) (-1118.174) [-1117.107] (-1118.198) -- 0:00:44 301000 -- (-1119.847) (-1119.354) [-1118.980] (-1119.024) * [-1117.178] (-1118.131) (-1122.909) (-1118.038) -- 0:00:44 301500 -- (-1117.012) [-1119.438] (-1119.167) (-1118.992) * (-1118.812) [-1117.348] (-1120.923) (-1119.864) -- 0:00:44 302000 -- [-1117.154] (-1119.846) (-1120.625) (-1117.304) * (-1123.379) [-1118.018] (-1121.423) (-1117.528) -- 0:00:43 302500 -- (-1117.353) (-1121.438) (-1118.011) [-1117.946] * (-1121.003) (-1117.621) (-1121.002) [-1120.797] -- 0:00:43 303000 -- [-1121.236] (-1117.846) (-1118.769) (-1118.542) * (-1119.432) [-1118.155] (-1122.546) (-1121.946) -- 0:00:43 303500 -- (-1121.954) (-1119.589) [-1117.862] (-1117.058) * (-1117.661) (-1119.629) (-1119.592) [-1118.627] -- 0:00:43 304000 -- (-1122.059) (-1120.912) (-1118.150) [-1122.307] * (-1118.258) [-1117.115] (-1121.942) (-1119.295) -- 0:00:43 304500 -- [-1124.266] (-1117.943) (-1117.639) (-1119.388) * (-1117.571) (-1117.112) (-1121.025) [-1124.023] -- 0:00:43 305000 -- (-1121.701) (-1117.322) [-1119.244] (-1120.426) * (-1121.017) (-1117.469) [-1118.119] (-1119.662) -- 0:00:43 Average standard deviation of split frequencies: 0.016541 305500 -- (-1118.443) (-1119.205) [-1117.472] (-1121.444) * [-1117.514] (-1117.587) (-1117.606) (-1116.856) -- 0:00:43 306000 -- (-1121.977) (-1121.980) (-1118.028) [-1120.034] * (-1118.625) (-1119.272) (-1121.032) [-1120.027] -- 0:00:43 306500 -- [-1117.679] (-1121.884) (-1119.111) (-1118.459) * [-1120.247] (-1117.878) (-1122.435) (-1122.812) -- 0:00:42 307000 -- (-1118.397) (-1118.623) [-1120.112] (-1118.807) * (-1118.432) [-1117.598] (-1120.763) (-1124.402) -- 0:00:42 307500 -- (-1121.958) (-1118.669) (-1118.154) [-1118.270] * (-1119.309) [-1117.586] (-1121.152) (-1124.771) -- 0:00:42 308000 -- (-1117.820) (-1119.913) [-1116.860] (-1118.095) * (-1121.010) (-1118.924) [-1118.775] (-1118.060) -- 0:00:42 308500 -- [-1120.231] (-1119.640) (-1119.034) (-1122.002) * (-1121.509) (-1117.784) (-1120.265) [-1119.950] -- 0:00:42 309000 -- (-1120.508) (-1117.723) [-1117.866] (-1120.741) * (-1121.349) (-1119.518) (-1120.376) [-1116.859] -- 0:00:42 309500 -- (-1123.194) (-1118.903) (-1118.054) [-1120.172] * (-1118.412) (-1120.615) (-1120.389) [-1119.294] -- 0:00:44 310000 -- (-1119.849) [-1118.422] (-1121.190) (-1124.125) * (-1120.787) [-1118.937] (-1118.490) (-1116.902) -- 0:00:44 Average standard deviation of split frequencies: 0.017570 310500 -- (-1119.840) [-1117.486] (-1120.260) (-1124.373) * (-1121.173) (-1119.668) [-1116.634] (-1118.297) -- 0:00:44 311000 -- [-1117.089] (-1121.784) (-1119.455) (-1119.768) * (-1121.351) (-1122.732) (-1121.176) [-1116.736] -- 0:00:44 311500 -- (-1117.753) (-1116.418) [-1121.470] (-1119.589) * (-1122.029) [-1118.686] (-1118.564) (-1121.916) -- 0:00:44 312000 -- [-1117.624] (-1120.041) (-1118.448) (-1120.092) * (-1118.123) (-1118.194) [-1123.356] (-1118.716) -- 0:00:44 312500 -- (-1118.539) [-1116.979] (-1124.031) (-1120.092) * (-1118.695) (-1118.810) [-1119.331] (-1118.545) -- 0:00:44 313000 -- (-1117.539) (-1121.580) (-1120.667) [-1117.434] * [-1117.122] (-1121.442) (-1122.836) (-1120.254) -- 0:00:43 313500 -- [-1117.340] (-1120.538) (-1121.050) (-1118.930) * [-1116.569] (-1118.281) (-1117.734) (-1119.399) -- 0:00:43 314000 -- (-1118.568) [-1118.820] (-1119.382) (-1117.369) * (-1117.292) [-1118.692] (-1117.842) (-1120.720) -- 0:00:43 314500 -- (-1118.806) (-1119.445) [-1118.134] (-1117.624) * (-1117.552) [-1118.954] (-1117.252) (-1120.741) -- 0:00:43 315000 -- [-1119.950] (-1118.364) (-1117.592) (-1116.452) * (-1117.553) (-1118.676) [-1117.886] (-1120.012) -- 0:00:43 Average standard deviation of split frequencies: 0.017653 315500 -- (-1118.182) (-1121.113) [-1117.070] (-1116.452) * (-1118.089) [-1121.415] (-1119.983) (-1118.557) -- 0:00:43 316000 -- (-1121.406) [-1116.796] (-1119.209) (-1117.608) * (-1118.296) (-1121.194) (-1118.787) [-1119.076] -- 0:00:43 316500 -- (-1118.414) (-1117.279) [-1119.766] (-1120.898) * (-1118.056) (-1119.261) [-1119.006] (-1118.488) -- 0:00:43 317000 -- (-1118.184) (-1117.080) (-1124.403) [-1119.602] * (-1118.352) [-1118.890] (-1117.829) (-1123.528) -- 0:00:43 317500 -- (-1121.913) [-1119.476] (-1120.207) (-1119.092) * (-1117.296) [-1118.983] (-1117.026) (-1118.268) -- 0:00:42 318000 -- (-1118.667) (-1118.879) (-1121.918) [-1117.948] * (-1119.185) (-1117.355) (-1118.317) [-1120.869] -- 0:00:42 318500 -- (-1122.026) (-1118.602) [-1117.089] (-1118.336) * (-1117.045) [-1119.042] (-1118.089) (-1120.687) -- 0:00:42 319000 -- (-1118.500) (-1120.782) (-1119.622) [-1117.296] * (-1126.529) [-1119.452] (-1117.190) (-1118.542) -- 0:00:42 319500 -- (-1118.540) (-1117.776) (-1119.379) [-1117.891] * (-1125.515) (-1124.992) [-1118.646] (-1120.017) -- 0:00:42 320000 -- (-1116.593) (-1118.210) [-1119.317] (-1120.975) * [-1118.336] (-1123.005) (-1121.214) (-1122.453) -- 0:00:42 Average standard deviation of split frequencies: 0.016480 320500 -- (-1117.101) (-1119.128) (-1120.867) [-1117.882] * (-1116.550) (-1117.240) [-1116.621] (-1119.585) -- 0:00:42 321000 -- (-1116.582) (-1116.758) [-1117.480] (-1118.507) * (-1116.613) (-1117.245) (-1117.014) [-1119.674] -- 0:00:42 321500 -- [-1118.503] (-1117.230) (-1116.401) (-1119.239) * [-1119.323] (-1116.709) (-1117.093) (-1117.195) -- 0:00:42 322000 -- (-1116.889) (-1119.404) [-1118.166] (-1118.941) * (-1121.075) (-1118.199) (-1117.706) [-1117.427] -- 0:00:42 322500 -- (-1118.425) [-1116.853] (-1118.702) (-1118.291) * [-1117.499] (-1118.351) (-1116.943) (-1118.679) -- 0:00:42 323000 -- (-1118.107) (-1116.826) [-1117.987] (-1117.705) * (-1118.067) (-1118.196) [-1118.260] (-1119.397) -- 0:00:41 323500 -- (-1117.207) (-1117.441) (-1121.207) [-1118.606] * (-1117.854) [-1118.662] (-1120.307) (-1120.463) -- 0:00:41 324000 -- (-1118.194) (-1118.486) (-1119.719) [-1118.979] * (-1118.184) (-1118.616) [-1119.481] (-1119.726) -- 0:00:41 324500 -- (-1118.349) (-1117.123) (-1118.894) [-1117.534] * [-1117.459] (-1119.393) (-1117.844) (-1121.645) -- 0:00:41 325000 -- (-1117.468) (-1117.866) [-1121.472] (-1121.448) * [-1117.775] (-1117.122) (-1116.857) (-1118.099) -- 0:00:41 Average standard deviation of split frequencies: 0.016820 325500 -- (-1120.122) [-1120.135] (-1119.707) (-1119.084) * (-1117.359) [-1119.121] (-1117.498) (-1117.639) -- 0:00:43 326000 -- (-1122.548) (-1117.349) (-1124.308) [-1118.293] * (-1116.780) (-1119.722) (-1116.719) [-1117.692] -- 0:00:43 326500 -- [-1119.585] (-1116.464) (-1123.137) (-1117.649) * (-1116.959) (-1120.003) [-1119.753] (-1117.677) -- 0:00:43 327000 -- (-1117.768) (-1120.365) (-1120.715) [-1120.642] * (-1118.134) (-1120.668) (-1123.246) [-1118.942] -- 0:00:43 327500 -- [-1121.411] (-1116.874) (-1121.634) (-1117.752) * (-1117.718) [-1118.461] (-1120.240) (-1118.442) -- 0:00:43 328000 -- (-1120.414) [-1117.406] (-1121.720) (-1117.508) * (-1117.794) [-1119.126] (-1120.226) (-1118.079) -- 0:00:43 328500 -- (-1118.387) [-1117.848] (-1118.654) (-1118.206) * (-1121.295) (-1121.646) (-1118.699) [-1117.719] -- 0:00:42 329000 -- (-1118.714) (-1119.358) (-1119.026) [-1117.839] * (-1118.988) (-1123.297) (-1124.520) [-1117.147] -- 0:00:42 329500 -- (-1120.840) (-1116.730) (-1123.506) [-1116.545] * (-1116.506) [-1120.562] (-1123.830) (-1117.077) -- 0:00:42 330000 -- (-1118.923) (-1117.176) [-1120.369] (-1125.797) * (-1117.884) (-1116.981) (-1118.360) [-1117.280] -- 0:00:42 Average standard deviation of split frequencies: 0.016657 330500 -- (-1123.326) (-1117.136) [-1119.785] (-1118.250) * (-1116.840) [-1116.657] (-1117.316) (-1116.851) -- 0:00:42 331000 -- (-1118.400) [-1119.931] (-1119.768) (-1118.340) * (-1121.385) (-1124.725) [-1117.789] (-1116.766) -- 0:00:42 331500 -- [-1118.047] (-1120.250) (-1117.325) (-1118.091) * (-1120.537) (-1124.374) (-1117.156) [-1118.064] -- 0:00:42 332000 -- (-1117.634) [-1118.921] (-1117.682) (-1117.457) * (-1118.342) (-1117.698) (-1117.528) [-1118.480] -- 0:00:42 332500 -- (-1117.259) (-1119.241) [-1116.929] (-1117.410) * [-1118.283] (-1121.029) (-1117.157) (-1119.063) -- 0:00:42 333000 -- [-1120.455] (-1120.448) (-1120.157) (-1119.762) * (-1121.389) (-1119.191) [-1116.541] (-1119.078) -- 0:00:42 333500 -- (-1116.550) [-1117.185] (-1116.508) (-1120.181) * (-1119.775) [-1119.156] (-1117.487) (-1118.889) -- 0:00:41 334000 -- (-1119.836) (-1118.626) [-1117.600] (-1119.977) * (-1120.585) (-1118.776) (-1118.334) [-1119.705] -- 0:00:41 334500 -- [-1123.415] (-1118.595) (-1117.810) (-1120.295) * (-1119.156) (-1118.819) [-1117.981] (-1118.961) -- 0:00:41 335000 -- (-1121.451) (-1119.455) (-1116.876) [-1119.359] * [-1122.108] (-1117.388) (-1119.865) (-1118.522) -- 0:00:41 Average standard deviation of split frequencies: 0.015433 335500 -- (-1121.948) [-1117.245] (-1116.465) (-1117.612) * (-1121.261) (-1117.205) [-1118.366] (-1118.371) -- 0:00:41 336000 -- [-1121.502] (-1117.747) (-1118.505) (-1117.859) * [-1120.452] (-1121.088) (-1116.993) (-1119.495) -- 0:00:41 336500 -- [-1118.612] (-1118.030) (-1116.869) (-1118.303) * (-1116.818) [-1118.098] (-1117.079) (-1119.162) -- 0:00:41 337000 -- (-1120.951) [-1119.604] (-1117.199) (-1117.184) * (-1117.798) (-1124.171) [-1118.318] (-1119.428) -- 0:00:41 337500 -- [-1116.594] (-1119.494) (-1118.530) (-1118.532) * (-1119.419) (-1119.913) [-1118.053] (-1119.841) -- 0:00:41 338000 -- (-1116.599) (-1122.345) (-1118.523) [-1121.301] * (-1121.262) [-1122.215] (-1118.020) (-1117.922) -- 0:00:41 338500 -- (-1116.468) [-1119.170] (-1120.387) (-1121.364) * (-1118.852) (-1118.562) [-1119.332] (-1120.983) -- 0:00:41 339000 -- (-1116.511) [-1120.422] (-1117.677) (-1119.464) * (-1117.738) (-1117.568) (-1118.733) [-1121.051] -- 0:00:40 339500 -- (-1123.490) (-1117.008) (-1117.492) [-1118.512] * [-1117.595] (-1117.577) (-1119.875) (-1123.666) -- 0:00:40 340000 -- (-1118.108) (-1116.955) [-1117.470] (-1118.420) * (-1116.347) (-1118.266) [-1116.726] (-1122.716) -- 0:00:40 Average standard deviation of split frequencies: 0.015221 340500 -- (-1117.553) (-1119.418) [-1117.613] (-1118.447) * [-1119.691] (-1117.439) (-1118.716) (-1118.584) -- 0:00:40 341000 -- (-1123.096) (-1118.194) [-1117.858] (-1116.946) * (-1119.711) (-1120.364) [-1118.704] (-1117.885) -- 0:00:42 341500 -- (-1117.132) (-1117.906) [-1116.851] (-1117.686) * [-1118.617] (-1117.520) (-1117.282) (-1118.491) -- 0:00:42 342000 -- (-1123.186) (-1118.043) (-1116.981) [-1120.153] * (-1119.891) (-1119.288) (-1117.224) [-1117.844] -- 0:00:42 342500 -- [-1119.365] (-1117.696) (-1116.887) (-1121.279) * (-1119.469) [-1119.906] (-1117.523) (-1125.112) -- 0:00:42 343000 -- (-1118.227) [-1120.374] (-1118.594) (-1118.616) * (-1118.198) (-1118.594) [-1118.682] (-1119.316) -- 0:00:42 343500 -- [-1117.129] (-1116.660) (-1117.082) (-1119.574) * (-1119.307) [-1117.315] (-1118.911) (-1120.699) -- 0:00:42 344000 -- (-1116.759) (-1119.643) (-1116.545) [-1119.854] * (-1116.594) [-1119.893] (-1119.042) (-1118.085) -- 0:00:41 344500 -- (-1118.101) (-1123.324) [-1116.456] (-1118.076) * (-1121.392) (-1118.471) (-1117.354) [-1119.896] -- 0:00:41 345000 -- (-1118.468) (-1121.237) [-1116.703] (-1119.283) * (-1117.824) (-1118.431) [-1118.859] (-1125.565) -- 0:00:41 Average standard deviation of split frequencies: 0.015919 345500 -- [-1120.435] (-1117.600) (-1118.414) (-1118.362) * (-1118.602) [-1116.766] (-1119.067) (-1117.366) -- 0:00:41 346000 -- (-1119.720) (-1117.991) (-1116.585) [-1119.971] * [-1118.800] (-1121.680) (-1118.558) (-1116.910) -- 0:00:41 346500 -- (-1116.393) (-1119.092) [-1117.636] (-1119.948) * [-1117.486] (-1118.046) (-1117.443) (-1117.202) -- 0:00:41 347000 -- (-1117.161) (-1118.895) (-1119.329) [-1120.018] * (-1116.584) (-1119.326) (-1118.273) [-1117.604] -- 0:00:41 347500 -- (-1118.698) [-1117.742] (-1118.628) (-1117.437) * (-1116.700) [-1121.112] (-1120.739) (-1117.901) -- 0:00:41 348000 -- [-1120.939] (-1118.743) (-1118.468) (-1118.231) * (-1118.403) (-1117.873) (-1120.067) [-1117.932] -- 0:00:41 348500 -- [-1119.467] (-1120.499) (-1117.133) (-1117.128) * (-1118.191) (-1120.391) [-1117.291] (-1118.212) -- 0:00:41 349000 -- (-1117.466) (-1117.759) [-1120.938] (-1120.395) * [-1117.710] (-1119.230) (-1116.983) (-1119.109) -- 0:00:41 349500 -- [-1119.716] (-1118.619) (-1119.544) (-1117.878) * (-1118.931) (-1118.589) [-1117.134] (-1122.813) -- 0:00:40 350000 -- (-1116.919) [-1116.622] (-1117.788) (-1116.381) * [-1119.127] (-1118.382) (-1119.948) (-1119.431) -- 0:00:40 Average standard deviation of split frequencies: 0.016729 350500 -- (-1123.209) (-1120.771) (-1118.084) [-1117.210] * (-1117.745) (-1117.646) [-1118.827] (-1123.858) -- 0:00:40 351000 -- (-1125.215) [-1118.757] (-1118.123) (-1119.722) * (-1118.035) (-1117.520) (-1117.928) [-1116.369] -- 0:00:40 351500 -- (-1122.740) (-1119.505) [-1116.969] (-1121.415) * [-1120.814] (-1117.322) (-1118.651) (-1116.957) -- 0:00:40 352000 -- (-1121.454) [-1117.115] (-1117.398) (-1122.092) * (-1118.087) (-1117.894) [-1120.470] (-1116.842) -- 0:00:40 352500 -- (-1123.130) [-1117.707] (-1117.414) (-1119.754) * (-1117.356) (-1119.683) (-1118.092) [-1116.828] -- 0:00:40 353000 -- [-1119.285] (-1116.230) (-1117.564) (-1119.766) * [-1117.988] (-1117.425) (-1119.349) (-1118.226) -- 0:00:40 353500 -- [-1117.290] (-1117.288) (-1119.373) (-1118.829) * (-1118.363) (-1118.076) (-1122.646) [-1117.223] -- 0:00:40 354000 -- (-1118.484) (-1116.819) (-1117.271) [-1120.254] * [-1117.724] (-1121.018) (-1120.154) (-1118.740) -- 0:00:40 354500 -- [-1119.267] (-1118.173) (-1119.454) (-1118.336) * (-1119.852) [-1118.616] (-1119.364) (-1118.940) -- 0:00:40 355000 -- [-1117.444] (-1117.832) (-1117.205) (-1118.346) * [-1121.997] (-1119.801) (-1118.836) (-1120.537) -- 0:00:39 Average standard deviation of split frequencies: 0.016517 355500 -- [-1119.472] (-1120.914) (-1124.309) (-1120.398) * (-1128.988) (-1120.628) (-1118.709) [-1117.484] -- 0:00:39 356000 -- (-1118.794) (-1121.899) (-1120.008) [-1118.402] * (-1128.031) (-1121.238) (-1117.366) [-1116.614] -- 0:00:39 356500 -- (-1120.165) [-1118.423] (-1118.288) (-1120.071) * [-1121.758] (-1116.938) (-1119.301) (-1119.908) -- 0:00:39 357000 -- [-1119.396] (-1120.441) (-1119.771) (-1121.843) * (-1119.550) (-1116.777) (-1117.208) [-1119.180] -- 0:00:39 357500 -- (-1120.451) (-1117.117) [-1118.163] (-1121.744) * (-1119.534) (-1117.718) (-1118.189) [-1119.616] -- 0:00:41 358000 -- (-1120.030) [-1118.183] (-1119.927) (-1118.227) * (-1119.311) (-1119.798) (-1116.354) [-1119.117] -- 0:00:41 358500 -- (-1120.763) (-1119.945) (-1119.888) [-1117.199] * (-1117.955) (-1116.945) [-1116.419] (-1119.902) -- 0:00:41 359000 -- (-1118.189) (-1123.732) [-1121.694] (-1118.107) * (-1118.889) (-1117.218) (-1117.799) [-1117.588] -- 0:00:41 359500 -- (-1117.210) [-1119.157] (-1118.182) (-1119.439) * (-1116.620) (-1117.618) [-1117.551] (-1117.360) -- 0:00:40 360000 -- [-1117.212] (-1117.470) (-1118.341) (-1116.891) * (-1120.041) (-1122.143) [-1118.288] (-1116.672) -- 0:00:40 Average standard deviation of split frequencies: 0.017790 360500 -- (-1116.551) [-1117.318] (-1118.188) (-1116.754) * [-1116.863] (-1122.201) (-1117.394) (-1117.047) -- 0:00:40 361000 -- [-1118.162] (-1118.427) (-1117.811) (-1119.731) * (-1117.724) (-1119.903) [-1119.465] (-1123.925) -- 0:00:40 361500 -- [-1118.018] (-1116.678) (-1119.430) (-1116.587) * (-1118.188) (-1120.260) (-1119.174) [-1120.539] -- 0:00:40 362000 -- (-1117.764) [-1118.009] (-1117.945) (-1116.677) * (-1123.161) [-1118.445] (-1123.695) (-1127.844) -- 0:00:40 362500 -- (-1123.106) [-1117.717] (-1117.453) (-1116.826) * (-1119.501) (-1117.690) [-1117.402] (-1122.812) -- 0:00:40 363000 -- (-1121.241) [-1116.999] (-1122.383) (-1118.091) * (-1119.802) (-1121.641) [-1117.090] (-1118.638) -- 0:00:40 363500 -- (-1117.328) (-1117.801) (-1118.048) [-1118.276] * (-1120.085) (-1123.791) [-1117.850] (-1123.169) -- 0:00:40 364000 -- (-1117.008) [-1117.197] (-1122.908) (-1122.325) * (-1118.973) (-1120.733) [-1118.498] (-1118.737) -- 0:00:40 364500 -- (-1116.931) [-1117.086] (-1120.184) (-1117.798) * (-1118.885) (-1118.267) (-1117.113) [-1117.726] -- 0:00:40 365000 -- (-1123.581) (-1120.128) [-1120.564] (-1118.983) * [-1119.054] (-1116.820) (-1119.579) (-1117.956) -- 0:00:40 Average standard deviation of split frequencies: 0.016744 365500 -- (-1121.667) [-1122.879] (-1120.477) (-1121.995) * (-1120.047) [-1119.034] (-1118.717) (-1117.509) -- 0:00:39 366000 -- (-1118.858) [-1119.555] (-1118.071) (-1118.783) * [-1118.425] (-1125.781) (-1118.930) (-1118.998) -- 0:00:39 366500 -- (-1119.298) (-1118.972) [-1116.591] (-1121.130) * (-1116.991) (-1123.008) [-1119.378] (-1116.925) -- 0:00:39 367000 -- (-1118.346) [-1118.942] (-1117.318) (-1118.494) * (-1119.488) (-1124.894) (-1121.175) [-1116.971] -- 0:00:39 367500 -- (-1117.502) [-1118.290] (-1117.259) (-1122.313) * (-1118.250) [-1118.594] (-1118.282) (-1118.743) -- 0:00:39 368000 -- [-1119.106] (-1120.250) (-1117.117) (-1119.466) * [-1117.688] (-1118.011) (-1120.495) (-1120.025) -- 0:00:39 368500 -- (-1118.081) (-1117.744) (-1116.817) [-1120.458] * [-1116.224] (-1119.534) (-1116.981) (-1121.075) -- 0:00:39 369000 -- (-1117.960) (-1118.148) [-1119.553] (-1117.310) * [-1116.705] (-1116.872) (-1120.762) (-1119.418) -- 0:00:39 369500 -- (-1119.201) (-1119.536) (-1119.865) [-1117.286] * [-1116.362] (-1117.191) (-1120.660) (-1117.068) -- 0:00:39 370000 -- (-1118.950) (-1118.455) (-1118.660) [-1118.038] * (-1116.458) (-1120.245) [-1119.077] (-1117.780) -- 0:00:39 Average standard deviation of split frequencies: 0.017269 370500 -- (-1117.314) (-1118.927) (-1117.520) [-1119.785] * (-1117.191) (-1118.308) [-1117.865] (-1119.263) -- 0:00:39 371000 -- (-1119.644) (-1121.420) [-1116.632] (-1119.265) * (-1119.027) (-1119.139) [-1118.097] (-1119.327) -- 0:00:38 371500 -- (-1117.182) (-1120.136) [-1116.884] (-1121.433) * (-1117.372) [-1118.296] (-1117.003) (-1123.510) -- 0:00:38 372000 -- (-1120.365) (-1117.151) [-1131.417] (-1121.151) * (-1119.519) (-1124.430) [-1117.458] (-1118.943) -- 0:00:38 372500 -- [-1117.917] (-1120.013) (-1126.360) (-1117.718) * [-1120.616] (-1117.040) (-1117.063) (-1117.705) -- 0:00:38 373000 -- (-1118.830) (-1118.759) [-1119.168] (-1127.506) * [-1116.841] (-1117.999) (-1118.463) (-1119.168) -- 0:00:38 373500 -- [-1117.993] (-1116.894) (-1118.765) (-1119.199) * (-1121.374) [-1116.878] (-1120.590) (-1118.365) -- 0:00:40 374000 -- (-1120.789) (-1117.216) [-1117.260] (-1118.373) * (-1120.277) (-1116.703) [-1120.416] (-1116.852) -- 0:00:40 374500 -- (-1119.031) (-1116.846) [-1117.366] (-1117.642) * (-1116.478) [-1116.827] (-1120.596) (-1117.888) -- 0:00:40 375000 -- [-1118.508] (-1117.377) (-1121.259) (-1117.103) * (-1116.311) (-1116.959) (-1118.455) [-1120.623] -- 0:00:40 Average standard deviation of split frequencies: 0.016892 375500 -- (-1119.099) (-1117.065) (-1117.583) [-1118.470] * (-1116.155) [-1120.268] (-1117.647) (-1117.981) -- 0:00:39 376000 -- (-1122.087) (-1116.988) [-1117.146] (-1118.034) * (-1116.355) (-1119.464) (-1116.976) [-1118.814] -- 0:00:39 376500 -- (-1116.165) (-1117.977) (-1117.881) [-1118.566] * (-1118.893) (-1122.506) [-1120.135] (-1120.885) -- 0:00:39 377000 -- (-1118.004) [-1117.095] (-1118.123) (-1117.585) * (-1121.620) [-1117.397] (-1123.176) (-1119.865) -- 0:00:39 377500 -- [-1118.880] (-1122.434) (-1116.925) (-1120.675) * [-1118.015] (-1120.612) (-1122.697) (-1118.592) -- 0:00:39 378000 -- [-1118.702] (-1118.217) (-1116.512) (-1118.540) * [-1116.978] (-1118.398) (-1122.700) (-1117.645) -- 0:00:39 378500 -- [-1117.283] (-1119.935) (-1118.479) (-1117.733) * (-1117.814) [-1118.011] (-1117.367) (-1118.822) -- 0:00:39 379000 -- [-1116.975] (-1118.815) (-1120.839) (-1116.632) * [-1119.314] (-1118.933) (-1116.480) (-1119.519) -- 0:00:39 379500 -- (-1116.857) (-1123.103) [-1117.417] (-1118.719) * (-1118.845) [-1118.782] (-1116.922) (-1118.963) -- 0:00:39 380000 -- [-1118.156] (-1116.908) (-1117.874) (-1126.492) * (-1120.649) [-1120.425] (-1117.330) (-1119.366) -- 0:00:39 Average standard deviation of split frequencies: 0.016099 380500 -- (-1119.336) [-1118.870] (-1117.894) (-1118.880) * (-1121.482) [-1120.846] (-1117.350) (-1122.892) -- 0:00:39 381000 -- [-1118.024] (-1118.104) (-1117.651) (-1121.733) * (-1120.358) (-1119.280) [-1116.414] (-1120.372) -- 0:00:38 381500 -- [-1121.972] (-1120.737) (-1122.981) (-1120.772) * [-1116.850] (-1120.079) (-1118.366) (-1119.574) -- 0:00:38 382000 -- (-1119.243) (-1117.545) (-1119.685) [-1121.406] * (-1118.451) (-1119.552) (-1117.437) [-1120.046] -- 0:00:38 382500 -- (-1119.653) [-1116.998] (-1120.443) (-1118.718) * (-1117.381) (-1119.143) (-1116.663) [-1118.694] -- 0:00:38 383000 -- (-1119.624) (-1118.686) (-1122.796) [-1118.276] * (-1118.797) (-1119.236) [-1117.752] (-1117.418) -- 0:00:38 383500 -- (-1118.289) (-1119.052) [-1121.225] (-1116.627) * (-1122.429) (-1119.356) [-1117.471] (-1118.861) -- 0:00:38 384000 -- (-1123.005) [-1118.430] (-1119.780) (-1116.936) * (-1120.540) [-1119.434] (-1123.873) (-1116.663) -- 0:00:38 384500 -- (-1117.081) (-1116.991) (-1118.966) [-1118.265] * (-1119.445) (-1118.475) (-1119.831) [-1116.679] -- 0:00:38 385000 -- (-1122.643) (-1119.468) (-1120.867) [-1118.369] * (-1118.146) [-1121.307] (-1123.557) (-1117.954) -- 0:00:38 Average standard deviation of split frequencies: 0.015298 385500 -- (-1116.823) (-1122.284) [-1117.208] (-1117.925) * [-1117.902] (-1117.431) (-1118.928) (-1116.554) -- 0:00:38 386000 -- [-1117.821] (-1116.283) (-1117.936) (-1117.417) * (-1117.613) (-1118.317) (-1119.404) [-1116.256] -- 0:00:38 386500 -- (-1119.040) (-1119.798) [-1116.995] (-1118.356) * [-1116.817] (-1118.416) (-1118.158) (-1117.112) -- 0:00:38 387000 -- (-1119.649) (-1117.083) (-1118.774) [-1117.124] * [-1116.188] (-1117.504) (-1117.609) (-1117.522) -- 0:00:38 387500 -- (-1119.126) [-1117.257] (-1121.443) (-1118.701) * (-1116.651) [-1118.410] (-1117.609) (-1117.523) -- 0:00:37 388000 -- (-1118.056) (-1119.442) [-1118.542] (-1119.337) * (-1117.151) (-1118.458) (-1119.916) [-1117.490] -- 0:00:37 388500 -- [-1117.939] (-1122.129) (-1117.228) (-1119.418) * (-1116.955) (-1116.217) (-1118.757) [-1117.270] -- 0:00:37 389000 -- [-1117.944] (-1123.669) (-1116.973) (-1117.809) * (-1118.226) [-1117.450] (-1123.871) (-1121.687) -- 0:00:37 389500 -- (-1118.617) [-1118.390] (-1123.963) (-1117.681) * (-1119.793) (-1116.295) [-1117.942] (-1122.806) -- 0:00:37 390000 -- [-1117.854] (-1119.799) (-1120.485) (-1118.271) * (-1122.296) (-1117.499) [-1117.814] (-1124.141) -- 0:00:39 Average standard deviation of split frequencies: 0.014078 390500 -- (-1118.853) [-1119.304] (-1119.287) (-1119.039) * (-1121.363) (-1118.636) [-1117.711] (-1120.064) -- 0:00:39 391000 -- (-1121.046) (-1118.322) (-1118.759) [-1118.899] * (-1117.953) (-1117.942) (-1117.764) [-1119.545] -- 0:00:38 391500 -- (-1118.313) [-1117.338] (-1121.912) (-1118.903) * (-1117.505) (-1118.460) [-1116.972] (-1120.563) -- 0:00:38 392000 -- (-1118.530) (-1119.721) (-1121.341) [-1118.362] * [-1117.710] (-1118.677) (-1117.392) (-1121.169) -- 0:00:38 392500 -- [-1119.734] (-1120.706) (-1122.985) (-1117.198) * (-1117.411) (-1118.469) (-1117.350) [-1123.330] -- 0:00:38 393000 -- (-1124.995) (-1119.327) (-1121.207) [-1116.980] * [-1117.952] (-1117.820) (-1117.556) (-1126.489) -- 0:00:38 393500 -- (-1126.491) [-1117.528] (-1118.311) (-1118.667) * [-1118.983] (-1119.649) (-1117.465) (-1122.456) -- 0:00:38 394000 -- (-1124.694) (-1119.436) [-1117.356] (-1118.429) * (-1118.820) [-1117.842] (-1118.816) (-1119.329) -- 0:00:38 394500 -- (-1117.162) (-1118.146) [-1119.773] (-1119.087) * (-1118.982) (-1116.983) (-1125.223) [-1120.450] -- 0:00:38 395000 -- (-1118.312) (-1119.191) [-1118.242] (-1120.667) * (-1120.249) (-1117.031) [-1117.612] (-1120.987) -- 0:00:38 Average standard deviation of split frequencies: 0.013165 395500 -- (-1119.129) (-1120.729) [-1117.114] (-1117.623) * [-1119.801] (-1119.136) (-1119.789) (-1121.900) -- 0:00:38 396000 -- (-1118.474) [-1120.140] (-1121.940) (-1120.006) * (-1117.165) (-1119.433) [-1120.166] (-1124.731) -- 0:00:38 396500 -- (-1116.481) (-1117.920) [-1118.558] (-1118.950) * (-1116.962) (-1120.284) (-1120.056) [-1118.550] -- 0:00:38 397000 -- (-1118.684) [-1117.068] (-1118.916) (-1120.781) * [-1119.307] (-1120.937) (-1119.822) (-1118.577) -- 0:00:37 397500 -- (-1118.772) (-1122.296) [-1119.168] (-1118.116) * (-1120.296) [-1118.037] (-1117.459) (-1118.508) -- 0:00:37 398000 -- (-1119.362) [-1118.537] (-1118.359) (-1118.531) * (-1119.636) [-1117.459] (-1118.349) (-1117.472) -- 0:00:37 398500 -- (-1122.674) (-1118.728) (-1117.590) [-1119.104] * [-1117.069] (-1119.165) (-1119.706) (-1116.592) -- 0:00:37 399000 -- [-1116.830] (-1117.832) (-1116.440) (-1119.074) * (-1118.013) [-1118.497] (-1119.785) (-1119.946) -- 0:00:37 399500 -- (-1117.277) [-1118.240] (-1116.592) (-1119.502) * (-1120.024) [-1117.746] (-1118.686) (-1120.733) -- 0:00:37 400000 -- (-1122.182) (-1116.629) (-1120.206) [-1116.912] * [-1118.199] (-1117.999) (-1120.312) (-1117.132) -- 0:00:37 Average standard deviation of split frequencies: 0.013751 400500 -- (-1122.509) [-1118.033] (-1116.876) (-1116.980) * [-1118.315] (-1117.264) (-1121.297) (-1117.607) -- 0:00:37 401000 -- (-1123.068) (-1117.223) (-1118.736) [-1116.655] * (-1118.088) [-1116.617] (-1121.030) (-1117.332) -- 0:00:37 401500 -- [-1121.534] (-1118.529) (-1121.304) (-1117.891) * (-1116.756) (-1117.948) (-1118.948) [-1119.099] -- 0:00:37 402000 -- (-1121.440) [-1120.581] (-1118.708) (-1118.554) * [-1116.463] (-1116.208) (-1118.082) (-1117.105) -- 0:00:37 402500 -- [-1116.644] (-1118.312) (-1117.869) (-1117.600) * [-1117.073] (-1117.867) (-1117.515) (-1117.094) -- 0:00:37 403000 -- (-1116.874) (-1117.052) (-1117.980) [-1117.893] * (-1117.431) (-1117.722) [-1116.619] (-1116.728) -- 0:00:37 403500 -- (-1118.405) (-1121.456) [-1116.491] (-1121.504) * (-1117.724) (-1118.072) [-1117.459] (-1119.730) -- 0:00:36 404000 -- (-1119.054) [-1119.718] (-1121.050) (-1120.480) * [-1118.178] (-1118.303) (-1117.249) (-1118.896) -- 0:00:36 404500 -- (-1117.173) (-1118.134) [-1118.754] (-1118.090) * (-1119.106) [-1117.805] (-1117.867) (-1118.900) -- 0:00:36 405000 -- [-1116.729] (-1117.754) (-1118.577) (-1119.288) * [-1119.587] (-1119.067) (-1119.381) (-1117.935) -- 0:00:36 Average standard deviation of split frequencies: 0.012917 405500 -- (-1117.315) [-1117.441] (-1119.860) (-1118.206) * (-1119.622) (-1117.827) (-1117.849) [-1117.506] -- 0:00:36 406000 -- (-1120.047) (-1119.274) [-1122.919] (-1118.375) * (-1117.995) (-1118.255) [-1117.390] (-1116.597) -- 0:00:38 406500 -- (-1118.238) [-1118.348] (-1123.113) (-1118.460) * (-1116.269) (-1117.481) [-1117.516] (-1118.404) -- 0:00:37 407000 -- (-1119.200) [-1119.319] (-1120.590) (-1119.008) * (-1118.182) (-1118.372) (-1118.085) [-1119.494] -- 0:00:37 407500 -- (-1118.635) (-1119.541) [-1119.811] (-1117.562) * (-1117.055) (-1120.625) [-1121.069] (-1122.473) -- 0:00:37 408000 -- (-1118.562) [-1120.932] (-1118.747) (-1119.250) * [-1117.162] (-1120.247) (-1121.700) (-1118.148) -- 0:00:37 408500 -- [-1119.140] (-1117.491) (-1118.571) (-1118.986) * (-1117.300) [-1122.205] (-1121.237) (-1120.043) -- 0:00:37 409000 -- (-1116.805) (-1118.075) [-1121.927] (-1117.831) * (-1117.341) (-1117.390) [-1116.976] (-1118.900) -- 0:00:37 409500 -- (-1122.453) (-1119.005) [-1121.539] (-1117.510) * (-1116.351) (-1119.735) (-1116.751) [-1119.323] -- 0:00:37 410000 -- (-1118.100) [-1119.057] (-1118.123) (-1119.571) * (-1122.371) [-1118.639] (-1120.730) (-1119.266) -- 0:00:37 Average standard deviation of split frequencies: 0.012559 410500 -- (-1118.157) (-1121.014) [-1118.012] (-1116.587) * (-1122.327) (-1118.388) (-1116.936) [-1118.267] -- 0:00:37 411000 -- (-1118.291) [-1119.039] (-1118.156) (-1120.521) * [-1116.825] (-1119.161) (-1118.591) (-1117.753) -- 0:00:37 411500 -- (-1117.232) (-1120.716) (-1118.581) [-1119.589] * [-1117.602] (-1120.000) (-1117.480) (-1117.858) -- 0:00:37 412000 -- (-1123.986) (-1121.051) (-1119.343) [-1120.047] * [-1118.619] (-1119.186) (-1117.238) (-1118.819) -- 0:00:37 412500 -- (-1121.838) (-1118.286) [-1118.196] (-1119.622) * (-1121.732) (-1122.086) [-1117.884] (-1117.943) -- 0:00:37 413000 -- [-1121.662] (-1118.219) (-1120.153) (-1116.949) * (-1120.379) (-1120.240) (-1119.005) [-1117.400] -- 0:00:36 413500 -- [-1119.984] (-1117.209) (-1117.356) (-1118.642) * [-1117.093] (-1118.280) (-1118.637) (-1117.452) -- 0:00:36 414000 -- (-1117.735) (-1118.348) (-1116.653) [-1119.509] * (-1119.786) [-1118.300] (-1118.120) (-1117.463) -- 0:00:36 414500 -- (-1116.624) (-1120.426) [-1116.931] (-1121.198) * (-1117.613) (-1118.383) [-1117.864] (-1123.206) -- 0:00:36 415000 -- (-1116.625) [-1116.582] (-1120.611) (-1118.602) * (-1117.689) (-1119.080) [-1116.516] (-1122.323) -- 0:00:36 Average standard deviation of split frequencies: 0.012182 415500 -- [-1116.623] (-1117.554) (-1116.727) (-1118.713) * (-1120.504) (-1118.014) [-1116.990] (-1119.627) -- 0:00:36 416000 -- (-1116.762) [-1116.424] (-1122.449) (-1119.199) * (-1121.719) (-1122.732) (-1121.062) [-1117.048] -- 0:00:36 416500 -- (-1117.991) (-1116.677) [-1119.266] (-1117.871) * (-1118.670) (-1118.644) (-1118.361) [-1120.996] -- 0:00:36 417000 -- [-1117.334] (-1117.544) (-1116.925) (-1120.144) * (-1119.885) (-1120.839) [-1117.889] (-1118.252) -- 0:00:36 417500 -- (-1119.439) (-1118.023) (-1117.442) [-1118.314] * (-1119.835) (-1120.355) [-1122.836] (-1118.839) -- 0:00:36 418000 -- (-1117.156) [-1120.836] (-1119.154) (-1118.858) * [-1119.557] (-1117.682) (-1120.549) (-1117.558) -- 0:00:36 418500 -- [-1116.335] (-1117.009) (-1117.411) (-1122.433) * (-1117.270) (-1117.480) (-1116.317) [-1119.964] -- 0:00:36 419000 -- (-1117.868) [-1117.611] (-1117.493) (-1119.040) * [-1123.125] (-1117.555) (-1119.553) (-1119.739) -- 0:00:36 419500 -- (-1118.339) [-1117.635] (-1118.553) (-1120.653) * (-1118.134) (-1116.773) (-1122.371) [-1117.528] -- 0:00:35 420000 -- (-1117.883) (-1118.324) [-1118.012] (-1122.169) * (-1119.543) (-1117.650) (-1119.630) [-1119.392] -- 0:00:35 Average standard deviation of split frequencies: 0.012747 420500 -- [-1117.762] (-1119.585) (-1117.764) (-1119.709) * (-1119.523) [-1116.393] (-1119.909) (-1117.245) -- 0:00:35 421000 -- (-1117.377) [-1117.263] (-1118.898) (-1122.634) * (-1123.710) (-1118.330) [-1117.107] (-1118.104) -- 0:00:35 421500 -- [-1117.906] (-1117.201) (-1118.250) (-1117.680) * [-1120.894] (-1116.650) (-1118.981) (-1118.039) -- 0:00:35 422000 -- (-1117.085) (-1116.789) [-1118.519] (-1117.548) * [-1118.902] (-1118.170) (-1118.492) (-1118.338) -- 0:00:35 422500 -- [-1117.336] (-1118.562) (-1116.645) (-1118.952) * (-1118.867) [-1123.253] (-1119.233) (-1122.440) -- 0:00:36 423000 -- [-1117.124] (-1116.484) (-1116.630) (-1119.587) * [-1120.869] (-1125.739) (-1121.053) (-1118.537) -- 0:00:36 423500 -- (-1117.475) (-1117.722) (-1116.808) [-1119.931] * (-1121.453) (-1117.886) [-1117.221] (-1117.928) -- 0:00:36 424000 -- (-1117.475) [-1117.450] (-1116.421) (-1120.803) * (-1120.905) (-1119.042) [-1116.640] (-1116.869) -- 0:00:36 424500 -- [-1118.346] (-1116.405) (-1119.742) (-1119.817) * (-1119.633) (-1118.763) [-1119.491] (-1117.389) -- 0:00:36 425000 -- [-1117.493] (-1118.244) (-1121.199) (-1116.736) * (-1119.373) (-1120.484) [-1117.980] (-1118.250) -- 0:00:36 Average standard deviation of split frequencies: 0.013586 425500 -- [-1116.340] (-1119.037) (-1120.004) (-1116.759) * (-1119.102) [-1117.094] (-1118.512) (-1117.950) -- 0:00:36 426000 -- (-1116.906) [-1119.120] (-1118.633) (-1121.290) * (-1118.824) (-1120.688) [-1118.031] (-1119.012) -- 0:00:36 426500 -- [-1116.677] (-1120.716) (-1117.907) (-1119.419) * (-1117.991) [-1119.555] (-1116.928) (-1119.079) -- 0:00:36 427000 -- (-1117.192) [-1117.375] (-1122.350) (-1122.013) * [-1117.103] (-1120.808) (-1116.631) (-1120.046) -- 0:00:36 427500 -- (-1118.150) (-1117.229) [-1117.160] (-1117.474) * (-1117.054) [-1120.914] (-1117.447) (-1121.067) -- 0:00:36 428000 -- (-1117.932) [-1118.147] (-1119.469) (-1118.254) * [-1120.577] (-1119.783) (-1118.140) (-1117.053) -- 0:00:36 428500 -- [-1119.545] (-1118.813) (-1120.876) (-1119.899) * (-1118.767) (-1119.038) (-1122.939) [-1122.024] -- 0:00:36 429000 -- (-1121.161) [-1117.384] (-1121.100) (-1120.373) * (-1119.211) (-1120.058) (-1117.995) [-1125.729] -- 0:00:35 429500 -- (-1118.832) (-1118.246) (-1116.651) [-1118.218] * (-1117.978) (-1119.990) [-1116.148] (-1125.190) -- 0:00:35 430000 -- (-1120.069) [-1118.285] (-1116.230) (-1118.726) * (-1119.418) [-1119.303] (-1117.457) (-1121.089) -- 0:00:35 Average standard deviation of split frequencies: 0.013196 430500 -- (-1118.619) [-1116.442] (-1119.885) (-1118.790) * (-1125.563) (-1123.023) [-1118.026] (-1118.658) -- 0:00:35 431000 -- (-1117.653) (-1118.858) [-1116.988] (-1122.708) * [-1119.230] (-1116.480) (-1118.790) (-1117.896) -- 0:00:35 431500 -- (-1117.651) (-1120.204) (-1117.971) [-1118.800] * (-1118.344) (-1120.728) (-1122.580) [-1116.615] -- 0:00:35 432000 -- (-1118.353) (-1120.267) (-1122.677) [-1118.719] * (-1117.912) (-1122.185) [-1121.291] (-1122.083) -- 0:00:35 432500 -- (-1117.823) [-1118.786] (-1119.752) (-1122.791) * (-1117.505) (-1122.449) [-1123.418] (-1117.370) -- 0:00:35 433000 -- (-1118.386) (-1122.414) (-1118.651) [-1121.273] * [-1120.087] (-1124.988) (-1118.682) (-1119.955) -- 0:00:35 433500 -- (-1119.849) [-1118.108] (-1117.558) (-1122.164) * (-1120.103) [-1117.192] (-1119.326) (-1118.795) -- 0:00:35 434000 -- (-1119.116) [-1118.644] (-1122.006) (-1117.562) * (-1119.041) [-1117.046] (-1120.008) (-1117.429) -- 0:00:35 434500 -- (-1118.641) [-1119.416] (-1117.289) (-1121.409) * (-1119.741) [-1117.006] (-1118.491) (-1117.560) -- 0:00:35 435000 -- (-1117.797) (-1118.620) [-1117.849] (-1120.648) * (-1120.803) (-1117.276) (-1116.909) [-1118.698] -- 0:00:35 Average standard deviation of split frequencies: 0.013430 435500 -- (-1120.969) (-1118.606) [-1118.682] (-1123.152) * (-1119.332) (-1117.771) (-1119.227) [-1119.162] -- 0:00:34 436000 -- [-1120.459] (-1120.283) (-1118.406) (-1118.956) * (-1117.695) [-1116.577] (-1118.978) (-1117.482) -- 0:00:34 436500 -- (-1119.409) (-1117.789) [-1118.219] (-1119.072) * (-1120.566) [-1117.077] (-1118.571) (-1116.732) -- 0:00:34 437000 -- (-1117.754) [-1118.448] (-1120.505) (-1117.087) * [-1119.076] (-1118.182) (-1117.449) (-1119.724) -- 0:00:34 437500 -- (-1116.984) (-1117.415) [-1119.848] (-1119.173) * [-1118.592] (-1119.072) (-1117.741) (-1118.577) -- 0:00:34 438000 -- [-1116.921] (-1117.015) (-1119.540) (-1119.088) * (-1122.548) [-1117.233] (-1119.754) (-1117.209) -- 0:00:34 438500 -- (-1117.187) [-1117.347] (-1117.707) (-1121.286) * (-1121.779) (-1119.040) (-1117.208) [-1120.605] -- 0:00:34 439000 -- [-1121.484] (-1120.246) (-1118.528) (-1119.516) * [-1117.903] (-1118.901) (-1118.389) (-1119.890) -- 0:00:35 439500 -- (-1117.995) (-1118.996) (-1118.227) [-1116.842] * [-1121.903] (-1121.528) (-1116.324) (-1121.276) -- 0:00:35 440000 -- (-1123.113) (-1118.737) (-1119.110) [-1116.875] * [-1121.562] (-1117.959) (-1123.719) (-1119.938) -- 0:00:35 Average standard deviation of split frequencies: 0.012235 440500 -- [-1119.605] (-1116.708) (-1116.879) (-1117.522) * (-1121.062) (-1118.820) [-1120.165] (-1118.590) -- 0:00:35 441000 -- (-1116.385) (-1117.834) [-1116.431] (-1116.294) * (-1118.058) [-1122.515] (-1118.020) (-1119.054) -- 0:00:35 441500 -- (-1117.206) (-1121.267) (-1119.213) [-1116.764] * (-1118.714) (-1120.809) [-1117.594] (-1127.259) -- 0:00:35 442000 -- [-1117.930] (-1119.774) (-1119.215) (-1119.391) * (-1117.849) (-1119.213) (-1117.134) [-1123.879] -- 0:00:35 442500 -- (-1118.588) (-1117.523) (-1116.400) [-1119.766] * (-1117.702) (-1116.691) [-1119.860] (-1120.132) -- 0:00:35 443000 -- (-1118.659) (-1117.464) [-1120.250] (-1117.715) * (-1117.531) (-1118.893) (-1117.288) [-1119.889] -- 0:00:35 443500 -- (-1117.642) (-1119.330) [-1119.687] (-1118.574) * (-1116.775) [-1116.509] (-1117.060) (-1119.945) -- 0:00:35 444000 -- [-1119.044] (-1117.408) (-1117.003) (-1118.576) * [-1119.454] (-1116.767) (-1122.599) (-1119.751) -- 0:00:35 444500 -- (-1121.444) [-1117.010] (-1121.991) (-1117.055) * [-1117.327] (-1118.314) (-1120.389) (-1118.660) -- 0:00:34 445000 -- (-1125.444) (-1117.920) (-1118.918) [-1116.751] * (-1117.746) [-1117.167] (-1119.100) (-1117.997) -- 0:00:34 Average standard deviation of split frequencies: 0.013153 445500 -- (-1117.575) (-1117.904) (-1119.946) [-1116.374] * (-1119.006) (-1129.309) (-1118.103) [-1119.883] -- 0:00:34 446000 -- [-1118.718] (-1121.360) (-1119.833) (-1118.725) * (-1118.550) (-1124.278) (-1117.363) [-1118.823] -- 0:00:34 446500 -- [-1120.322] (-1117.320) (-1117.618) (-1119.377) * (-1119.450) (-1120.035) (-1117.999) [-1118.691] -- 0:00:34 447000 -- (-1118.450) (-1117.336) [-1117.763] (-1119.613) * (-1118.731) (-1120.784) [-1117.013] (-1117.364) -- 0:00:34 447500 -- (-1117.253) (-1117.442) [-1117.578] (-1121.049) * (-1118.091) (-1124.347) (-1118.209) [-1118.505] -- 0:00:34 448000 -- (-1117.048) (-1120.865) [-1117.994] (-1116.972) * (-1117.750) [-1122.160] (-1121.535) (-1122.130) -- 0:00:34 448500 -- (-1119.305) (-1123.700) [-1117.911] (-1120.952) * [-1118.473] (-1124.471) (-1125.025) (-1116.927) -- 0:00:34 449000 -- [-1119.300] (-1117.535) (-1121.783) (-1118.881) * (-1122.865) [-1118.617] (-1118.926) (-1118.414) -- 0:00:34 449500 -- (-1122.058) (-1118.257) (-1121.241) [-1117.786] * (-1118.154) (-1118.103) [-1118.448] (-1120.064) -- 0:00:34 450000 -- (-1125.395) [-1118.933] (-1118.474) (-1117.768) * (-1120.005) (-1118.380) [-1117.967] (-1118.654) -- 0:00:34 Average standard deviation of split frequencies: 0.013229 450500 -- (-1118.039) (-1119.557) [-1117.828] (-1116.892) * (-1120.229) (-1119.620) [-1117.553] (-1116.540) -- 0:00:34 451000 -- (-1117.873) (-1119.164) [-1117.245] (-1117.285) * (-1117.708) (-1116.812) (-1117.682) [-1117.339] -- 0:00:34 451500 -- (-1119.901) [-1116.791] (-1117.910) (-1118.319) * (-1120.161) (-1117.474) (-1117.975) [-1117.574] -- 0:00:34 452000 -- (-1123.912) [-1117.267] (-1118.422) (-1119.141) * (-1116.845) [-1121.469] (-1123.544) (-1117.869) -- 0:00:33 452500 -- (-1123.827) [-1117.229] (-1118.424) (-1118.888) * (-1119.198) [-1119.951] (-1121.370) (-1117.555) -- 0:00:33 453000 -- (-1118.328) [-1118.301] (-1117.848) (-1118.356) * (-1120.998) (-1117.095) (-1118.828) [-1117.646] -- 0:00:33 453500 -- (-1118.781) (-1119.024) [-1117.540] (-1119.393) * (-1122.251) [-1119.145] (-1118.854) (-1116.946) -- 0:00:33 454000 -- [-1118.957] (-1123.598) (-1117.384) (-1120.429) * (-1119.274) [-1118.143] (-1118.831) (-1117.093) -- 0:00:33 454500 -- (-1121.180) [-1117.386] (-1117.873) (-1118.434) * (-1118.449) (-1119.935) (-1119.840) [-1116.447] -- 0:00:33 455000 -- (-1124.613) [-1117.676] (-1117.019) (-1119.934) * (-1117.795) (-1119.898) (-1121.030) [-1116.457] -- 0:00:33 Average standard deviation of split frequencies: 0.013439 455500 -- (-1120.604) (-1118.522) [-1118.708] (-1121.309) * (-1118.549) [-1120.868] (-1117.942) (-1116.722) -- 0:00:34 456000 -- [-1117.405] (-1117.163) (-1118.670) (-1119.083) * (-1118.145) (-1118.175) (-1117.598) [-1118.655] -- 0:00:34 456500 -- [-1118.453] (-1117.322) (-1118.343) (-1121.987) * (-1118.289) (-1125.094) [-1117.594] (-1120.245) -- 0:00:34 457000 -- (-1117.789) (-1117.649) (-1120.404) [-1117.990] * (-1118.818) [-1120.272] (-1119.254) (-1118.567) -- 0:00:34 457500 -- [-1120.356] (-1118.937) (-1119.454) (-1118.085) * (-1119.338) (-1123.542) (-1125.436) [-1119.394] -- 0:00:34 458000 -- [-1118.106] (-1120.196) (-1118.642) (-1117.341) * (-1119.792) (-1122.579) [-1118.560] (-1121.051) -- 0:00:34 458500 -- (-1120.165) (-1119.325) [-1118.807] (-1117.434) * (-1117.773) (-1122.417) (-1118.796) [-1118.147] -- 0:00:34 459000 -- [-1123.240] (-1117.990) (-1117.479) (-1119.533) * (-1117.692) (-1120.178) (-1117.788) [-1117.321] -- 0:00:34 459500 -- (-1124.089) [-1117.504] (-1120.184) (-1121.329) * (-1119.066) (-1119.423) (-1116.789) [-1117.046] -- 0:00:34 460000 -- [-1118.236] (-1121.738) (-1119.014) (-1119.913) * [-1119.153] (-1117.483) (-1120.132) (-1117.189) -- 0:00:34 Average standard deviation of split frequencies: 0.013122 460500 -- (-1117.391) (-1121.664) (-1118.457) [-1119.709] * (-1121.026) [-1119.176] (-1125.279) (-1116.985) -- 0:00:33 461000 -- (-1117.254) (-1116.895) (-1116.942) [-1119.785] * [-1119.960] (-1118.111) (-1121.131) (-1118.330) -- 0:00:33 461500 -- (-1118.502) (-1116.607) [-1117.746] (-1119.468) * [-1118.233] (-1118.398) (-1120.259) (-1119.606) -- 0:00:33 462000 -- [-1121.390] (-1120.036) (-1121.136) (-1119.087) * [-1118.167] (-1122.161) (-1117.253) (-1121.241) -- 0:00:33 462500 -- [-1121.968] (-1118.437) (-1121.813) (-1117.788) * (-1116.697) (-1119.656) (-1117.196) [-1118.279] -- 0:00:33 463000 -- [-1120.340] (-1120.059) (-1122.352) (-1119.541) * (-1118.878) [-1117.669] (-1117.385) (-1119.442) -- 0:00:33 463500 -- [-1116.673] (-1118.754) (-1118.142) (-1119.179) * [-1118.845] (-1117.748) (-1118.060) (-1118.066) -- 0:00:33 464000 -- (-1119.086) (-1117.632) [-1121.792] (-1122.789) * (-1118.481) (-1118.535) [-1116.625] (-1119.626) -- 0:00:33 464500 -- (-1119.122) (-1118.733) [-1122.494] (-1118.479) * (-1118.117) (-1118.574) [-1117.280] (-1117.334) -- 0:00:33 465000 -- (-1120.015) (-1123.887) (-1122.574) [-1118.118] * (-1121.538) (-1116.951) (-1117.171) [-1117.483] -- 0:00:33 Average standard deviation of split frequencies: 0.012794 465500 -- (-1120.241) [-1123.953] (-1122.345) (-1117.203) * (-1118.311) (-1119.434) (-1117.769) [-1116.819] -- 0:00:33 466000 -- [-1121.203] (-1118.931) (-1119.671) (-1118.807) * [-1120.114] (-1119.639) (-1117.475) (-1118.014) -- 0:00:33 466500 -- (-1117.213) (-1119.188) (-1119.426) [-1119.932] * (-1120.220) (-1120.665) (-1119.550) [-1117.824] -- 0:00:33 467000 -- (-1117.631) [-1116.789] (-1119.197) (-1117.627) * (-1117.825) (-1121.063) (-1118.089) [-1119.255] -- 0:00:33 467500 -- (-1120.109) [-1119.051] (-1121.179) (-1116.460) * (-1119.286) (-1122.100) [-1117.842] (-1117.703) -- 0:00:33 468000 -- (-1118.577) (-1120.306) (-1121.715) [-1117.389] * (-1117.481) [-1120.371] (-1119.648) (-1121.159) -- 0:00:32 468500 -- (-1117.790) [-1119.127] (-1117.959) (-1119.075) * [-1121.312] (-1117.536) (-1117.680) (-1119.621) -- 0:00:32 469000 -- (-1118.697) (-1117.923) (-1117.759) [-1119.552] * (-1117.006) [-1117.964] (-1117.046) (-1120.240) -- 0:00:32 469500 -- (-1119.221) [-1117.245] (-1118.420) (-1119.128) * [-1118.320] (-1117.636) (-1117.201) (-1117.910) -- 0:00:32 470000 -- (-1118.191) (-1120.662) (-1117.707) [-1117.227] * (-1118.324) (-1120.500) (-1119.343) [-1118.350] -- 0:00:32 Average standard deviation of split frequencies: 0.012372 470500 -- [-1116.888] (-1119.603) (-1120.596) (-1117.105) * (-1118.790) (-1117.435) (-1118.348) [-1118.898] -- 0:00:32 471000 -- (-1117.697) (-1119.757) (-1118.508) [-1117.327] * [-1117.790] (-1117.090) (-1116.750) (-1122.147) -- 0:00:32 471500 -- (-1117.514) (-1116.952) (-1116.254) [-1119.229] * (-1118.666) (-1117.905) [-1118.582] (-1119.547) -- 0:00:32 472000 -- (-1120.327) (-1117.829) (-1119.146) [-1117.588] * (-1118.524) (-1117.916) [-1120.714] (-1116.673) -- 0:00:33 472500 -- [-1118.074] (-1118.926) (-1118.003) (-1119.188) * (-1118.153) (-1119.450) (-1117.929) [-1121.632] -- 0:00:33 473000 -- [-1119.181] (-1118.842) (-1116.761) (-1117.221) * (-1118.145) [-1117.811] (-1118.002) (-1120.923) -- 0:00:33 473500 -- (-1118.345) [-1118.657] (-1116.806) (-1120.059) * [-1117.168] (-1120.016) (-1118.384) (-1118.988) -- 0:00:33 474000 -- (-1117.448) [-1121.191] (-1118.922) (-1118.770) * (-1119.332) [-1117.607] (-1117.762) (-1122.486) -- 0:00:33 474500 -- (-1118.852) [-1121.228] (-1118.177) (-1118.770) * (-1121.695) [-1118.012] (-1118.701) (-1118.945) -- 0:00:33 475000 -- (-1118.198) (-1120.611) [-1118.124] (-1118.505) * (-1119.310) (-1118.469) [-1119.528] (-1118.724) -- 0:00:33 Average standard deviation of split frequencies: 0.012001 475500 -- [-1119.255] (-1118.095) (-1121.505) (-1118.848) * (-1116.453) [-1118.816] (-1117.478) (-1118.351) -- 0:00:33 476000 -- (-1118.048) (-1117.351) (-1118.825) [-1121.379] * (-1116.453) [-1117.933] (-1118.488) (-1120.034) -- 0:00:33 476500 -- (-1120.146) (-1117.379) [-1116.982] (-1121.573) * (-1118.465) (-1121.816) (-1119.307) [-1119.761] -- 0:00:32 477000 -- [-1120.585] (-1117.224) (-1117.433) (-1119.908) * (-1118.198) (-1116.286) [-1118.553] (-1117.447) -- 0:00:32 477500 -- [-1116.772] (-1118.161) (-1117.589) (-1117.333) * [-1120.221] (-1116.926) (-1120.987) (-1116.621) -- 0:00:32 478000 -- (-1117.160) (-1118.833) [-1121.350] (-1117.040) * (-1120.621) [-1117.260] (-1121.285) (-1118.119) -- 0:00:32 478500 -- (-1119.205) (-1120.799) (-1116.953) [-1117.849] * [-1116.795] (-1120.030) (-1118.787) (-1117.481) -- 0:00:32 479000 -- (-1118.426) [-1119.008] (-1118.868) (-1117.632) * (-1116.943) [-1118.467] (-1117.633) (-1119.195) -- 0:00:32 479500 -- (-1122.962) (-1118.433) (-1117.933) [-1120.385] * (-1116.748) (-1117.616) (-1117.979) [-1117.309] -- 0:00:32 480000 -- [-1120.922] (-1117.940) (-1119.190) (-1117.461) * [-1117.757] (-1118.279) (-1118.801) (-1120.483) -- 0:00:32 Average standard deviation of split frequencies: 0.012461 480500 -- (-1120.111) (-1118.716) (-1118.443) [-1118.041] * [-1120.488] (-1120.473) (-1119.273) (-1118.997) -- 0:00:32 481000 -- [-1117.630] (-1118.912) (-1117.311) (-1118.579) * (-1119.953) (-1119.670) [-1121.494] (-1119.841) -- 0:00:32 481500 -- (-1118.871) [-1116.391] (-1117.625) (-1123.515) * (-1117.959) (-1120.097) [-1119.408] (-1117.316) -- 0:00:32 482000 -- (-1116.326) [-1119.077] (-1117.418) (-1121.851) * (-1117.716) [-1117.491] (-1118.397) (-1117.022) -- 0:00:32 482500 -- (-1117.986) [-1116.987] (-1119.308) (-1120.323) * [-1117.210] (-1117.475) (-1117.612) (-1117.381) -- 0:00:32 483000 -- (-1117.280) (-1118.046) (-1119.238) [-1118.216] * (-1116.216) [-1117.083] (-1119.481) (-1122.488) -- 0:00:32 483500 -- (-1116.508) (-1120.413) (-1118.892) [-1117.606] * (-1118.851) (-1119.187) [-1118.945] (-1119.675) -- 0:00:32 484000 -- (-1116.600) (-1120.296) [-1116.463] (-1118.518) * (-1118.307) [-1117.703] (-1118.105) (-1117.544) -- 0:00:31 484500 -- (-1121.627) (-1119.459) [-1117.388] (-1121.563) * (-1118.848) [-1116.309] (-1117.159) (-1121.503) -- 0:00:31 485000 -- [-1118.318] (-1117.412) (-1118.731) (-1117.892) * (-1117.108) (-1117.574) [-1116.648] (-1121.199) -- 0:00:31 Average standard deviation of split frequencies: 0.011821 485500 -- (-1116.338) (-1116.837) (-1117.103) [-1118.714] * (-1122.434) (-1118.304) [-1118.261] (-1121.276) -- 0:00:31 486000 -- (-1117.475) (-1117.365) [-1119.086] (-1117.803) * (-1118.528) [-1116.678] (-1117.645) (-1120.688) -- 0:00:31 486500 -- (-1118.610) (-1117.100) (-1117.810) [-1123.035] * (-1117.026) (-1116.579) (-1123.250) [-1117.416] -- 0:00:31 487000 -- [-1117.348] (-1118.058) (-1123.418) (-1118.452) * (-1118.745) (-1121.242) (-1119.750) [-1118.094] -- 0:00:31 487500 -- [-1120.849] (-1118.099) (-1118.509) (-1119.415) * (-1117.038) (-1120.206) (-1123.658) [-1118.734] -- 0:00:31 488000 -- (-1117.152) (-1116.652) (-1118.383) [-1116.621] * [-1118.043] (-1121.002) (-1121.282) (-1117.384) -- 0:00:31 488500 -- (-1118.481) (-1119.685) [-1118.322] (-1118.616) * (-1118.369) (-1119.233) [-1118.069] (-1117.679) -- 0:00:32 489000 -- (-1121.912) (-1120.176) (-1117.734) [-1118.911] * (-1119.275) (-1117.440) (-1122.604) [-1117.776] -- 0:00:32 489500 -- (-1118.070) (-1118.264) [-1119.015] (-1117.043) * (-1116.905) (-1124.741) [-1119.034] (-1117.896) -- 0:00:32 490000 -- [-1119.279] (-1120.232) (-1117.994) (-1118.171) * (-1118.301) [-1117.698] (-1120.485) (-1118.579) -- 0:00:32 Average standard deviation of split frequencies: 0.012998 490500 -- (-1117.833) [-1120.141] (-1124.292) (-1118.388) * (-1119.849) [-1121.645] (-1117.830) (-1116.696) -- 0:00:32 491000 -- (-1118.169) [-1121.739] (-1118.171) (-1118.421) * (-1117.167) [-1121.149] (-1120.114) (-1116.976) -- 0:00:32 491500 -- [-1117.204] (-1119.321) (-1116.483) (-1119.302) * (-1116.809) [-1120.424] (-1116.407) (-1121.216) -- 0:00:32 492000 -- (-1119.081) (-1119.902) (-1121.430) [-1118.779] * (-1124.722) (-1120.769) (-1118.665) [-1121.603] -- 0:00:32 492500 -- (-1116.917) (-1118.381) (-1118.268) [-1116.770] * (-1118.777) (-1117.326) (-1116.426) [-1118.040] -- 0:00:31 493000 -- (-1118.457) [-1121.518] (-1118.057) (-1116.898) * (-1117.957) (-1118.112) (-1118.279) [-1116.477] -- 0:00:31 493500 -- (-1118.186) [-1121.124] (-1117.156) (-1116.833) * (-1117.572) [-1119.778] (-1121.388) (-1119.765) -- 0:00:31 494000 -- (-1119.042) [-1117.471] (-1117.951) (-1116.654) * [-1118.479] (-1122.288) (-1117.542) (-1120.370) -- 0:00:31 494500 -- (-1118.670) (-1117.126) (-1118.729) [-1118.849] * (-1119.389) [-1118.247] (-1117.481) (-1121.084) -- 0:00:31 495000 -- (-1119.246) (-1117.226) [-1116.774] (-1122.261) * (-1118.499) (-1117.640) (-1118.151) [-1118.487] -- 0:00:31 Average standard deviation of split frequencies: 0.013082 495500 -- (-1121.377) [-1117.356] (-1122.814) (-1119.518) * (-1117.322) [-1118.605] (-1119.423) (-1121.387) -- 0:00:31 496000 -- (-1121.186) (-1118.107) [-1121.237] (-1118.195) * (-1116.962) (-1118.421) (-1117.348) [-1120.613] -- 0:00:31 496500 -- (-1117.664) (-1118.002) [-1121.300] (-1118.536) * (-1117.413) [-1119.352] (-1117.832) (-1118.642) -- 0:00:31 497000 -- (-1119.876) (-1119.928) (-1119.869) [-1117.146] * (-1117.332) (-1119.141) (-1118.814) [-1119.002] -- 0:00:31 497500 -- (-1119.376) (-1117.570) (-1120.108) [-1119.287] * (-1121.030) [-1119.966] (-1118.260) (-1120.329) -- 0:00:31 498000 -- (-1119.326) (-1120.089) (-1118.199) [-1119.361] * [-1116.859] (-1117.510) (-1119.083) (-1118.857) -- 0:00:31 498500 -- (-1118.129) [-1120.439] (-1128.247) (-1117.964) * (-1118.754) (-1116.672) (-1116.783) [-1117.204] -- 0:00:31 499000 -- (-1122.526) [-1118.154] (-1122.196) (-1116.924) * [-1117.890] (-1117.115) (-1122.997) (-1117.609) -- 0:00:31 499500 -- (-1118.199) (-1118.549) (-1121.523) [-1116.518] * (-1117.392) [-1116.798] (-1121.215) (-1118.888) -- 0:00:31 500000 -- [-1121.350] (-1123.322) (-1118.676) (-1120.044) * (-1116.810) (-1117.372) (-1117.670) [-1117.627] -- 0:00:31 Average standard deviation of split frequencies: 0.012406 500500 -- [-1117.567] (-1119.217) (-1119.258) (-1121.829) * (-1116.982) (-1117.574) (-1120.168) [-1117.032] -- 0:00:30 501000 -- (-1118.904) (-1117.361) (-1118.920) [-1118.129] * (-1118.438) [-1119.038] (-1118.650) (-1118.457) -- 0:00:30 501500 -- [-1116.598] (-1117.764) (-1119.355) (-1117.073) * (-1118.986) [-1118.342] (-1117.652) (-1123.280) -- 0:00:30 502000 -- (-1116.154) (-1117.439) [-1120.884] (-1117.223) * [-1116.788] (-1119.466) (-1119.866) (-1118.720) -- 0:00:30 502500 -- (-1117.821) (-1117.439) [-1116.743] (-1117.169) * (-1119.215) (-1117.510) [-1121.591] (-1118.540) -- 0:00:30 503000 -- (-1117.563) (-1118.223) (-1118.389) [-1117.505] * (-1122.523) [-1117.695] (-1121.211) (-1118.766) -- 0:00:30 503500 -- (-1120.517) (-1118.046) (-1118.279) [-1117.695] * (-1119.406) (-1118.387) (-1118.955) [-1119.118] -- 0:00:30 504000 -- (-1120.057) (-1117.632) (-1116.785) [-1118.633] * (-1120.701) (-1119.828) [-1122.152] (-1126.034) -- 0:00:30 504500 -- (-1119.116) (-1117.211) [-1119.728] (-1119.916) * (-1117.395) (-1118.488) (-1119.802) [-1120.506] -- 0:00:31 505000 -- (-1120.891) (-1116.667) [-1120.624] (-1117.126) * (-1116.791) (-1118.632) (-1121.383) [-1117.434] -- 0:00:31 Average standard deviation of split frequencies: 0.011399 505500 -- (-1120.469) (-1123.737) [-1121.956] (-1117.988) * [-1121.214] (-1119.781) (-1119.845) (-1120.959) -- 0:00:31 506000 -- (-1117.913) [-1123.666] (-1122.476) (-1120.631) * (-1119.611) (-1120.641) (-1120.957) [-1118.034] -- 0:00:31 506500 -- (-1118.669) [-1119.983] (-1121.270) (-1117.960) * (-1119.413) [-1117.859] (-1117.368) (-1117.686) -- 0:00:31 507000 -- (-1119.314) (-1120.800) (-1118.487) [-1117.524] * (-1118.359) (-1120.705) (-1117.199) [-1117.705] -- 0:00:31 507500 -- (-1120.134) (-1120.643) (-1120.166) [-1118.828] * (-1117.183) (-1120.245) [-1118.382] (-1119.927) -- 0:00:31 508000 -- (-1116.584) [-1124.078] (-1120.372) (-1119.432) * (-1116.632) (-1120.850) [-1116.829] (-1116.328) -- 0:00:30 508500 -- [-1118.833] (-1117.620) (-1119.690) (-1120.129) * (-1119.756) (-1117.025) (-1118.324) [-1116.672] -- 0:00:30 509000 -- (-1118.758) [-1118.949] (-1120.031) (-1118.773) * [-1120.323] (-1116.925) (-1117.347) (-1117.400) -- 0:00:30 509500 -- (-1117.099) (-1119.322) [-1118.736] (-1119.361) * (-1119.567) [-1116.254] (-1121.639) (-1119.372) -- 0:00:30 510000 -- (-1121.391) (-1119.347) [-1119.496] (-1118.261) * (-1118.665) (-1116.158) [-1118.087] (-1122.515) -- 0:00:30 Average standard deviation of split frequencies: 0.011349 510500 -- (-1118.132) (-1118.228) [-1118.742] (-1122.187) * (-1120.838) (-1117.997) (-1120.747) [-1120.617] -- 0:00:30 511000 -- [-1116.953] (-1117.694) (-1118.195) (-1123.368) * [-1118.167] (-1119.582) (-1119.242) (-1118.926) -- 0:00:30 511500 -- (-1116.570) (-1119.519) (-1116.671) [-1123.795] * (-1121.626) (-1118.318) (-1119.637) [-1116.419] -- 0:00:30 512000 -- (-1116.477) (-1116.640) (-1116.833) [-1124.781] * (-1121.024) (-1117.884) (-1119.779) [-1117.276] -- 0:00:30 512500 -- (-1117.462) (-1118.343) [-1118.672] (-1119.456) * (-1118.887) (-1118.186) [-1117.302] (-1116.987) -- 0:00:30 513000 -- (-1119.445) (-1119.966) [-1118.220] (-1119.852) * (-1118.937) (-1117.562) (-1119.670) [-1116.566] -- 0:00:30 513500 -- [-1118.205] (-1118.302) (-1118.806) (-1119.645) * (-1117.591) [-1117.496] (-1118.798) (-1116.602) -- 0:00:30 514000 -- (-1118.666) (-1119.875) [-1118.798] (-1118.648) * [-1118.890] (-1117.601) (-1120.691) (-1122.563) -- 0:00:30 514500 -- (-1118.845) (-1122.702) (-1116.941) [-1118.427] * (-1117.811) (-1119.250) (-1122.057) [-1120.886] -- 0:00:30 515000 -- (-1118.521) (-1120.347) [-1118.322] (-1119.247) * [-1117.474] (-1118.511) (-1121.204) (-1117.161) -- 0:00:30 Average standard deviation of split frequencies: 0.010748 515500 -- (-1117.451) [-1119.745] (-1117.411) (-1120.652) * (-1117.718) (-1117.346) (-1117.339) [-1116.651] -- 0:00:30 516000 -- (-1118.494) (-1117.681) (-1117.359) [-1119.361] * (-1116.458) [-1117.519] (-1119.087) (-1117.466) -- 0:00:30 516500 -- (-1118.005) (-1116.701) [-1118.206] (-1117.497) * (-1119.553) (-1119.697) [-1119.341] (-1117.548) -- 0:00:29 517000 -- (-1117.803) (-1118.243) (-1119.303) [-1117.172] * [-1118.487] (-1119.024) (-1121.967) (-1117.359) -- 0:00:29 517500 -- (-1117.977) (-1116.973) (-1118.058) [-1117.178] * (-1117.167) (-1124.095) [-1120.255] (-1117.733) -- 0:00:29 518000 -- (-1119.064) [-1117.326] (-1117.693) (-1117.014) * (-1118.510) (-1121.196) (-1117.731) [-1116.711] -- 0:00:29 518500 -- (-1119.845) [-1117.062] (-1119.386) (-1117.226) * [-1119.125] (-1121.131) (-1122.804) (-1122.261) -- 0:00:29 519000 -- [-1117.805] (-1116.988) (-1123.518) (-1116.834) * (-1118.217) (-1119.140) [-1118.272] (-1117.979) -- 0:00:29 519500 -- [-1119.059] (-1119.500) (-1122.710) (-1123.443) * (-1117.524) [-1118.171] (-1116.756) (-1119.219) -- 0:00:29 520000 -- (-1117.812) (-1117.691) (-1127.023) [-1117.229] * (-1116.435) (-1117.570) [-1117.796] (-1117.875) -- 0:00:29 Average standard deviation of split frequencies: 0.011291 520500 -- (-1118.265) [-1118.811] (-1119.151) (-1119.394) * (-1118.614) [-1117.640] (-1119.711) (-1116.180) -- 0:00:29 521000 -- (-1121.439) [-1118.211] (-1119.374) (-1122.275) * (-1119.005) (-1118.051) (-1122.924) [-1117.276] -- 0:00:30 521500 -- [-1117.280] (-1118.270) (-1117.561) (-1117.777) * [-1118.780] (-1117.766) (-1121.662) (-1117.218) -- 0:00:30 522000 -- [-1121.156] (-1119.459) (-1118.352) (-1116.790) * (-1119.717) (-1120.654) [-1122.702] (-1116.613) -- 0:00:30 522500 -- [-1119.086] (-1117.745) (-1124.313) (-1117.827) * (-1117.573) (-1117.169) [-1117.604] (-1117.021) -- 0:00:30 523000 -- (-1119.133) [-1117.121] (-1117.389) (-1118.614) * [-1116.795] (-1116.703) (-1118.848) (-1119.627) -- 0:00:30 523500 -- (-1121.979) (-1122.679) [-1117.202] (-1117.691) * (-1117.865) (-1117.106) (-1119.611) [-1118.200] -- 0:00:30 524000 -- (-1119.431) [-1117.806] (-1120.438) (-1117.620) * (-1117.678) (-1116.926) (-1121.811) [-1117.858] -- 0:00:29 524500 -- (-1117.197) [-1116.715] (-1119.664) (-1119.383) * (-1124.141) [-1118.063] (-1120.938) (-1119.590) -- 0:00:29 525000 -- (-1117.813) (-1117.755) [-1117.342] (-1118.807) * (-1119.486) [-1117.127] (-1120.673) (-1118.747) -- 0:00:29 Average standard deviation of split frequencies: 0.010807 525500 -- (-1119.615) (-1118.099) [-1117.163] (-1118.374) * (-1117.642) (-1118.014) (-1120.596) [-1118.880] -- 0:00:29 526000 -- (-1116.915) [-1119.228] (-1116.734) (-1120.375) * [-1116.763] (-1118.133) (-1120.704) (-1118.049) -- 0:00:29 526500 -- (-1117.410) (-1118.272) [-1116.409] (-1116.737) * (-1117.264) (-1119.523) (-1117.348) [-1120.690] -- 0:00:29 527000 -- [-1116.291] (-1116.484) (-1116.884) (-1121.345) * (-1117.093) (-1122.879) (-1126.268) [-1117.754] -- 0:00:29 527500 -- [-1117.538] (-1117.974) (-1116.381) (-1117.104) * (-1116.940) [-1117.728] (-1127.040) (-1118.235) -- 0:00:29 528000 -- (-1118.498) (-1118.951) [-1117.493] (-1120.870) * (-1118.987) (-1120.587) (-1121.391) [-1118.235] -- 0:00:29 528500 -- (-1119.385) (-1120.822) (-1118.519) [-1120.712] * (-1122.290) (-1122.092) [-1117.509] (-1118.475) -- 0:00:29 529000 -- (-1120.766) (-1120.074) [-1118.266] (-1120.297) * (-1118.120) [-1116.268] (-1120.989) (-1123.117) -- 0:00:29 529500 -- (-1117.617) (-1120.975) [-1120.802] (-1124.501) * [-1122.641] (-1118.083) (-1120.054) (-1119.510) -- 0:00:29 530000 -- (-1116.951) (-1119.035) [-1119.053] (-1118.467) * (-1119.633) [-1117.208] (-1119.562) (-1119.764) -- 0:00:29 Average standard deviation of split frequencies: 0.010712 530500 -- (-1120.199) (-1119.299) [-1117.733] (-1116.523) * (-1118.471) [-1118.602] (-1118.031) (-1118.127) -- 0:00:29 531000 -- (-1121.038) (-1117.909) (-1118.760) [-1116.585] * (-1120.851) (-1119.250) (-1117.271) [-1117.041] -- 0:00:29 531500 -- (-1122.050) (-1117.518) (-1118.938) [-1116.798] * (-1117.426) (-1119.531) (-1117.520) [-1122.433] -- 0:00:29 532000 -- (-1117.405) (-1121.897) [-1118.958] (-1117.905) * (-1117.867) [-1117.245] (-1118.010) (-1119.228) -- 0:00:29 532500 -- (-1121.698) [-1118.096] (-1118.107) (-1122.099) * [-1116.941] (-1121.936) (-1118.120) (-1122.773) -- 0:00:28 533000 -- (-1125.909) (-1119.360) [-1117.654] (-1121.383) * [-1117.234] (-1119.508) (-1117.922) (-1120.469) -- 0:00:28 533500 -- (-1117.846) (-1129.889) (-1117.739) [-1120.879] * (-1117.892) [-1117.503] (-1119.820) (-1119.184) -- 0:00:28 534000 -- (-1119.005) (-1123.156) (-1118.288) [-1120.808] * (-1118.352) [-1118.266] (-1119.098) (-1119.040) -- 0:00:28 534500 -- (-1120.597) [-1118.341] (-1119.059) (-1119.315) * (-1117.426) [-1117.775] (-1117.725) (-1117.860) -- 0:00:28 535000 -- (-1120.237) (-1118.701) (-1119.323) [-1117.778] * (-1118.294) [-1117.948] (-1116.780) (-1118.984) -- 0:00:28 Average standard deviation of split frequencies: 0.010036 535500 -- [-1117.749] (-1119.001) (-1123.171) (-1117.952) * (-1117.828) [-1118.699] (-1121.105) (-1119.203) -- 0:00:28 536000 -- (-1116.945) (-1118.348) (-1120.340) [-1116.082] * [-1118.865] (-1117.473) (-1119.945) (-1118.503) -- 0:00:28 536500 -- (-1116.455) (-1116.603) [-1119.260] (-1119.068) * (-1118.397) [-1118.053] (-1117.538) (-1117.426) -- 0:00:28 537000 -- (-1118.727) (-1117.279) (-1117.158) [-1119.155] * (-1116.746) [-1118.147] (-1117.355) (-1118.033) -- 0:00:29 537500 -- (-1118.521) (-1118.501) (-1117.394) [-1120.467] * (-1117.111) (-1118.084) [-1116.791] (-1116.700) -- 0:00:29 538000 -- (-1120.062) [-1117.605] (-1118.110) (-1119.075) * [-1116.801] (-1116.674) (-1117.224) (-1117.627) -- 0:00:29 538500 -- (-1120.624) (-1118.407) (-1119.069) [-1117.771] * [-1119.599] (-1126.264) (-1116.262) (-1120.144) -- 0:00:29 539000 -- (-1121.100) (-1119.987) (-1117.486) [-1118.535] * [-1117.351] (-1121.397) (-1116.813) (-1117.990) -- 0:00:29 539500 -- (-1120.453) [-1119.080] (-1116.733) (-1118.282) * (-1120.089) (-1119.653) (-1118.246) [-1119.550] -- 0:00:29 540000 -- (-1117.306) [-1117.247] (-1117.219) (-1120.065) * [-1120.907] (-1116.952) (-1117.186) (-1119.162) -- 0:00:28 Average standard deviation of split frequencies: 0.010001 540500 -- (-1117.490) (-1118.309) [-1117.286] (-1120.708) * [-1117.661] (-1116.596) (-1118.070) (-1116.634) -- 0:00:28 541000 -- (-1119.750) (-1118.759) [-1119.393] (-1119.472) * (-1117.340) [-1118.222] (-1118.569) (-1117.578) -- 0:00:28 541500 -- (-1116.958) [-1118.291] (-1118.081) (-1116.785) * (-1116.484) (-1117.777) [-1121.462] (-1116.437) -- 0:00:28 542000 -- (-1122.071) (-1118.543) [-1118.027] (-1117.826) * [-1116.319] (-1122.321) (-1119.707) (-1119.246) -- 0:00:28 542500 -- (-1119.067) (-1118.922) (-1123.991) [-1117.087] * [-1116.495] (-1119.132) (-1120.029) (-1117.867) -- 0:00:28 543000 -- (-1116.790) (-1118.062) (-1118.228) [-1116.993] * (-1118.846) (-1118.823) [-1118.224] (-1118.149) -- 0:00:28 543500 -- (-1116.387) [-