--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:59:29 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2654/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -692.34          -697.87
2       -692.33          -696.53
--------------------------------------
TOTAL     -692.34          -697.41
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.863616    0.087519    0.373989    1.484248    0.841070   1380.37   1440.68    1.000
r(A<->C){all}   0.168400    0.018747    0.000045    0.435323    0.134791    303.57    331.43    1.000
r(A<->G){all}   0.169294    0.021530    0.000120    0.470548    0.126976    183.29    218.93    1.004
r(A<->T){all}   0.133047    0.015185    0.000074    0.382133    0.096839    167.02    225.97    1.008
r(C<->G){all}   0.181319    0.021406    0.000072    0.471646    0.145929    214.86    225.31    1.011
r(C<->T){all}   0.130328    0.013976    0.000021    0.367920    0.097093    247.87    261.01    1.000
r(G<->T){all}   0.217613    0.024577    0.000426    0.529423    0.182453    164.21    201.79    1.004
pi(A){all}      0.235690    0.000352    0.201253    0.273276    0.235708   1010.30   1237.51    1.000
pi(C){all}      0.284092    0.000412    0.245927    0.325404    0.283466   1268.80   1341.40    1.000
pi(G){all}      0.290608    0.000399    0.250500    0.328380    0.290697   1057.12   1279.06    1.000
pi(T){all}      0.189610    0.000313    0.152821    0.221852    0.189100   1274.04   1353.65    1.000
alpha{1,2}      0.233803    0.057797    0.003509    0.628750    0.169601   1267.42   1384.21    1.000
alpha{3}        0.391240    0.209067    0.000150    1.351097    0.219084   1152.88   1260.69    1.000
pinvar{all}     0.992443    0.000039    0.981274    0.999766    0.993970   1442.90   1459.93    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-669.907009
Model 2: PositiveSelection	-669.669216
Model 0: one-ratio	-669.669203
Model 7: beta	-669.90701
Model 8: beta&w>1	-669.669216


Model 0 vs 1	0.4756119999999555

Model 2 vs 1	0.47558600000002116

Model 8 vs 7	0.4755880000000161
>C1
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C2
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C3
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C4
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C5
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C6
MMLRLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=165 

C1              MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C2              MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C3              MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C4              MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C5              MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C6              MMLRLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
                *** **********************************************

C1              AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C2              AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C3              AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C4              AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C5              AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C6              AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
                **************************************************

C1              QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C2              QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C3              QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C4              QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C5              QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C6              QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
                **************************************************

C1              DNGALTDVVVHPLEK
C2              DNGALTDVVVHPLEK
C3              DNGALTDVVVHPLEK
C4              DNGALTDVVVHPLEK
C5              DNGALTDVVVHPLEK
C6              DNGALTDVVVHPLEK
                ***************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  165 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  165 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4950]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [4950]--->[4950]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.466 Mb, Max= 30.697 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C2              MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C3              MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C4              MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C5              MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C6              MMLRLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
                *** **********************************************

C1              AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C2              AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C3              AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C4              AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C5              AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C6              AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
                **************************************************

C1              QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C2              QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C3              QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C4              QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C5              QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C6              QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
                **************************************************

C1              DNGALTDVVVHPLEK
C2              DNGALTDVVVHPLEK
C3              DNGALTDVVVHPLEK
C4              DNGALTDVVVHPLEK
C5              DNGALTDVVVHPLEK
C6              DNGALTDVVVHPLEK
                ***************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 99.39 C1	 C6	 99.39
TOP	    5    0	 99.39 C6	 C1	 99.39
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.39 C2	 C6	 99.39
TOP	    5    1	 99.39 C6	 C2	 99.39
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 99.39 C3	 C6	 99.39
TOP	    5    2	 99.39 C6	 C3	 99.39
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 99.39 C4	 C6	 99.39
TOP	    5    3	 99.39 C6	 C4	 99.39
BOT	    4    5	 99.39 C5	 C6	 99.39
TOP	    5    4	 99.39 C6	 C5	 99.39
AVG	 0	 C1	  *	 99.88
AVG	 1	 C2	  *	 99.88
AVG	 2	 C3	  *	 99.88
AVG	 3	 C4	  *	 99.88
AVG	 4	 C5	  *	 99.88
AVG	 5	 C6	  *	 99.39
TOT	 TOT	  *	 99.80
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
C2              ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
C3              ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
C4              ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
C5              ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
C6              ATGATGCTACGGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
                ********** ***************************************

C1              CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
C2              CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
C3              CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
C4              CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
C5              CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
C6              CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
                **************************************************

C1              ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
C2              ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
C3              ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
C4              ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
C5              ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
C6              ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
                **************************************************

C1              GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
C2              GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
C3              GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
C4              GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
C5              GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
C6              GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
                **************************************************

C1              GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
C2              GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
C3              GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
C4              GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
C5              GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
C6              GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
                **************************************************

C1              CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
C2              CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
C3              CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
C4              CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
C5              CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
C6              CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
                **************************************************

C1              CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
C2              CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
C3              CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
C4              CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
C5              CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
C6              CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
                **************************************************

C1              ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
C2              ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
C3              ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
C4              ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
C5              ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
C6              ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
                **************************************************

C1              CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
C2              CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
C3              CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
C4              CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
C5              CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
C6              CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
                **************************************************

C1              GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
C2              GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
C3              GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
C4              GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
C5              GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
C6              GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
                *********************************************



>C1
ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
>C2
ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
>C3
ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
>C4
ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
>C5
ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
>C6
ATGATGCTACGGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
>C1
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C2
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C3
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C4
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C5
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C6
MMLRLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 495 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859880
      Setting output file names to "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1950597824
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5163787124
      Seed = 81099158
      Swapseed = 1579859880
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1111.236595 -- -24.965149
         Chain 2 -- -1111.236360 -- -24.965149
         Chain 3 -- -1111.235045 -- -24.965149
         Chain 4 -- -1111.236532 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1111.235045 -- -24.965149
         Chain 2 -- -1111.236595 -- -24.965149
         Chain 3 -- -1111.236595 -- -24.965149
         Chain 4 -- -1111.236532 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1111.237] (-1111.236) (-1111.235) (-1111.237) * [-1111.235] (-1111.237) (-1111.237) (-1111.237) 
        500 -- (-705.404) [-696.524] (-699.232) (-693.710) * (-702.177) (-698.520) [-696.643] (-698.853) -- 0:00:00
       1000 -- [-693.645] (-699.505) (-697.829) (-692.375) * (-696.355) (-703.169) (-704.067) [-700.247] -- 0:00:00
       1500 -- (-697.214) (-695.114) (-696.812) [-702.668] * (-699.629) (-702.294) (-706.886) [-699.025] -- 0:00:00
       2000 -- [-694.788] (-708.973) (-701.493) (-698.706) * [-696.091] (-696.002) (-697.352) (-698.226) -- 0:00:00
       2500 -- (-701.048) (-697.179) (-695.594) [-694.775] * [-695.434] (-694.660) (-696.986) (-704.534) -- 0:00:00
       3000 -- [-697.132] (-694.664) (-700.877) (-700.820) * (-697.726) (-697.586) [-695.580] (-694.986) -- 0:00:00
       3500 -- (-699.949) (-702.107) [-695.561] (-696.493) * [-698.083] (-700.995) (-700.826) (-696.891) -- 0:00:00
       4000 -- (-696.664) (-697.941) [-697.711] (-696.692) * (-695.048) [-702.675] (-695.506) (-697.711) -- 0:00:00
       4500 -- (-703.008) (-700.692) [-693.556] (-695.417) * [-698.440] (-697.484) (-698.227) (-696.982) -- 0:00:00
       5000 -- (-703.173) (-702.338) [-703.125] (-699.354) * (-697.078) [-694.694] (-698.212) (-697.087) -- 0:00:00

      Average standard deviation of split frequencies: 0.094281

       5500 -- [-690.499] (-705.697) (-696.714) (-700.020) * (-696.970) (-697.091) [-704.660] (-696.158) -- 0:00:00
       6000 -- (-703.371) (-698.649) [-690.742] (-696.605) * (-691.883) (-696.444) [-699.713] (-698.817) -- 0:00:00
       6500 -- (-702.349) [-698.321] (-699.491) (-700.835) * [-701.929] (-699.878) (-695.204) (-698.543) -- 0:00:00
       7000 -- (-700.710) (-697.955) [-691.286] (-698.768) * (-707.086) (-698.653) (-700.517) [-697.504] -- 0:02:21
       7500 -- (-703.532) (-700.288) [-699.988] (-717.811) * (-703.105) [-693.097] (-696.799) (-698.076) -- 0:02:12
       8000 -- [-693.822] (-700.654) (-702.808) (-701.943) * [-692.358] (-700.402) (-704.637) (-700.299) -- 0:02:04
       8500 -- (-702.469) (-701.780) (-697.594) [-695.753] * (-701.965) (-700.101) [-695.256] (-697.182) -- 0:01:56
       9000 -- (-697.552) (-718.175) [-696.037] (-701.276) * [-698.386] (-699.659) (-703.573) (-701.291) -- 0:01:50
       9500 -- [-695.239] (-694.538) (-697.202) (-694.837) * (-701.786) [-699.151] (-697.551) (-702.833) -- 0:01:44
      10000 -- [-694.427] (-700.186) (-693.993) (-700.102) * (-695.586) [-696.288] (-692.779) (-699.279) -- 0:01:39

      Average standard deviation of split frequencies: 0.090493

      10500 -- [-702.997] (-701.312) (-696.169) (-707.089) * [-702.708] (-702.587) (-692.291) (-703.872) -- 0:01:34
      11000 -- (-697.096) (-694.230) [-694.223] (-706.063) * (-706.351) [-696.136] (-695.258) (-707.442) -- 0:01:29
      11500 -- (-698.196) (-692.851) [-710.151] (-700.620) * (-705.677) [-698.937] (-691.995) (-701.405) -- 0:01:25
      12000 -- (-700.169) (-696.776) (-710.954) [-705.000] * [-699.108] (-700.908) (-697.337) (-699.217) -- 0:01:22
      12500 -- (-696.717) (-694.872) (-713.835) [-700.580] * [-698.075] (-699.526) (-694.837) (-701.409) -- 0:01:19
      13000 -- (-704.162) [-694.277] (-691.047) (-694.575) * [-694.972] (-698.465) (-694.827) (-695.989) -- 0:01:15
      13500 -- (-706.341) (-695.971) (-692.219) [-694.735] * (-700.917) (-693.692) [-692.671] (-699.097) -- 0:01:13
      14000 -- (-701.794) (-694.434) (-692.151) [-698.427] * (-700.042) (-702.355) [-693.672] (-698.700) -- 0:01:10
      14500 -- (-700.104) (-694.877) (-690.926) [-695.326] * (-710.970) (-693.326) (-695.877) [-694.404] -- 0:01:07
      15000 -- [-691.796] (-698.518) (-691.075) (-697.781) * (-707.108) (-701.720) (-692.562) [-699.709] -- 0:01:05

      Average standard deviation of split frequencies: 0.078076

      15500 -- [-702.940] (-694.047) (-690.030) (-694.285) * (-703.317) (-703.301) (-692.569) [-696.337] -- 0:01:03
      16000 -- (-697.880) (-696.815) (-692.769) [-706.844] * (-703.969) [-698.630] (-691.784) (-701.619) -- 0:01:01
      16500 -- (-693.471) (-695.630) (-692.635) [-697.166] * (-693.788) [-695.025] (-691.089) (-712.051) -- 0:00:59
      17000 -- (-699.141) (-695.336) (-693.497) [-694.910] * (-699.351) [-697.058] (-692.502) (-695.409) -- 0:00:57
      17500 -- (-695.653) (-691.093) (-692.684) [-693.078] * (-706.038) (-697.894) (-693.140) [-698.941] -- 0:00:56
      18000 -- (-703.899) (-693.435) [-690.408] (-692.765) * (-701.962) [-697.887] (-692.066) (-694.625) -- 0:00:54
      18500 -- (-706.034) (-694.714) [-692.381] (-693.450) * (-702.179) (-701.044) [-692.672] (-695.023) -- 0:00:53
      19000 -- (-719.675) (-692.529) [-692.980] (-696.279) * (-703.717) [-697.399] (-694.334) (-691.880) -- 0:01:43
      19500 -- (-692.367) (-691.621) (-702.123) [-699.523] * (-695.932) (-700.483) (-692.024) [-693.452] -- 0:01:40
      20000 -- (-690.863) (-694.620) [-691.483] (-703.621) * (-699.405) [-695.211] (-694.201) (-693.060) -- 0:01:38

      Average standard deviation of split frequencies: 0.067162

      20500 -- (-690.830) [-694.783] (-697.757) (-702.995) * (-694.540) [-697.679] (-693.693) (-691.755) -- 0:01:35
      21000 -- (-691.623) (-694.987) [-689.311] (-699.182) * (-694.522) (-694.609) (-693.595) [-692.237] -- 0:01:33
      21500 -- (-692.591) (-694.025) (-690.051) [-691.761] * [-691.067] (-699.258) (-697.145) (-693.417) -- 0:01:31
      22000 -- (-691.894) (-692.924) [-692.174] (-692.547) * (-695.267) (-708.410) (-692.329) [-691.359] -- 0:01:28
      22500 -- [-690.442] (-693.224) (-694.612) (-696.636) * (-692.099) (-698.241) (-694.446) [-694.124] -- 0:01:26
      23000 -- (-691.052) (-695.269) [-692.411] (-693.984) * (-695.924) (-700.270) [-691.175] (-693.640) -- 0:01:24
      23500 -- [-690.609] (-694.163) (-691.705) (-697.022) * (-699.686) (-699.234) [-692.106] (-694.205) -- 0:01:23
      24000 -- (-690.180) [-693.390] (-696.511) (-694.088) * [-693.143] (-698.968) (-692.545) (-694.911) -- 0:01:21
      24500 -- [-692.096] (-695.109) (-693.411) (-692.067) * (-693.446) [-696.267] (-691.825) (-694.081) -- 0:01:19
      25000 -- [-691.761] (-695.415) (-691.337) (-692.009) * (-694.101) (-701.888) [-696.023] (-692.960) -- 0:01:18

      Average standard deviation of split frequencies: 0.047486

      25500 -- (-693.573) (-694.050) (-695.421) [-694.879] * (-691.854) [-701.940] (-691.994) (-694.010) -- 0:01:16
      26000 -- (-696.261) (-696.033) [-692.458] (-693.651) * [-692.766] (-696.785) (-697.521) (-694.319) -- 0:01:14
      26500 -- (-693.376) [-693.407] (-694.701) (-694.361) * [-692.652] (-698.123) (-694.395) (-693.528) -- 0:01:13
      27000 -- (-694.620) (-692.913) (-692.737) [-695.734] * [-691.794] (-695.682) (-694.304) (-693.452) -- 0:01:12
      27500 -- (-696.344) [-696.910] (-698.674) (-693.908) * (-694.878) (-698.089) [-693.445] (-690.339) -- 0:01:10
      28000 -- (-693.261) (-693.850) (-692.755) [-690.804] * (-695.269) [-693.687] (-692.542) (-692.831) -- 0:01:09
      28500 -- (-695.236) [-692.997] (-692.448) (-699.108) * [-691.022] (-696.745) (-690.851) (-694.240) -- 0:01:08
      29000 -- (-691.021) (-693.458) [-696.651] (-695.040) * [-691.837] (-694.036) (-694.669) (-694.414) -- 0:01:06
      29500 -- [-692.393] (-696.154) (-695.002) (-694.364) * [-693.644] (-696.911) (-693.394) (-694.576) -- 0:01:05
      30000 -- (-694.059) (-695.566) [-692.547] (-697.238) * (-693.860) (-693.574) [-692.774] (-692.109) -- 0:01:04

      Average standard deviation of split frequencies: 0.046116

      30500 -- [-695.668] (-693.166) (-693.547) (-694.982) * (-694.566) (-696.045) (-694.911) [-694.646] -- 0:01:03
      31000 -- [-695.094] (-696.541) (-690.336) (-693.194) * (-695.779) (-692.404) [-692.250] (-700.152) -- 0:01:02
      31500 -- (-692.262) (-696.486) (-691.129) [-690.565] * (-692.604) [-693.661] (-694.896) (-696.138) -- 0:01:01
      32000 -- (-695.133) [-695.079] (-692.501) (-692.829) * (-693.940) (-694.413) (-694.173) [-694.579] -- 0:01:30
      32500 -- (-695.020) [-692.019] (-692.581) (-691.663) * (-694.215) (-694.869) [-691.684] (-692.313) -- 0:01:29
      33000 -- (-694.332) (-695.424) (-691.220) [-692.464] * (-696.107) [-694.422] (-696.481) (-693.172) -- 0:01:27
      33500 -- (-694.665) (-693.786) (-694.129) [-693.924] * (-696.000) (-694.059) (-692.207) [-690.443] -- 0:01:26
      34000 -- [-693.854] (-701.080) (-693.239) (-692.607) * [-691.201] (-695.215) (-691.298) (-692.965) -- 0:01:25
      34500 -- (-692.374) (-694.638) [-695.093] (-693.645) * (-695.609) [-696.607] (-697.949) (-696.130) -- 0:01:23
      35000 -- (-692.491) [-694.243] (-697.164) (-691.014) * [-695.962] (-696.373) (-698.629) (-693.890) -- 0:01:22

      Average standard deviation of split frequencies: 0.049468

      35500 -- (-692.337) [-693.165] (-694.987) (-691.758) * (-692.841) (-692.858) (-697.370) [-696.185] -- 0:01:21
      36000 -- (-696.486) (-693.981) [-691.415] (-695.679) * (-691.644) (-694.693) (-696.842) [-692.951] -- 0:01:20
      36500 -- (-693.727) [-695.114] (-690.971) (-693.743) * (-693.297) (-698.157) (-691.615) [-693.929] -- 0:01:19
      37000 -- [-694.483] (-693.132) (-694.204) (-694.564) * (-694.867) [-699.608] (-692.184) (-695.561) -- 0:01:18
      37500 -- (-692.737) (-695.021) [-693.345] (-694.247) * (-696.197) (-695.662) (-692.628) [-696.578] -- 0:01:17
      38000 -- [-693.906] (-694.334) (-693.466) (-693.863) * (-694.972) [-698.452] (-690.472) (-697.936) -- 0:01:15
      38500 -- [-692.935] (-695.068) (-693.116) (-695.360) * (-695.727) (-698.829) [-692.413] (-694.895) -- 0:01:14
      39000 -- (-694.634) [-692.715] (-694.182) (-692.405) * (-693.428) (-696.475) (-694.352) [-694.140] -- 0:01:13
      39500 -- (-692.720) [-694.059] (-696.046) (-695.409) * (-691.677) [-691.474] (-694.028) (-695.947) -- 0:01:12
      40000 -- [-692.609] (-692.114) (-699.072) (-693.969) * (-704.040) [-696.566] (-692.954) (-696.284) -- 0:01:12

      Average standard deviation of split frequencies: 0.047012

      40500 -- [-690.514] (-693.911) (-693.504) (-696.008) * (-691.773) (-697.174) [-691.896] (-695.145) -- 0:01:11
      41000 -- [-692.927] (-696.737) (-692.784) (-695.151) * (-692.687) [-692.935] (-694.829) (-697.053) -- 0:01:10
      41500 -- (-691.500) (-695.193) (-693.203) [-694.173] * [-692.168] (-695.453) (-696.449) (-693.534) -- 0:01:09
      42000 -- (-691.995) (-693.288) (-694.159) [-694.485] * (-694.699) (-693.354) [-696.629] (-693.449) -- 0:01:08
      42500 -- (-694.264) [-695.975] (-692.537) (-693.189) * (-692.602) (-694.221) (-694.218) [-695.434] -- 0:01:07
      43000 -- (-693.002) [-693.744] (-694.037) (-694.957) * (-694.332) (-695.268) (-695.485) [-692.798] -- 0:01:06
      43500 -- (-700.489) (-692.523) (-693.160) [-695.471] * (-690.812) (-694.221) (-695.114) [-693.115] -- 0:01:05
      44000 -- [-693.922] (-693.707) (-692.328) (-694.822) * (-692.405) [-691.484] (-693.788) (-695.083) -- 0:01:05
      44500 -- [-693.277] (-694.381) (-693.960) (-693.064) * [-693.263] (-693.110) (-696.928) (-694.078) -- 0:01:04
      45000 -- (-691.969) [-692.314] (-693.406) (-693.177) * [-694.793] (-692.573) (-692.971) (-691.600) -- 0:01:03

      Average standard deviation of split frequencies: 0.033818

      45500 -- (-692.639) (-692.369) (-694.901) [-693.970] * [-693.640] (-695.716) (-694.045) (-697.599) -- 0:01:02
      46000 -- [-693.889] (-694.432) (-695.188) (-697.248) * [-691.813] (-694.252) (-696.674) (-696.708) -- 0:01:02
      46500 -- (-695.551) (-692.381) (-695.778) [-695.369] * (-690.216) (-698.395) [-692.825] (-694.614) -- 0:01:01
      47000 -- [-691.540] (-691.836) (-694.291) (-694.657) * [-693.600] (-695.978) (-696.596) (-693.063) -- 0:01:21
      47500 -- (-692.022) (-694.666) (-696.729) [-696.147] * (-693.651) (-693.332) (-691.391) [-692.761] -- 0:01:20
      48000 -- (-695.293) [-695.208] (-693.098) (-694.966) * (-695.934) (-697.393) [-692.143] (-695.395) -- 0:01:19
      48500 -- (-694.308) [-691.722] (-694.870) (-693.318) * (-696.183) (-695.270) [-691.784] (-695.106) -- 0:01:18
      49000 -- [-694.110] (-690.893) (-690.885) (-696.144) * [-694.644] (-691.728) (-691.476) (-693.892) -- 0:01:17
      49500 -- (-695.105) (-693.929) (-694.251) [-694.910] * (-692.969) [-690.625] (-695.327) (-695.391) -- 0:01:16
      50000 -- (-693.737) [-692.930] (-694.610) (-694.154) * (-692.234) [-691.749] (-698.983) (-698.307) -- 0:01:16

      Average standard deviation of split frequencies: 0.040317

      50500 -- [-693.649] (-693.462) (-697.086) (-693.656) * (-695.749) [-693.186] (-695.264) (-695.580) -- 0:01:15
      51000 -- (-692.571) [-695.143] (-695.805) (-694.632) * [-694.882] (-692.219) (-694.469) (-697.533) -- 0:01:14
      51500 -- [-697.693] (-694.753) (-697.595) (-691.768) * (-693.841) [-692.245] (-693.220) (-694.587) -- 0:01:13
      52000 -- (-696.789) (-693.173) (-694.315) [-691.712] * [-696.473] (-693.443) (-693.369) (-696.395) -- 0:01:12
      52500 -- (-692.831) (-693.022) (-692.569) [-694.163] * (-694.356) [-692.045] (-693.871) (-693.959) -- 0:01:12
      53000 -- [-695.349] (-694.418) (-692.274) (-691.129) * (-692.807) (-691.977) [-692.273] (-693.845) -- 0:01:11
      53500 -- (-695.537) (-695.830) [-691.008] (-693.847) * (-696.547) (-697.295) (-696.539) [-694.910] -- 0:01:10
      54000 -- (-695.533) (-694.909) (-695.711) [-691.654] * [-694.245] (-692.075) (-691.842) (-699.176) -- 0:01:10
      54500 -- [-694.279] (-695.123) (-694.405) (-691.218) * (-695.653) (-694.982) (-700.285) [-695.632] -- 0:01:09
      55000 -- [-691.830] (-694.709) (-694.752) (-695.496) * (-694.123) (-694.506) (-697.014) [-695.081] -- 0:01:08

      Average standard deviation of split frequencies: 0.032343

      55500 -- [-692.331] (-693.235) (-693.541) (-693.387) * (-693.929) (-695.064) (-694.946) [-694.073] -- 0:01:08
      56000 -- (-693.974) [-695.258] (-693.429) (-692.998) * [-695.267] (-692.468) (-695.495) (-694.545) -- 0:01:07
      56500 -- (-692.216) (-693.570) [-692.668] (-698.719) * [-691.386] (-694.650) (-696.137) (-692.580) -- 0:01:06
      57000 -- (-695.211) [-691.772] (-691.657) (-694.267) * (-692.674) [-695.193] (-697.788) (-693.856) -- 0:01:06
      57500 -- (-696.979) [-692.140] (-696.751) (-694.004) * (-693.723) (-694.241) (-694.478) [-695.307] -- 0:01:05
      58000 -- [-691.766] (-697.119) (-698.886) (-694.578) * (-692.462) (-692.649) (-695.981) [-693.276] -- 0:01:04
      58500 -- (-695.226) (-695.318) (-693.379) [-696.007] * (-693.244) [-691.845] (-695.937) (-692.780) -- 0:01:04
      59000 -- (-694.446) [-691.896] (-691.411) (-696.487) * (-692.974) (-693.481) (-696.877) [-693.000] -- 0:01:03
      59500 -- (-696.271) [-695.367] (-692.586) (-699.561) * (-691.525) (-691.957) (-693.389) [-691.339] -- 0:01:03
      60000 -- (-694.021) (-690.690) [-689.679] (-697.680) * (-696.764) (-692.860) [-691.551] (-692.847) -- 0:01:02

      Average standard deviation of split frequencies: 0.031082

      60500 -- (-694.579) [-692.645] (-696.675) (-697.097) * (-695.957) (-691.242) (-693.869) [-695.742] -- 0:01:02
      61000 -- (-696.719) (-699.045) (-696.780) [-696.419] * (-692.755) (-695.290) [-692.821] (-696.577) -- 0:01:01
      61500 -- (-691.607) [-694.958] (-697.553) (-691.798) * (-693.374) (-694.483) (-694.021) [-693.115] -- 0:01:01
      62000 -- (-694.022) [-693.644] (-693.554) (-692.219) * [-692.594] (-691.780) (-694.685) (-691.562) -- 0:01:00
      62500 -- (-693.651) [-695.205] (-692.324) (-692.602) * [-693.487] (-698.282) (-697.264) (-692.820) -- 0:01:00
      63000 -- (-692.798) (-698.730) [-692.293] (-696.342) * (-693.071) (-691.745) [-691.155] (-693.080) -- 0:01:14
      63500 -- [-691.673] (-692.835) (-694.167) (-693.466) * (-698.045) [-691.555] (-694.098) (-697.708) -- 0:01:13
      64000 -- (-694.049) (-692.751) (-692.725) [-695.541] * (-699.658) (-695.007) (-694.797) [-696.829] -- 0:01:13
      64500 -- (-693.564) (-694.633) [-691.433] (-693.423) * (-691.052) [-694.133] (-693.600) (-692.304) -- 0:01:12
      65000 -- (-692.444) (-703.537) [-692.431] (-693.201) * [-693.096] (-698.050) (-694.186) (-694.131) -- 0:01:11

      Average standard deviation of split frequencies: 0.026529

      65500 -- [-691.064] (-696.696) (-690.069) (-693.388) * (-696.998) [-693.720] (-693.349) (-692.577) -- 0:01:11
      66000 -- (-691.942) (-697.165) [-692.853] (-696.468) * (-703.991) (-692.170) (-695.671) [-691.595] -- 0:01:10
      66500 -- (-692.517) [-692.306] (-692.828) (-693.693) * [-693.005] (-695.878) (-691.688) (-694.125) -- 0:01:10
      67000 -- (-693.247) (-698.017) [-695.139] (-692.979) * (-694.246) [-691.799] (-694.907) (-692.064) -- 0:01:09
      67500 -- (-697.296) [-693.396] (-692.412) (-691.775) * (-692.008) (-692.628) [-691.864] (-693.699) -- 0:01:09
      68000 -- (-696.540) [-691.729] (-690.699) (-694.609) * [-692.371] (-695.177) (-692.952) (-696.295) -- 0:01:08
      68500 -- (-696.981) (-691.738) (-693.438) [-693.513] * (-692.544) (-693.292) [-691.998] (-695.014) -- 0:01:07
      69000 -- [-695.152] (-694.726) (-693.207) (-693.801) * (-691.568) [-693.035] (-693.593) (-693.284) -- 0:01:07
      69500 -- (-696.394) [-695.673] (-698.054) (-695.573) * (-692.198) (-690.912) [-692.582] (-691.702) -- 0:01:06
      70000 -- (-695.638) [-694.103] (-697.578) (-696.211) * [-693.016] (-693.888) (-692.326) (-692.006) -- 0:01:06

      Average standard deviation of split frequencies: 0.025349

      70500 -- (-699.787) [-692.412] (-696.506) (-701.930) * (-694.291) [-696.679] (-694.065) (-692.232) -- 0:01:05
      71000 -- (-694.441) [-693.446] (-695.416) (-693.092) * (-691.917) (-693.317) [-691.779] (-692.721) -- 0:01:05
      71500 -- [-691.397] (-693.164) (-695.486) (-693.834) * (-691.137) (-695.894) [-692.148] (-692.257) -- 0:01:04
      72000 -- (-691.602) [-693.458] (-694.508) (-695.845) * (-692.244) (-693.140) (-695.764) [-691.818] -- 0:01:04
      72500 -- (-701.592) (-690.634) [-695.108] (-694.118) * [-694.606] (-691.474) (-692.399) (-692.156) -- 0:01:03
      73000 -- (-694.236) [-691.711] (-694.712) (-694.502) * [-695.984] (-694.492) (-691.644) (-692.117) -- 0:01:03
      73500 -- (-693.515) [-692.159] (-698.575) (-694.192) * [-695.819] (-693.489) (-695.280) (-694.440) -- 0:01:03
      74000 -- (-699.915) (-694.426) (-695.107) [-695.018] * (-697.929) (-695.096) [-691.505] (-692.371) -- 0:01:02
      74500 -- (-693.266) [-691.731] (-694.576) (-692.787) * (-693.372) (-693.835) [-694.124] (-693.019) -- 0:01:02
      75000 -- (-692.981) (-693.578) (-695.346) [-694.556] * (-695.306) [-695.164] (-692.765) (-691.572) -- 0:01:01

      Average standard deviation of split frequencies: 0.022199

      75500 -- (-692.215) (-692.615) [-696.648] (-693.968) * (-691.279) (-692.472) (-693.988) [-696.327] -- 0:01:01
      76000 -- (-695.149) (-694.407) (-694.863) [-691.892] * (-697.418) [-692.286] (-694.012) (-694.800) -- 0:01:00
      76500 -- [-693.935] (-696.210) (-693.643) (-694.546) * [-693.051] (-697.640) (-693.937) (-693.778) -- 0:01:00
      77000 -- [-696.669] (-692.251) (-695.188) (-700.603) * (-694.405) (-701.829) [-692.857] (-693.659) -- 0:00:59
      77500 -- (-692.596) [-695.444] (-694.894) (-702.984) * (-691.091) (-697.408) [-696.968] (-694.312) -- 0:00:59
      78000 -- (-692.702) (-698.943) (-691.227) [-696.913] * (-692.926) [-690.678] (-694.759) (-694.846) -- 0:00:59
      78500 -- (-692.457) (-695.786) (-690.947) [-690.451] * [-696.046] (-692.690) (-697.469) (-695.632) -- 0:00:58
      79000 -- (-698.678) (-695.799) [-692.211] (-694.842) * (-690.453) (-692.539) [-696.914] (-697.201) -- 0:01:09
      79500 -- (-695.713) (-695.087) (-693.667) [-694.428] * [-690.891] (-693.245) (-692.467) (-694.687) -- 0:01:09
      80000 -- (-693.029) [-692.860] (-695.945) (-694.254) * [-692.856] (-690.651) (-699.104) (-695.646) -- 0:01:09

      Average standard deviation of split frequencies: 0.021530

      80500 -- (-694.641) [-694.598] (-692.391) (-697.612) * (-691.359) (-692.694) [-693.029] (-692.554) -- 0:01:08
      81000 -- (-692.693) (-698.623) (-693.168) [-691.120] * (-691.520) (-690.878) [-695.278] (-694.174) -- 0:01:08
      81500 -- [-693.192] (-694.779) (-696.013) (-698.566) * (-691.998) [-691.157] (-693.174) (-691.850) -- 0:01:07
      82000 -- (-694.357) (-692.456) (-691.464) [-693.205] * (-692.777) (-693.687) [-691.630] (-689.733) -- 0:01:07
      82500 -- [-693.013] (-694.509) (-693.397) (-692.751) * [-693.679] (-691.999) (-691.981) (-693.001) -- 0:01:06
      83000 -- (-691.162) (-695.434) (-695.003) [-692.506] * [-691.733] (-695.102) (-696.208) (-693.052) -- 0:01:06
      83500 -- (-695.334) [-695.196] (-694.735) (-692.814) * (-692.180) (-695.101) (-692.304) [-696.122] -- 0:01:05
      84000 -- [-694.822] (-692.685) (-692.911) (-692.568) * [-691.910] (-699.450) (-693.330) (-694.861) -- 0:01:05
      84500 -- (-693.067) (-691.242) [-695.010] (-691.980) * [-692.804] (-693.864) (-695.325) (-696.123) -- 0:01:05
      85000 -- [-692.995] (-692.739) (-694.336) (-696.019) * (-692.474) (-693.480) [-692.290] (-694.074) -- 0:01:04

      Average standard deviation of split frequencies: 0.022503

      85500 -- (-696.247) (-696.422) [-697.853] (-694.239) * (-691.852) (-696.411) [-694.278] (-693.890) -- 0:01:04
      86000 -- (-695.274) (-692.911) [-697.115] (-695.076) * (-692.872) (-692.928) [-691.039] (-694.209) -- 0:01:03
      86500 -- (-693.273) (-697.238) [-692.149] (-694.492) * (-694.775) (-693.717) [-691.080] (-694.738) -- 0:01:03
      87000 -- (-695.860) [-695.831] (-696.548) (-692.950) * (-694.662) [-691.903] (-691.641) (-689.787) -- 0:01:02
      87500 -- (-694.549) (-692.614) [-692.476] (-693.403) * (-694.820) (-694.872) (-691.629) [-693.567] -- 0:01:02
      88000 -- (-694.429) [-693.992] (-695.077) (-694.174) * (-695.673) (-693.395) (-693.472) [-691.413] -- 0:01:02
      88500 -- (-694.915) (-698.851) [-697.069] (-694.320) * (-695.754) (-695.436) [-690.278] (-694.041) -- 0:01:01
      89000 -- (-695.123) [-693.315] (-696.528) (-694.892) * (-694.395) (-695.782) [-691.488] (-699.434) -- 0:01:01
      89500 -- (-698.984) [-693.184] (-694.302) (-693.530) * (-693.253) (-697.035) [-691.664] (-692.075) -- 0:01:01
      90000 -- [-695.063] (-696.777) (-701.249) (-696.069) * (-692.485) (-695.854) [-694.190] (-695.971) -- 0:01:00

      Average standard deviation of split frequencies: 0.021071

      90500 -- (-691.881) (-693.801) [-696.318] (-698.016) * (-694.112) (-695.609) (-694.470) [-692.362] -- 0:01:00
      91000 -- (-695.008) (-696.031) [-695.348] (-691.808) * [-691.629] (-692.312) (-694.114) (-694.189) -- 0:00:59
      91500 -- (-692.421) (-695.315) [-691.001] (-691.948) * (-696.053) (-692.647) (-696.266) [-694.790] -- 0:00:59
      92000 -- [-691.846] (-697.591) (-699.116) (-693.651) * (-692.790) (-692.086) (-697.521) [-692.904] -- 0:00:59
      92500 -- [-694.232] (-697.515) (-697.773) (-694.628) * (-693.955) (-692.412) (-695.585) [-695.568] -- 0:00:58
      93000 -- [-691.567] (-693.578) (-699.024) (-695.494) * (-692.444) [-691.430] (-698.239) (-692.754) -- 0:00:58
      93500 -- (-692.368) [-693.935] (-701.796) (-694.531) * (-690.671) (-698.242) [-689.855] (-691.867) -- 0:00:58
      94000 -- (-694.477) (-696.298) (-700.494) [-692.074] * [-693.319] (-693.295) (-693.047) (-693.808) -- 0:00:57
      94500 -- (-691.386) (-692.370) [-695.291] (-693.499) * (-703.888) (-696.081) (-690.894) [-697.045] -- 0:01:07
      95000 -- [-697.799] (-695.095) (-696.373) (-694.540) * (-704.390) (-692.432) [-691.281] (-693.183) -- 0:01:06

      Average standard deviation of split frequencies: 0.020220

      95500 -- (-693.628) (-692.889) (-695.301) [-693.543] * [-690.768] (-699.575) (-693.976) (-691.567) -- 0:01:06
      96000 -- (-692.412) (-693.238) (-697.370) [-697.918] * [-691.807] (-692.401) (-690.907) (-692.628) -- 0:01:05
      96500 -- (-696.191) [-691.502] (-694.562) (-692.244) * [-691.801] (-697.418) (-694.050) (-693.205) -- 0:01:05
      97000 -- (-693.430) [-693.723] (-696.147) (-694.867) * (-696.726) [-696.007] (-692.265) (-694.449) -- 0:01:05
      97500 -- (-691.768) (-696.152) (-695.874) [-692.141] * [-691.932] (-697.242) (-691.472) (-697.411) -- 0:01:04
      98000 -- (-697.076) (-696.696) (-696.111) [-693.138] * (-691.205) (-697.236) [-693.478] (-695.198) -- 0:01:04
      98500 -- [-697.873] (-692.323) (-699.773) (-697.861) * (-695.828) (-694.685) (-693.802) [-693.124] -- 0:01:04
      99000 -- (-693.081) [-694.842] (-699.714) (-693.179) * (-694.045) [-694.156] (-695.713) (-692.989) -- 0:01:03
      99500 -- (-690.368) [-694.420] (-694.432) (-693.709) * [-692.369] (-693.283) (-694.224) (-693.327) -- 0:01:03
      100000 -- (-692.937) [-694.742] (-695.070) (-691.620) * [-693.109] (-693.140) (-694.175) (-692.424) -- 0:01:02

      Average standard deviation of split frequencies: 0.020384

      100500 -- (-693.704) (-694.833) [-697.048] (-696.520) * (-696.229) (-696.210) [-693.235] (-693.721) -- 0:01:02
      101000 -- [-694.978] (-694.135) (-695.004) (-696.809) * (-694.415) (-696.990) [-694.362] (-690.644) -- 0:01:02
      101500 -- (-692.611) [-693.664] (-695.959) (-695.618) * (-693.759) (-697.543) [-692.391] (-693.712) -- 0:01:01
      102000 -- (-694.909) (-691.680) (-695.694) [-692.676] * (-694.433) (-691.370) [-695.806] (-695.105) -- 0:01:01
      102500 -- [-690.657] (-694.332) (-693.864) (-695.029) * (-693.981) [-693.239] (-692.352) (-691.912) -- 0:01:01
      103000 -- (-696.011) (-689.556) (-694.346) [-695.694] * (-695.680) (-694.700) [-694.473] (-691.113) -- 0:01:00
      103500 -- [-691.431] (-694.944) (-693.523) (-696.066) * [-694.236] (-694.656) (-697.165) (-693.141) -- 0:01:00
      104000 -- (-693.297) (-694.452) [-699.849] (-694.581) * (-694.063) (-692.647) [-693.595] (-695.713) -- 0:01:00
      104500 -- (-694.809) [-693.636] (-691.542) (-692.450) * (-691.808) (-692.947) [-692.691] (-696.199) -- 0:00:59
      105000 -- [-693.275] (-692.585) (-694.697) (-695.775) * [-694.497] (-700.188) (-691.950) (-698.481) -- 0:00:59

      Average standard deviation of split frequencies: 0.021742

      105500 -- [-693.832] (-692.536) (-691.964) (-693.845) * (-692.292) (-696.716) (-691.536) [-691.739] -- 0:00:59
      106000 -- (-694.126) [-693.181] (-692.615) (-693.110) * [-695.572] (-695.446) (-696.034) (-694.673) -- 0:00:59
      106500 -- (-692.079) (-693.845) (-693.560) [-694.247] * (-695.392) [-693.259] (-694.455) (-694.246) -- 0:00:58
      107000 -- (-692.319) [-691.728] (-694.735) (-692.887) * (-694.559) (-693.297) (-693.510) [-692.912] -- 0:00:58
      107500 -- (-695.465) [-692.560] (-694.176) (-693.703) * (-697.797) (-693.863) [-692.686] (-692.474) -- 0:00:58
      108000 -- (-695.274) [-693.788] (-692.071) (-693.010) * (-690.475) (-692.017) [-691.400] (-691.971) -- 0:00:57
      108500 -- (-692.349) [-693.942] (-695.167) (-692.983) * [-691.957] (-698.958) (-691.799) (-692.357) -- 0:00:57
      109000 -- (-698.137) (-692.480) [-694.102] (-692.709) * (-691.691) [-694.468] (-692.180) (-692.911) -- 0:00:57
      109500 -- [-694.378] (-693.632) (-692.087) (-693.023) * (-692.924) (-694.408) [-692.248] (-694.340) -- 0:00:56
      110000 -- (-695.640) (-696.803) [-692.214] (-696.667) * (-694.430) (-693.425) [-694.188] (-693.865) -- 0:01:04

      Average standard deviation of split frequencies: 0.024138

      110500 -- [-694.889] (-692.619) (-693.535) (-696.782) * (-693.636) [-692.852] (-693.586) (-696.741) -- 0:01:04
      111000 -- (-696.080) (-692.404) [-695.486] (-697.374) * (-693.462) [-693.742] (-695.982) (-693.791) -- 0:01:04
      111500 -- (-696.116) [-691.826] (-694.278) (-695.327) * [-695.206] (-695.911) (-694.939) (-696.300) -- 0:01:03
      112000 -- (-695.127) [-691.895] (-700.894) (-692.499) * [-694.026] (-694.089) (-697.533) (-694.943) -- 0:01:03
      112500 -- (-695.796) (-695.380) (-695.325) [-694.976] * (-692.809) (-695.262) [-691.911] (-696.253) -- 0:01:03
      113000 -- (-693.261) [-695.743] (-696.678) (-698.862) * (-693.597) (-692.855) [-694.732] (-694.880) -- 0:01:02
      113500 -- (-694.574) (-693.264) (-696.056) [-692.641] * [-693.941] (-693.213) (-693.671) (-694.527) -- 0:01:02
      114000 -- (-696.943) [-690.910] (-692.524) (-693.568) * (-692.861) (-695.691) (-694.106) [-692.828] -- 0:01:02
      114500 -- [-694.577] (-692.238) (-695.474) (-693.483) * (-692.474) (-693.626) [-693.432] (-694.282) -- 0:01:01
      115000 -- (-695.373) (-693.158) (-692.511) [-693.495] * (-694.769) (-692.388) [-690.623] (-694.100) -- 0:01:01

      Average standard deviation of split frequencies: 0.025512

      115500 -- [-694.343] (-698.366) (-692.418) (-694.546) * (-691.335) (-694.564) (-691.800) [-693.281] -- 0:01:01
      116000 -- (-695.993) (-693.702) [-694.937] (-695.516) * (-694.492) [-696.044] (-695.478) (-693.598) -- 0:01:00
      116500 -- (-692.402) [-691.731] (-692.950) (-695.216) * (-693.617) (-691.994) [-691.568] (-694.327) -- 0:01:00
      117000 -- (-698.220) (-692.831) (-700.611) [-695.521] * [-694.658] (-694.516) (-694.396) (-694.877) -- 0:01:00
      117500 -- (-692.626) (-695.560) (-692.365) [-701.407] * (-695.144) (-694.021) (-693.661) [-693.050] -- 0:01:00
      118000 -- [-691.533] (-694.365) (-690.885) (-693.614) * [-694.848] (-698.774) (-694.042) (-696.969) -- 0:00:59
      118500 -- [-691.218] (-696.453) (-695.563) (-693.117) * [-693.035] (-698.086) (-692.396) (-692.374) -- 0:00:59
      119000 -- (-692.831) [-692.438] (-692.246) (-698.214) * [-694.131] (-696.652) (-695.725) (-695.910) -- 0:00:59
      119500 -- [-692.791] (-694.174) (-695.441) (-695.696) * [-691.208] (-694.331) (-693.117) (-693.255) -- 0:00:58
      120000 -- [-693.112] (-696.077) (-695.989) (-694.072) * (-691.623) (-695.130) (-693.175) [-691.748] -- 0:00:58

      Average standard deviation of split frequencies: 0.024674

      120500 -- [-692.288] (-695.920) (-696.963) (-694.171) * [-692.280] (-693.650) (-694.661) (-696.158) -- 0:00:58
      121000 -- [-692.860] (-700.035) (-697.070) (-696.090) * (-696.225) [-693.913] (-691.108) (-692.642) -- 0:00:58
      121500 -- [-694.065] (-693.009) (-703.947) (-694.535) * [-695.496] (-693.123) (-694.473) (-694.265) -- 0:00:57
      122000 -- (-693.106) (-693.266) (-695.619) [-694.609] * [-692.105] (-693.703) (-691.340) (-692.364) -- 0:00:57
      122500 -- [-692.936] (-695.219) (-692.665) (-692.752) * [-693.168] (-696.112) (-692.511) (-691.422) -- 0:00:57
      123000 -- (-696.537) (-693.359) [-693.739] (-695.910) * (-691.457) (-692.557) (-694.634) [-692.917] -- 0:00:57
      123500 -- [-698.287] (-691.089) (-692.716) (-692.638) * [-691.311] (-695.303) (-692.650) (-692.930) -- 0:00:56
      124000 -- (-698.655) [-694.625] (-697.180) (-693.099) * (-696.952) (-692.915) (-693.201) [-693.118] -- 0:00:56
      124500 -- (-690.837) (-699.044) [-695.615] (-697.643) * (-691.300) (-691.947) (-693.699) [-692.610] -- 0:00:56
      125000 -- (-692.049) [-690.775] (-693.270) (-699.791) * (-691.268) [-693.281] (-690.325) (-691.561) -- 0:00:56

      Average standard deviation of split frequencies: 0.023826

      125500 -- (-692.908) (-692.424) [-693.044] (-695.327) * [-692.161] (-693.311) (-691.657) (-691.057) -- 0:01:02
      126000 -- (-692.518) (-692.312) [-696.704] (-694.574) * (-693.965) (-692.610) (-692.658) [-692.691] -- 0:01:02
      126500 -- (-692.708) [-690.379] (-696.217) (-693.837) * (-693.243) (-694.630) (-691.171) [-691.962] -- 0:01:02
      127000 -- [-693.330] (-695.833) (-691.670) (-694.929) * [-693.604] (-692.535) (-693.292) (-693.239) -- 0:01:01
      127500 -- [-693.205] (-693.538) (-692.134) (-693.063) * (-695.247) [-691.479] (-692.660) (-693.689) -- 0:01:01
      128000 -- (-692.239) [-692.398] (-695.173) (-692.200) * [-693.511] (-694.800) (-694.274) (-693.444) -- 0:01:01
      128500 -- (-690.802) [-695.286] (-694.224) (-693.608) * (-696.261) (-693.455) [-692.746] (-692.786) -- 0:01:01
      129000 -- (-691.166) [-692.306] (-698.081) (-692.541) * (-694.979) [-690.604] (-693.771) (-693.919) -- 0:01:00
      129500 -- (-692.031) (-692.961) (-698.181) [-692.954] * (-692.097) [-692.130] (-691.589) (-697.150) -- 0:01:00
      130000 -- (-692.042) (-699.625) [-695.495] (-694.709) * (-696.947) [-696.529] (-691.308) (-695.873) -- 0:01:00

      Average standard deviation of split frequencies: 0.022406

      130500 -- (-694.269) (-698.122) (-692.692) [-695.082] * (-693.279) (-691.896) [-691.248] (-696.250) -- 0:00:59
      131000 -- [-690.933] (-693.460) (-693.289) (-693.149) * (-692.651) (-695.527) [-694.859] (-691.346) -- 0:00:59
      131500 -- [-692.858] (-692.110) (-692.748) (-693.494) * (-691.838) (-693.191) [-695.479] (-693.639) -- 0:00:59
      132000 -- (-692.267) (-698.060) [-691.682] (-693.989) * (-691.630) (-694.889) (-697.969) [-691.131] -- 0:00:59
      132500 -- (-692.784) (-699.361) [-692.423] (-690.616) * (-693.264) (-694.790) (-696.953) [-691.533] -- 0:00:58
      133000 -- (-692.822) (-696.571) [-690.502] (-692.633) * (-695.325) [-691.982] (-695.710) (-691.457) -- 0:00:58
      133500 -- (-692.777) (-694.705) (-692.310) [-691.465] * (-693.802) [-691.171] (-697.988) (-694.419) -- 0:00:58
      134000 -- (-692.617) [-692.989] (-692.166) (-697.325) * (-693.639) (-697.375) [-693.170] (-693.361) -- 0:00:58
      134500 -- [-691.274] (-693.627) (-698.565) (-692.576) * [-693.515] (-697.324) (-694.835) (-691.415) -- 0:00:57
      135000 -- [-692.334] (-694.728) (-693.204) (-693.331) * (-696.558) [-696.916] (-692.313) (-693.276) -- 0:00:57

      Average standard deviation of split frequencies: 0.022145

      135500 -- (-694.920) (-692.359) (-699.470) [-693.242] * (-697.362) [-694.351] (-695.671) (-693.732) -- 0:00:57
      136000 -- (-693.531) [-696.220] (-694.903) (-694.705) * [-697.929] (-696.247) (-691.292) (-692.904) -- 0:00:57
      136500 -- [-692.129] (-693.459) (-696.438) (-693.676) * (-694.097) [-695.230] (-694.455) (-691.883) -- 0:00:56
      137000 -- (-696.042) (-693.723) (-691.714) [-695.168] * [-691.364] (-698.636) (-693.924) (-694.278) -- 0:00:56
      137500 -- (-693.207) [-693.478] (-696.727) (-693.784) * (-692.824) (-691.794) [-692.817] (-692.543) -- 0:00:56
      138000 -- (-703.069) [-691.677] (-696.005) (-693.368) * [-690.457] (-691.648) (-694.048) (-694.280) -- 0:00:56
      138500 -- (-692.295) (-692.531) [-698.395] (-692.264) * (-695.524) [-691.692] (-692.932) (-692.346) -- 0:00:55
      139000 -- (-693.746) (-691.329) [-695.430] (-696.524) * [-694.628] (-692.655) (-693.422) (-692.596) -- 0:00:55
      139500 -- (-694.537) (-692.367) [-696.716] (-693.408) * (-692.247) [-692.252] (-692.040) (-692.842) -- 0:00:55
      140000 -- (-692.085) [-691.351] (-696.872) (-693.448) * (-700.560) [-693.796] (-694.852) (-695.552) -- 0:00:55

      Average standard deviation of split frequencies: 0.021684

      140500 -- (-696.743) [-693.730] (-696.514) (-693.935) * [-695.652] (-694.397) (-691.522) (-695.198) -- 0:00:55
      141000 -- (-694.168) [-690.628] (-696.295) (-694.207) * (-698.378) [-695.297] (-692.826) (-691.938) -- 0:01:00
      141500 -- (-694.314) (-692.942) (-695.070) [-695.570] * (-694.397) (-698.565) [-692.163] (-695.116) -- 0:01:00
      142000 -- (-694.578) (-691.508) (-693.753) [-694.364] * [-693.377] (-693.247) (-699.462) (-694.537) -- 0:01:00
      142500 -- (-692.293) [-694.444] (-692.854) (-697.159) * (-693.440) (-693.697) [-694.578] (-698.414) -- 0:01:00
      143000 -- (-696.840) (-692.687) (-693.791) [-697.270] * (-691.010) (-693.065) (-696.423) [-692.959] -- 0:00:59
      143500 -- (-694.690) (-693.617) [-693.189] (-696.776) * [-691.284] (-694.191) (-693.202) (-692.573) -- 0:00:59
      144000 -- (-693.899) (-691.303) [-693.151] (-697.977) * (-691.743) [-691.622] (-705.490) (-693.861) -- 0:00:59
      144500 -- (-692.097) (-692.544) [-694.666] (-694.106) * (-694.312) (-692.743) (-701.050) [-697.116] -- 0:00:59
      145000 -- (-696.718) (-694.525) [-694.640] (-693.799) * (-697.994) [-692.953] (-693.289) (-692.961) -- 0:00:58

      Average standard deviation of split frequencies: 0.020702

      145500 -- (-694.399) (-690.842) (-693.952) [-692.971] * (-691.742) (-693.866) [-695.417] (-694.772) -- 0:00:58
      146000 -- [-696.596] (-691.948) (-692.034) (-692.140) * (-694.691) (-700.273) [-691.554] (-693.250) -- 0:00:58
      146500 -- [-692.239] (-696.897) (-694.856) (-692.237) * [-691.802] (-697.102) (-692.368) (-693.486) -- 0:00:58
      147000 -- (-694.485) [-693.456] (-693.805) (-695.460) * [-694.777] (-692.566) (-693.882) (-696.581) -- 0:00:58
      147500 -- (-691.893) (-693.801) (-692.162) [-693.784] * (-693.308) (-692.692) [-692.787] (-695.140) -- 0:00:57
      148000 -- (-691.540) (-695.447) [-693.477] (-693.256) * (-697.181) (-695.020) [-694.457] (-692.302) -- 0:00:57
      148500 -- (-691.978) (-694.632) (-695.397) [-691.425] * [-692.595] (-695.100) (-693.280) (-694.301) -- 0:00:57
      149000 -- (-698.862) (-692.910) [-691.590] (-695.700) * [-692.388] (-695.230) (-693.699) (-696.625) -- 0:00:57
      149500 -- (-696.389) [-694.179] (-694.284) (-691.999) * [-693.533] (-697.414) (-695.020) (-691.837) -- 0:00:56
      150000 -- (-696.438) [-696.100] (-692.634) (-692.687) * (-692.510) (-699.472) (-696.717) [-693.291] -- 0:00:56

      Average standard deviation of split frequencies: 0.021902

      150500 -- (-694.401) (-696.512) [-692.831] (-692.614) * (-697.277) (-694.329) [-692.945] (-695.639) -- 0:00:56
      151000 -- (-693.485) (-694.735) [-692.440] (-692.547) * (-697.141) (-695.360) (-693.859) [-693.760] -- 0:00:56
      151500 -- [-691.205] (-694.898) (-694.883) (-695.725) * [-694.012] (-695.383) (-694.520) (-693.670) -- 0:00:56
      152000 -- (-694.414) [-693.571] (-694.454) (-691.304) * [-694.880] (-694.978) (-694.083) (-693.015) -- 0:00:55
      152500 -- (-697.680) (-701.170) (-699.039) [-692.331] * (-694.229) [-692.734] (-691.217) (-692.296) -- 0:00:55
      153000 -- (-697.995) [-695.579] (-697.552) (-694.616) * (-693.779) (-696.800) [-691.925] (-690.926) -- 0:00:55
      153500 -- [-692.719] (-693.866) (-698.326) (-694.145) * [-694.699] (-701.147) (-695.519) (-693.324) -- 0:00:55
      154000 -- (-691.921) (-697.733) (-692.357) [-695.279] * (-695.673) (-695.660) (-696.756) [-696.974] -- 0:00:54
      154500 -- (-691.951) (-696.131) [-692.057] (-692.884) * (-693.411) (-698.150) (-692.993) [-697.147] -- 0:00:54
      155000 -- [-691.719] (-690.158) (-692.979) (-693.185) * (-692.983) (-694.478) (-694.612) [-696.136] -- 0:00:54

      Average standard deviation of split frequencies: 0.021686

      155500 -- (-691.427) (-691.725) [-690.294] (-691.597) * (-694.547) (-697.079) [-693.767] (-691.553) -- 0:00:54
      156000 -- [-693.042] (-693.495) (-697.616) (-693.231) * (-692.920) [-692.854] (-694.904) (-691.630) -- 0:00:54
      156500 -- [-691.808] (-692.683) (-694.379) (-693.581) * (-694.938) [-692.566] (-693.935) (-695.087) -- 0:00:59
      157000 -- (-693.560) [-691.359] (-693.300) (-693.921) * (-696.868) (-692.124) (-691.690) [-696.677] -- 0:00:59
      157500 -- (-694.315) (-694.322) [-692.385] (-694.128) * (-693.507) (-694.978) (-696.461) [-695.577] -- 0:00:58
      158000 -- (-701.153) [-695.049] (-695.185) (-695.684) * (-693.227) (-692.597) (-695.867) [-692.910] -- 0:00:58
      158500 -- (-697.080) (-699.127) (-697.184) [-692.363] * (-693.926) (-693.983) (-693.506) [-692.325] -- 0:00:58
      159000 -- (-694.418) (-694.934) (-696.924) [-693.038] * [-694.180] (-691.387) (-694.778) (-698.605) -- 0:00:58
      159500 -- (-694.728) [-694.369] (-696.466) (-691.915) * (-693.360) [-695.216] (-692.198) (-695.309) -- 0:00:57
      160000 -- (-696.545) [-691.115] (-693.257) (-693.359) * (-696.245) (-696.297) (-692.677) [-696.080] -- 0:00:57

      Average standard deviation of split frequencies: 0.023127

      160500 -- (-693.646) [-691.742] (-699.339) (-693.853) * [-695.392] (-694.576) (-696.200) (-696.465) -- 0:00:57
      161000 -- (-695.234) (-691.105) (-693.420) [-693.376] * [-691.305] (-696.306) (-691.428) (-696.943) -- 0:00:57
      161500 -- (-697.419) (-695.495) [-691.336] (-691.385) * (-697.006) (-693.229) [-690.355] (-696.687) -- 0:00:57
      162000 -- [-694.157] (-694.877) (-694.789) (-691.299) * (-692.338) [-695.477] (-694.028) (-696.208) -- 0:00:56
      162500 -- (-695.104) (-693.543) (-692.669) [-691.093] * (-695.857) [-693.773] (-692.319) (-695.273) -- 0:00:56
      163000 -- [-693.262] (-693.025) (-694.308) (-700.507) * (-692.991) [-690.863] (-691.587) (-694.560) -- 0:00:56
      163500 -- [-692.449] (-691.677) (-694.155) (-690.471) * (-695.479) [-691.729] (-689.769) (-695.139) -- 0:00:56
      164000 -- (-693.461) [-693.036] (-694.050) (-696.091) * (-692.313) [-695.767] (-692.620) (-693.377) -- 0:00:56
      164500 -- (-692.741) (-693.891) (-695.497) [-691.104] * (-695.501) (-692.080) (-695.617) [-692.023] -- 0:00:55
      165000 -- (-691.277) (-697.028) [-696.193] (-695.782) * (-692.468) [-693.814] (-696.180) (-691.861) -- 0:00:55

      Average standard deviation of split frequencies: 0.022008

      165500 -- (-694.027) (-695.912) [-693.490] (-693.968) * [-693.067] (-693.901) (-694.162) (-692.785) -- 0:00:55
      166000 -- (-693.626) (-697.054) (-695.901) [-695.943] * (-695.304) (-692.228) [-691.370] (-693.735) -- 0:00:55
      166500 -- (-697.431) [-695.343] (-693.883) (-695.718) * (-698.311) (-694.482) [-694.114] (-694.771) -- 0:00:55
      167000 -- (-692.514) [-697.638] (-693.933) (-691.302) * (-695.332) (-690.416) (-694.811) [-696.254] -- 0:00:54
      167500 -- (-691.053) (-695.184) [-697.979] (-693.244) * [-696.368] (-691.105) (-694.248) (-693.266) -- 0:00:54
      168000 -- [-694.624] (-693.560) (-693.217) (-693.215) * (-694.481) [-693.305] (-692.243) (-693.849) -- 0:00:54
      168500 -- (-693.184) (-695.990) [-698.722] (-691.752) * (-692.601) [-691.217] (-694.170) (-694.970) -- 0:00:54
      169000 -- (-695.601) (-694.428) (-694.273) [-692.221] * [-695.360] (-690.355) (-695.494) (-694.029) -- 0:00:54
      169500 -- [-693.273] (-693.545) (-692.471) (-694.459) * [-692.087] (-693.500) (-694.484) (-692.407) -- 0:00:53
      170000 -- (-692.581) (-693.546) (-693.016) [-693.096] * (-696.811) [-694.037] (-691.660) (-694.978) -- 0:00:53

      Average standard deviation of split frequencies: 0.019795

      170500 -- (-691.697) (-693.589) [-692.450] (-694.922) * (-696.173) [-691.576] (-690.038) (-692.243) -- 0:00:53
      171000 -- [-691.948] (-694.684) (-696.946) (-692.105) * (-693.308) (-690.817) (-695.816) [-694.169] -- 0:00:53
      171500 -- (-693.391) (-694.322) [-692.149] (-692.728) * (-696.815) (-693.377) [-691.378] (-692.139) -- 0:00:53
      172000 -- (-697.568) (-693.393) [-693.386] (-691.758) * (-695.478) [-691.579] (-691.060) (-692.248) -- 0:00:52
      172500 -- (-692.898) [-694.229] (-694.012) (-692.944) * (-693.572) (-692.051) (-695.340) [-693.433] -- 0:00:57
      173000 -- (-694.607) (-695.572) (-694.467) [-692.583] * (-693.870) [-692.918] (-693.925) (-694.618) -- 0:00:57
      173500 -- (-694.117) (-695.797) [-696.440] (-698.833) * (-693.161) (-697.472) [-693.110] (-698.975) -- 0:00:57
      174000 -- [-693.908] (-695.839) (-692.531) (-696.214) * (-692.956) [-692.907] (-693.930) (-692.614) -- 0:00:56
      174500 -- [-691.334] (-693.293) (-696.555) (-692.659) * (-696.124) (-694.967) [-695.186] (-693.683) -- 0:00:56
      175000 -- (-690.162) (-695.266) [-693.178] (-691.650) * (-696.178) (-692.492) (-696.011) [-693.701] -- 0:00:56

      Average standard deviation of split frequencies: 0.020167

      175500 -- (-691.072) [-690.976] (-696.129) (-692.062) * (-694.105) [-692.244] (-696.347) (-694.776) -- 0:00:56
      176000 -- (-692.758) [-692.953] (-690.555) (-692.008) * [-691.541] (-692.285) (-693.243) (-698.084) -- 0:00:56
      176500 -- (-694.074) (-696.449) (-692.642) [-694.223] * [-693.227] (-691.935) (-695.655) (-694.894) -- 0:00:55
      177000 -- (-697.159) (-695.307) [-691.606] (-693.944) * (-695.972) (-693.314) (-693.995) [-695.305] -- 0:00:55
      177500 -- (-695.673) [-689.847] (-694.841) (-694.273) * (-691.916) [-694.930] (-695.187) (-695.139) -- 0:00:55
      178000 -- (-694.786) (-692.885) (-694.663) [-691.149] * (-693.618) (-693.398) (-696.357) [-695.892] -- 0:00:55
      178500 -- (-694.049) [-693.556] (-696.282) (-692.433) * (-694.816) [-693.453] (-694.042) (-694.704) -- 0:00:55
      179000 -- (-694.587) (-692.954) (-696.551) [-693.808] * (-701.900) [-693.168] (-697.643) (-695.172) -- 0:00:55
      179500 -- (-692.051) (-691.257) (-693.358) [-693.547] * (-694.142) [-694.225] (-692.774) (-692.825) -- 0:00:54
      180000 -- [-694.277] (-691.958) (-694.650) (-691.490) * (-695.625) (-699.272) [-694.681] (-697.096) -- 0:00:54

      Average standard deviation of split frequencies: 0.019406

      180500 -- (-694.760) [-693.581] (-692.522) (-692.409) * (-694.191) [-693.913] (-696.100) (-693.743) -- 0:00:54
      181000 -- (-695.333) (-690.815) (-692.750) [-694.379] * (-697.915) (-695.360) (-698.215) [-694.753] -- 0:00:54
      181500 -- [-695.980] (-697.579) (-695.480) (-692.839) * [-694.910] (-694.396) (-694.847) (-696.093) -- 0:00:54
      182000 -- (-695.993) (-697.103) (-695.738) [-695.216] * (-694.704) (-692.113) (-692.700) [-694.627] -- 0:00:53
      182500 -- (-694.838) (-696.686) [-696.302] (-697.435) * (-696.158) [-691.745] (-695.123) (-693.212) -- 0:00:53
      183000 -- (-696.425) (-694.153) [-692.349] (-691.503) * [-695.351] (-691.621) (-700.598) (-694.315) -- 0:00:53
      183500 -- (-693.705) [-693.734] (-696.459) (-695.266) * (-696.085) (-694.048) (-694.923) [-695.826] -- 0:00:53
      184000 -- (-694.584) [-694.401] (-693.996) (-692.731) * [-695.722] (-695.782) (-692.900) (-695.346) -- 0:00:53
      184500 -- [-697.358] (-695.833) (-693.737) (-691.425) * (-695.288) (-692.083) (-692.569) [-693.124] -- 0:00:53
      185000 -- (-703.865) [-694.949] (-695.262) (-691.097) * (-698.124) (-695.469) [-691.758] (-692.851) -- 0:00:52

      Average standard deviation of split frequencies: 0.020698

      185500 -- (-699.210) (-694.833) (-693.746) [-693.126] * (-705.921) (-694.938) [-693.784] (-694.508) -- 0:00:52
      186000 -- (-695.996) (-693.098) (-694.441) [-694.541] * (-702.785) (-696.093) [-692.711] (-691.370) -- 0:00:52
      186500 -- (-693.244) (-693.122) (-692.426) [-692.669] * (-696.085) [-692.673] (-692.454) (-693.534) -- 0:00:52
      187000 -- (-694.843) (-696.202) (-693.140) [-693.803] * (-692.102) (-694.452) [-692.880] (-692.956) -- 0:00:52
      187500 -- (-696.581) (-695.180) [-696.254] (-695.384) * (-700.586) (-695.826) (-692.057) [-693.494] -- 0:00:52
      188000 -- (-693.617) [-694.042] (-696.683) (-693.029) * (-700.502) (-694.488) (-689.591) [-690.852] -- 0:00:56
      188500 -- (-691.438) (-690.703) [-693.768] (-694.580) * (-695.430) (-695.346) [-691.632] (-693.236) -- 0:00:55
      189000 -- [-692.888] (-693.679) (-693.668) (-691.108) * [-696.088] (-692.344) (-692.706) (-691.082) -- 0:00:55
      189500 -- (-692.622) (-697.498) [-692.886] (-695.569) * (-696.592) (-691.643) (-694.363) [-692.769] -- 0:00:55
      190000 -- [-692.895] (-692.544) (-692.424) (-694.877) * (-697.283) [-692.465] (-692.819) (-692.773) -- 0:00:55

      Average standard deviation of split frequencies: 0.021290

      190500 -- (-692.614) (-694.492) [-692.205] (-699.840) * [-697.810] (-691.296) (-689.527) (-691.432) -- 0:00:55
      191000 -- (-695.353) (-693.267) (-694.204) [-697.504] * [-696.162] (-692.505) (-691.447) (-693.676) -- 0:00:55
      191500 -- [-691.556] (-692.640) (-692.536) (-699.583) * (-696.390) (-691.947) [-691.499] (-697.728) -- 0:00:54
      192000 -- (-695.429) (-693.474) (-692.193) [-693.826] * (-695.762) (-693.636) (-693.382) [-695.738] -- 0:00:54
      192500 -- (-695.111) (-691.563) [-693.052] (-695.202) * [-696.798] (-693.443) (-694.764) (-697.082) -- 0:00:54
      193000 -- [-692.418] (-691.908) (-694.819) (-696.121) * [-691.970] (-692.940) (-692.350) (-694.343) -- 0:00:54
      193500 -- [-695.495] (-694.683) (-692.299) (-695.676) * (-695.456) [-691.326] (-692.738) (-693.568) -- 0:00:54
      194000 -- (-692.012) (-693.874) (-698.802) [-691.032] * (-692.317) (-693.544) (-692.822) [-692.935] -- 0:00:54
      194500 -- (-697.797) [-694.118] (-700.088) (-695.587) * (-693.067) (-690.583) [-693.958] (-692.688) -- 0:00:53
      195000 -- (-695.694) (-696.229) (-696.282) [-692.544] * (-693.956) (-697.265) (-691.565) [-692.826] -- 0:00:53

      Average standard deviation of split frequencies: 0.021080

      195500 -- (-693.758) [-694.024] (-696.218) (-692.952) * [-694.893] (-695.758) (-696.486) (-694.340) -- 0:00:53
      196000 -- (-694.465) (-694.890) (-693.618) [-698.782] * (-693.712) (-692.744) (-697.077) [-695.989] -- 0:00:53
      196500 -- (-698.482) (-695.390) (-695.204) [-691.673] * (-699.979) (-692.322) [-693.313] (-693.475) -- 0:00:53
      197000 -- [-699.041] (-697.574) (-692.617) (-696.221) * (-694.921) (-694.010) [-692.560] (-694.039) -- 0:00:52
      197500 -- (-698.631) (-693.585) (-700.987) [-699.081] * (-694.480) [-692.794] (-692.545) (-692.236) -- 0:00:52
      198000 -- (-697.569) (-692.621) [-694.346] (-696.720) * (-695.020) (-692.434) (-691.714) [-692.154] -- 0:00:52
      198500 -- (-693.559) (-690.537) [-691.291] (-692.092) * (-696.179) (-693.553) [-691.772] (-694.633) -- 0:00:52
      199000 -- (-695.606) [-695.531] (-691.034) (-692.034) * (-694.339) (-693.092) [-691.281] (-691.072) -- 0:00:52
      199500 -- [-694.960] (-695.531) (-690.932) (-691.389) * (-694.123) (-694.788) (-692.947) [-691.701] -- 0:00:52
      200000 -- (-694.596) (-692.785) [-693.290] (-693.021) * (-694.156) (-691.033) [-695.059] (-692.591) -- 0:00:51

      Average standard deviation of split frequencies: 0.022611

      200500 -- (-694.364) (-694.553) [-695.348] (-692.000) * (-697.124) (-696.746) (-692.570) [-691.014] -- 0:00:51
      201000 -- (-695.851) [-692.418] (-693.114) (-694.064) * (-696.824) (-693.410) [-692.761] (-693.730) -- 0:00:51
      201500 -- [-691.175] (-691.001) (-692.766) (-690.907) * [-695.169] (-696.152) (-693.863) (-697.831) -- 0:00:51
      202000 -- (-694.088) (-694.358) (-691.960) [-692.748] * (-693.336) (-694.183) (-691.821) [-695.924] -- 0:00:51
      202500 -- [-692.928] (-692.372) (-694.068) (-691.437) * (-694.415) (-693.773) [-694.093] (-694.282) -- 0:00:51
      203000 -- (-691.750) (-699.291) [-692.377] (-700.283) * (-694.967) (-692.977) [-692.428] (-693.998) -- 0:00:51
      203500 -- (-696.918) [-696.452] (-691.837) (-699.273) * (-696.173) [-693.899] (-691.627) (-694.164) -- 0:00:50
      204000 -- (-694.435) (-695.425) (-691.261) [-699.793] * (-696.971) [-694.189] (-693.651) (-696.332) -- 0:00:54
      204500 -- (-698.212) (-693.781) [-694.298] (-698.158) * (-695.498) (-695.145) (-693.875) [-693.251] -- 0:00:54
      205000 -- (-693.413) (-693.485) [-692.466] (-692.111) * (-691.155) (-694.387) [-693.657] (-691.493) -- 0:00:54

      Average standard deviation of split frequencies: 0.020730

      205500 -- (-698.464) (-691.332) (-695.238) [-694.553] * (-695.379) (-695.225) [-693.339] (-694.034) -- 0:00:54
      206000 -- (-696.966) [-693.304] (-694.765) (-696.810) * (-696.190) [-693.768] (-693.791) (-693.023) -- 0:00:53
      206500 -- [-693.505] (-692.878) (-698.308) (-697.390) * (-698.095) (-693.148) (-695.987) [-694.701] -- 0:00:53
      207000 -- [-696.351] (-691.778) (-695.071) (-694.721) * (-694.759) (-693.448) [-694.488] (-692.113) -- 0:00:53
      207500 -- [-695.871] (-694.124) (-692.755) (-691.473) * (-702.965) [-693.546] (-691.973) (-693.423) -- 0:00:53
      208000 -- (-696.026) (-696.957) [-695.223] (-690.327) * [-699.500] (-692.770) (-692.367) (-695.170) -- 0:00:53
      208500 -- (-696.410) [-695.775] (-696.568) (-695.462) * (-695.121) [-693.402] (-692.981) (-693.823) -- 0:00:53
      209000 -- (-695.611) (-696.086) [-691.166] (-695.466) * (-698.845) [-692.113] (-690.620) (-692.812) -- 0:00:52
      209500 -- (-693.717) (-690.835) [-694.659] (-695.993) * (-698.385) (-694.167) (-702.484) [-694.407] -- 0:00:52
      210000 -- (-697.333) (-692.368) [-695.674] (-695.806) * (-694.286) (-695.443) [-694.408] (-690.655) -- 0:00:52

      Average standard deviation of split frequencies: 0.019218

      210500 -- (-694.639) [-693.476] (-695.775) (-692.649) * (-692.455) (-692.639) (-690.833) [-692.136] -- 0:00:52
      211000 -- (-700.284) (-694.550) [-695.360] (-694.210) * (-695.299) (-693.915) (-693.675) [-696.196] -- 0:00:52
      211500 -- [-695.684] (-692.517) (-690.531) (-693.333) * (-691.921) (-693.657) (-693.611) [-690.976] -- 0:00:52
      212000 -- (-690.876) (-695.642) [-690.254] (-692.941) * (-694.466) (-695.807) [-690.511] (-692.094) -- 0:00:52
      212500 -- (-695.827) (-696.891) [-692.481] (-696.165) * [-694.209] (-691.648) (-693.228) (-692.876) -- 0:00:51
      213000 -- [-694.466] (-695.527) (-692.836) (-696.775) * (-695.852) (-696.044) [-691.760] (-697.003) -- 0:00:51
      213500 -- [-692.872] (-691.346) (-692.014) (-692.641) * [-693.807] (-694.829) (-691.722) (-694.317) -- 0:00:51
      214000 -- (-694.415) (-692.963) [-695.050] (-696.320) * [-691.193] (-694.112) (-695.085) (-693.711) -- 0:00:51
      214500 -- [-695.878] (-691.270) (-692.874) (-691.830) * (-693.900) [-692.769] (-693.416) (-700.139) -- 0:00:51
      215000 -- (-698.243) [-692.358] (-691.750) (-695.422) * (-695.513) (-697.289) [-693.906] (-697.764) -- 0:00:51

      Average standard deviation of split frequencies: 0.018615

      215500 -- (-699.095) (-695.432) (-692.089) [-694.130] * (-693.378) (-689.920) (-693.249) [-692.653] -- 0:00:50
      216000 -- (-695.290) (-693.115) [-695.649] (-691.418) * [-694.294] (-694.574) (-696.346) (-692.713) -- 0:00:50
      216500 -- (-699.801) (-693.555) (-700.056) [-694.012] * [-694.209] (-695.243) (-693.160) (-691.330) -- 0:00:50
      217000 -- (-695.597) [-694.908] (-698.305) (-693.684) * (-692.515) (-702.763) [-693.960] (-696.211) -- 0:00:50
      217500 -- (-691.413) (-693.958) [-692.382] (-691.602) * (-693.745) (-694.547) [-690.914] (-694.941) -- 0:00:50
      218000 -- (-692.459) [-689.913] (-691.459) (-697.903) * (-693.071) [-694.040] (-693.058) (-692.738) -- 0:00:50
      218500 -- (-693.029) (-693.612) [-694.813] (-693.268) * (-693.529) (-693.171) [-693.628] (-692.799) -- 0:00:50
      219000 -- (-693.634) (-695.960) [-694.369] (-691.914) * (-697.050) (-694.735) (-692.109) [-693.941] -- 0:00:49
      219500 -- (-695.479) (-692.910) [-691.474] (-693.012) * (-697.463) (-696.901) (-692.669) [-691.825] -- 0:00:49
      220000 -- (-694.020) [-692.671] (-700.887) (-694.076) * [-692.845] (-696.715) (-693.484) (-701.382) -- 0:00:53

      Average standard deviation of split frequencies: 0.018221

      220500 -- (-697.029) [-691.683] (-697.267) (-696.384) * (-691.993) (-696.890) [-690.531] (-696.842) -- 0:00:53
      221000 -- (-695.137) [-690.780] (-694.631) (-692.155) * [-694.415] (-697.360) (-692.121) (-695.255) -- 0:00:52
      221500 -- (-692.427) [-693.975] (-694.944) (-693.866) * (-694.057) (-696.855) [-692.193] (-693.487) -- 0:00:52
      222000 -- (-697.360) (-691.616) (-693.409) [-691.695] * (-696.502) [-694.685] (-691.847) (-696.431) -- 0:00:52
      222500 -- (-694.545) (-693.386) (-693.539) [-691.716] * (-695.318) (-697.109) (-690.236) [-693.539] -- 0:00:52
      223000 -- (-691.986) [-697.384] (-695.738) (-693.101) * (-692.165) [-694.369] (-691.607) (-696.617) -- 0:00:52
      223500 -- (-695.594) (-693.831) (-692.659) [-695.523] * (-695.332) [-692.161] (-693.387) (-696.962) -- 0:00:52
      224000 -- (-697.113) (-691.018) (-694.714) [-700.102] * [-695.180] (-694.225) (-694.472) (-693.544) -- 0:00:51
      224500 -- (-697.166) (-692.642) [-692.262] (-694.931) * (-696.644) [-693.850] (-692.253) (-694.807) -- 0:00:51
      225000 -- (-692.452) (-694.132) [-695.944] (-694.481) * (-700.530) (-693.185) (-694.908) [-693.472] -- 0:00:51

      Average standard deviation of split frequencies: 0.019141

      225500 -- (-691.956) (-697.806) [-692.491] (-694.546) * (-694.581) [-692.475] (-695.547) (-692.332) -- 0:00:51
      226000 -- (-693.167) (-695.310) [-691.683] (-695.090) * (-697.894) (-692.277) (-695.402) [-693.309] -- 0:00:51
      226500 -- (-694.521) (-691.408) [-695.896] (-698.507) * (-696.680) (-696.521) (-692.587) [-693.446] -- 0:00:51
      227000 -- (-695.813) (-697.544) [-692.251] (-696.936) * [-695.097] (-696.157) (-698.662) (-694.156) -- 0:00:51
      227500 -- [-696.800] (-693.060) (-692.286) (-697.821) * (-692.329) (-692.279) [-690.183] (-694.399) -- 0:00:50
      228000 -- (-693.440) [-692.270] (-696.972) (-697.216) * (-695.298) [-691.250] (-693.430) (-694.896) -- 0:00:50
      228500 -- [-694.145] (-699.836) (-694.706) (-698.696) * [-691.642] (-691.651) (-696.477) (-691.135) -- 0:00:50
      229000 -- (-695.123) [-692.716] (-695.352) (-697.954) * (-694.018) [-695.509] (-694.793) (-700.897) -- 0:00:50
      229500 -- (-697.713) (-693.276) (-692.161) [-692.337] * (-694.337) [-697.142] (-695.023) (-691.686) -- 0:00:50
      230000 -- [-692.654] (-695.328) (-691.571) (-691.806) * [-693.701] (-693.882) (-698.886) (-691.662) -- 0:00:50

      Average standard deviation of split frequencies: 0.017551

      230500 -- [-696.648] (-693.147) (-695.951) (-694.996) * (-698.074) (-696.245) (-693.976) [-691.224] -- 0:00:50
      231000 -- [-691.689] (-694.508) (-692.675) (-691.021) * (-694.675) [-691.678] (-692.790) (-692.692) -- 0:00:49
      231500 -- (-693.691) (-692.424) [-694.821] (-692.046) * (-694.933) (-696.032) (-692.477) [-693.834] -- 0:00:49
      232000 -- (-694.104) (-694.978) (-693.739) [-689.982] * [-691.498] (-695.448) (-692.564) (-690.179) -- 0:00:49
      232500 -- (-699.540) [-690.762] (-694.525) (-693.126) * (-692.489) (-696.139) (-694.167) [-693.686] -- 0:00:49
      233000 -- (-695.327) (-695.412) (-694.192) [-691.356] * (-695.896) (-690.742) (-692.596) [-690.928] -- 0:00:49
      233500 -- (-696.077) (-696.573) [-693.466] (-692.561) * [-695.680] (-691.859) (-695.010) (-693.449) -- 0:00:49
      234000 -- (-693.784) (-695.079) (-693.549) [-692.829] * (-698.366) [-692.644] (-697.135) (-695.535) -- 0:00:49
      234500 -- (-698.049) (-692.966) [-696.204] (-693.163) * (-695.344) (-691.501) [-691.413] (-696.009) -- 0:00:48
      235000 -- (-701.152) [-692.100] (-697.714) (-692.792) * [-695.032] (-694.322) (-693.276) (-692.393) -- 0:00:48

      Average standard deviation of split frequencies: 0.016567

      235500 -- (-698.676) [-693.322] (-696.798) (-692.072) * (-691.057) (-695.597) [-692.565] (-696.421) -- 0:00:51
      236000 -- (-695.379) (-691.261) [-697.437] (-692.524) * [-692.259] (-697.801) (-694.284) (-697.858) -- 0:00:51
      236500 -- (-692.776) [-691.908] (-695.034) (-693.303) * (-694.893) (-694.619) [-689.825] (-694.712) -- 0:00:51
      237000 -- [-695.240] (-692.292) (-696.455) (-693.406) * [-695.844] (-693.850) (-691.529) (-692.840) -- 0:00:51
      237500 -- (-693.115) (-693.368) (-693.578) [-693.584] * (-695.623) (-695.862) [-692.106] (-692.646) -- 0:00:51
      238000 -- (-694.896) (-694.161) (-695.405) [-692.152] * [-694.805] (-697.347) (-698.525) (-694.240) -- 0:00:51
      238500 -- (-692.158) [-691.248] (-695.434) (-692.398) * [-692.963] (-694.825) (-698.555) (-694.749) -- 0:00:51
      239000 -- (-695.313) (-695.604) (-695.559) [-691.745] * (-692.938) [-692.654] (-691.871) (-696.854) -- 0:00:50
      239500 -- (-692.270) (-694.688) [-694.691] (-691.996) * (-698.507) (-697.343) [-693.572] (-695.957) -- 0:00:50
      240000 -- [-693.195] (-695.231) (-693.774) (-695.613) * (-694.503) (-693.496) [-695.109] (-697.258) -- 0:00:50

      Average standard deviation of split frequencies: 0.017168

      240500 -- (-696.101) [-695.501] (-693.693) (-693.536) * (-693.555) (-692.057) (-692.399) [-693.507] -- 0:00:50
      241000 -- (-692.714) (-691.022) (-694.073) [-691.253] * (-694.245) [-693.594] (-693.988) (-693.011) -- 0:00:50
      241500 -- (-692.151) [-693.169] (-697.546) (-694.662) * (-694.948) [-694.208] (-693.581) (-692.064) -- 0:00:50
      242000 -- (-699.946) [-692.325] (-694.144) (-694.332) * (-695.384) (-694.510) (-692.363) [-692.639] -- 0:00:50
      242500 -- (-694.573) [-694.540] (-694.104) (-690.211) * (-697.852) (-695.074) [-694.385] (-697.858) -- 0:00:49
      243000 -- (-694.734) [-691.279] (-697.181) (-693.202) * (-694.110) (-693.366) (-693.308) [-692.208] -- 0:00:49
      243500 -- (-697.854) [-695.655] (-691.617) (-692.171) * (-695.821) (-692.085) (-693.710) [-693.492] -- 0:00:49
      244000 -- (-694.122) [-694.308] (-691.847) (-693.957) * (-697.346) [-693.723] (-692.803) (-692.904) -- 0:00:49
      244500 -- (-694.500) [-692.566] (-699.347) (-695.500) * (-697.096) [-690.629] (-691.529) (-691.192) -- 0:00:49
      245000 -- (-692.139) [-692.647] (-693.275) (-698.489) * (-691.322) (-696.863) (-691.987) [-702.305] -- 0:00:49

      Average standard deviation of split frequencies: 0.018374

      245500 -- (-697.734) [-693.671] (-692.209) (-691.240) * [-693.343] (-691.980) (-696.075) (-699.194) -- 0:00:49
      246000 -- [-692.785] (-695.325) (-694.163) (-692.670) * (-693.643) (-701.321) [-694.948] (-699.244) -- 0:00:49
      246500 -- (-693.322) (-691.203) [-692.404] (-691.267) * (-694.371) [-692.492] (-693.713) (-696.083) -- 0:00:48
      247000 -- (-698.949) (-694.883) [-694.825] (-693.355) * (-693.422) (-693.926) [-695.996] (-695.875) -- 0:00:48
      247500 -- [-698.330] (-690.885) (-696.674) (-691.010) * (-693.854) (-695.141) [-694.893] (-698.030) -- 0:00:48
      248000 -- (-696.297) (-692.587) (-694.789) [-691.889] * [-692.690] (-691.695) (-692.018) (-695.049) -- 0:00:48
      248500 -- (-696.081) [-691.493] (-697.766) (-693.143) * (-692.552) [-694.615] (-697.736) (-693.903) -- 0:00:48
      249000 -- [-694.681] (-695.662) (-696.220) (-693.682) * [-693.430] (-696.959) (-693.941) (-694.238) -- 0:00:48
      249500 -- [-691.364] (-692.821) (-692.218) (-690.976) * (-695.437) [-697.106] (-691.022) (-695.686) -- 0:00:48
      250000 -- [-691.965] (-691.750) (-694.371) (-696.205) * (-696.760) [-692.062] (-694.251) (-696.447) -- 0:00:48

      Average standard deviation of split frequencies: 0.017921

      250500 -- (-692.473) [-690.309] (-691.522) (-698.783) * (-696.598) (-694.305) [-691.522] (-694.960) -- 0:00:47
      251000 -- (-692.680) (-692.212) [-691.791] (-694.049) * (-695.829) (-692.814) (-690.586) [-692.010] -- 0:00:50
      251500 -- (-692.208) [-696.453] (-696.240) (-694.233) * (-695.201) [-694.636] (-692.624) (-693.282) -- 0:00:50
      252000 -- (-693.302) (-693.564) [-691.253] (-696.312) * (-695.445) (-695.676) (-695.368) [-691.602] -- 0:00:50
      252500 -- (-698.125) (-692.671) [-691.769] (-692.446) * (-692.610) (-690.874) (-693.498) [-698.708] -- 0:00:50
      253000 -- (-693.463) [-693.209] (-691.862) (-693.596) * (-691.746) (-694.909) (-694.731) [-694.651] -- 0:00:50
      253500 -- [-692.946] (-696.160) (-702.097) (-691.047) * (-694.029) (-693.138) (-693.958) [-693.517] -- 0:00:50
      254000 -- [-692.781] (-692.686) (-692.241) (-692.709) * [-692.733] (-698.403) (-691.604) (-693.496) -- 0:00:49
      254500 -- (-693.793) (-694.410) (-690.523) [-692.341] * (-697.049) [-693.981] (-694.194) (-698.504) -- 0:00:49
      255000 -- (-690.906) (-692.359) [-693.588] (-695.630) * (-692.310) [-694.238] (-692.343) (-695.744) -- 0:00:49

      Average standard deviation of split frequencies: 0.016248

      255500 -- (-693.009) [-691.572] (-692.900) (-695.106) * (-694.395) [-692.115] (-694.561) (-694.267) -- 0:00:49
      256000 -- (-691.198) [-692.437] (-691.805) (-695.115) * [-692.457] (-693.281) (-695.177) (-694.025) -- 0:00:49
      256500 -- [-691.007] (-693.906) (-692.458) (-695.407) * (-695.020) [-693.999] (-691.912) (-691.068) -- 0:00:49
      257000 -- (-692.095) (-695.916) (-695.408) [-694.383] * (-695.765) (-691.980) [-695.962] (-698.094) -- 0:00:49
      257500 -- (-693.359) [-698.005] (-692.595) (-696.477) * [-691.902] (-695.699) (-694.613) (-696.637) -- 0:00:49
      258000 -- (-692.694) [-695.872] (-693.399) (-694.550) * (-695.207) (-693.978) (-694.158) [-694.289] -- 0:00:48
      258500 -- [-692.831] (-697.280) (-694.662) (-695.505) * [-694.091] (-692.161) (-698.085) (-693.856) -- 0:00:48
      259000 -- [-693.835] (-698.568) (-693.077) (-691.892) * (-697.287) (-692.972) (-708.415) [-694.925] -- 0:00:48
      259500 -- [-696.011] (-698.050) (-693.054) (-697.708) * (-696.537) [-690.989] (-699.754) (-693.953) -- 0:00:48
      260000 -- (-695.021) (-693.187) [-693.284] (-694.269) * (-695.089) [-692.231] (-693.183) (-691.797) -- 0:00:48

      Average standard deviation of split frequencies: 0.016063

      260500 -- [-691.210] (-694.356) (-694.685) (-693.703) * (-695.746) (-696.106) [-696.137] (-691.411) -- 0:00:48
      261000 -- (-695.199) (-695.555) [-695.141] (-693.509) * (-697.255) (-693.387) [-696.421] (-691.434) -- 0:00:48
      261500 -- (-695.161) (-697.599) (-694.180) [-695.866] * (-699.564) (-693.956) [-691.950] (-693.023) -- 0:00:48
      262000 -- (-697.785) (-693.287) (-692.657) [-692.140] * (-694.727) [-693.562] (-693.416) (-694.174) -- 0:00:47
      262500 -- [-691.809] (-694.370) (-693.761) (-693.288) * (-705.054) (-694.351) [-693.583] (-694.567) -- 0:00:47
      263000 -- (-691.949) (-695.338) (-695.496) [-697.642] * (-697.755) (-693.439) (-693.856) [-694.239] -- 0:00:47
      263500 -- (-694.862) (-700.009) (-696.033) [-693.177] * (-695.217) [-694.445] (-696.657) (-693.197) -- 0:00:47
      264000 -- [-692.096] (-693.061) (-692.601) (-693.728) * (-693.663) (-691.386) (-693.371) [-696.496] -- 0:00:47
      264500 -- (-690.675) (-698.733) (-694.703) [-693.943] * (-691.916) (-695.031) [-693.126] (-693.891) -- 0:00:47
      265000 -- (-692.374) [-692.293] (-694.393) (-694.440) * (-694.514) (-694.776) (-695.957) [-693.892] -- 0:00:47

      Average standard deviation of split frequencies: 0.016263

      265500 -- (-695.977) [-697.785] (-692.922) (-695.857) * (-695.530) (-692.870) (-691.646) [-694.625] -- 0:00:47
      266000 -- (-695.295) (-693.742) (-695.301) [-693.648] * (-694.030) (-693.159) (-695.268) [-694.715] -- 0:00:46
      266500 -- (-693.019) (-697.497) (-696.003) [-692.797] * (-691.902) [-696.010] (-695.071) (-695.573) -- 0:00:49
      267000 -- (-692.041) (-693.563) [-692.273] (-692.818) * (-694.970) [-693.813] (-694.323) (-695.004) -- 0:00:49
      267500 -- (-689.691) [-694.657] (-694.929) (-693.753) * (-696.312) [-694.335] (-694.961) (-692.807) -- 0:00:49
      268000 -- [-692.906] (-694.793) (-693.805) (-690.936) * (-694.624) (-695.947) (-694.449) [-693.973] -- 0:00:49
      268500 -- (-695.412) [-693.755] (-694.637) (-695.400) * (-695.852) (-693.489) (-695.885) [-693.047] -- 0:00:49
      269000 -- [-692.511] (-694.939) (-694.470) (-695.089) * (-695.317) (-697.203) [-693.046] (-694.697) -- 0:00:48
      269500 -- (-694.200) (-695.506) (-696.255) [-691.984] * (-693.487) (-695.678) [-692.474] (-693.485) -- 0:00:48
      270000 -- (-691.181) (-695.723) (-694.667) [-691.290] * [-692.543] (-694.922) (-692.889) (-694.319) -- 0:00:48

      Average standard deviation of split frequencies: 0.016654

      270500 -- (-691.386) (-695.587) [-696.942] (-692.853) * (-699.230) (-695.018) [-696.038] (-692.579) -- 0:00:48
      271000 -- [-691.960] (-697.013) (-695.305) (-695.393) * (-697.038) (-692.067) (-693.285) [-694.069] -- 0:00:48
      271500 -- (-693.715) (-694.220) (-698.687) [-695.814] * (-696.868) [-693.462] (-695.705) (-691.353) -- 0:00:48
      272000 -- (-692.224) (-696.722) [-694.170] (-693.430) * [-690.958] (-695.723) (-694.752) (-692.356) -- 0:00:48
      272500 -- [-693.567] (-696.190) (-691.629) (-698.101) * [-696.711] (-695.811) (-698.965) (-695.846) -- 0:00:48
      273000 -- (-693.601) (-694.352) (-694.963) [-691.797] * [-697.916] (-698.531) (-699.257) (-695.160) -- 0:00:47
      273500 -- (-690.461) (-696.937) (-694.452) [-697.765] * (-696.807) (-697.926) (-690.829) [-691.495] -- 0:00:47
      274000 -- (-692.185) (-696.214) [-691.302] (-693.752) * (-699.515) (-695.552) (-693.479) [-690.957] -- 0:00:47
      274500 -- [-692.062] (-696.937) (-694.029) (-692.444) * (-696.883) (-694.849) [-694.538] (-695.026) -- 0:00:47
      275000 -- (-692.796) (-700.794) (-693.436) [-693.636] * (-696.275) (-695.181) (-693.958) [-692.474] -- 0:00:47

      Average standard deviation of split frequencies: 0.017381

      275500 -- [-693.187] (-698.795) (-692.372) (-693.352) * (-696.045) (-695.410) [-693.920] (-693.731) -- 0:00:47
      276000 -- (-692.522) (-696.711) [-692.011] (-692.625) * (-692.650) (-694.241) (-694.562) [-694.311] -- 0:00:47
      276500 -- (-695.214) (-695.017) (-695.427) [-690.865] * (-694.065) [-693.846] (-694.142) (-690.820) -- 0:00:47
      277000 -- [-691.794] (-695.676) (-692.197) (-694.449) * (-698.486) (-692.325) [-696.428] (-690.895) -- 0:00:46
      277500 -- (-692.798) (-699.577) [-691.274] (-695.599) * (-697.091) [-691.229] (-694.381) (-695.192) -- 0:00:46
      278000 -- (-694.506) [-697.028] (-695.790) (-700.514) * (-696.084) (-699.823) (-696.721) [-694.925] -- 0:00:46
      278500 -- (-694.075) (-696.618) [-692.131] (-695.589) * (-696.526) (-696.829) [-693.910] (-692.875) -- 0:00:46
      279000 -- (-699.516) (-696.987) [-694.172] (-697.208) * (-698.180) [-693.561] (-695.334) (-697.724) -- 0:00:46
      279500 -- [-693.399] (-693.387) (-693.468) (-695.693) * [-693.643] (-695.608) (-695.722) (-695.368) -- 0:00:46
      280000 -- (-691.634) (-693.825) (-691.189) [-695.307] * [-691.898] (-697.475) (-694.531) (-693.146) -- 0:00:46

      Average standard deviation of split frequencies: 0.017883

      280500 -- [-691.737] (-696.999) (-692.838) (-694.558) * (-692.451) [-695.127] (-692.822) (-700.188) -- 0:00:46
      281000 -- (-693.297) (-694.363) [-693.668] (-692.420) * (-696.145) (-699.539) (-693.130) [-693.971] -- 0:00:46
      281500 -- [-696.645] (-695.359) (-694.772) (-693.701) * (-694.986) [-695.327] (-695.328) (-692.211) -- 0:00:45
      282000 -- (-698.012) [-695.977] (-695.143) (-694.419) * (-694.510) (-695.419) (-693.094) [-693.038] -- 0:00:48
      282500 -- [-697.005] (-696.379) (-695.769) (-691.218) * (-694.327) (-693.910) [-694.411] (-694.585) -- 0:00:48
      283000 -- (-693.356) (-696.601) [-695.507] (-691.081) * (-698.289) (-695.688) [-694.227] (-693.540) -- 0:00:48
      283500 -- [-692.347] (-693.975) (-696.218) (-694.618) * (-703.294) (-692.810) (-695.411) [-694.689] -- 0:00:48
      284000 -- (-692.832) (-693.863) [-693.548] (-692.575) * [-696.978] (-692.993) (-695.397) (-693.613) -- 0:00:47
      284500 -- [-693.989] (-692.335) (-690.383) (-691.517) * (-695.930) (-692.424) (-697.004) [-690.822] -- 0:00:47
      285000 -- (-692.989) (-692.755) (-693.656) [-690.597] * (-695.171) [-693.371] (-697.506) (-693.025) -- 0:00:47

      Average standard deviation of split frequencies: 0.018228

      285500 -- (-691.897) [-692.761] (-693.909) (-693.840) * (-694.709) (-696.851) (-695.367) [-694.067] -- 0:00:47
      286000 -- [-694.567] (-692.010) (-696.294) (-695.823) * (-694.810) [-693.721] (-694.368) (-695.084) -- 0:00:47
      286500 -- (-691.183) (-699.043) [-696.634] (-694.275) * (-696.039) [-695.129] (-698.638) (-694.167) -- 0:00:47
      287000 -- [-694.770] (-693.878) (-692.848) (-694.191) * (-693.590) (-694.769) (-696.017) [-692.349] -- 0:00:47
      287500 -- (-692.650) [-691.664] (-696.877) (-696.262) * (-694.390) (-695.836) (-694.849) [-694.345] -- 0:00:47
      288000 -- (-692.612) (-696.174) (-696.081) [-690.056] * [-693.810] (-692.968) (-695.498) (-693.932) -- 0:00:46
      288500 -- [-691.937] (-693.124) (-698.986) (-694.161) * (-692.214) (-698.415) (-696.068) [-692.241] -- 0:00:46
      289000 -- (-693.910) (-691.545) (-696.103) [-693.109] * [-694.267] (-691.244) (-702.290) (-696.029) -- 0:00:46
      289500 -- (-692.546) [-693.148] (-695.087) (-693.845) * (-697.186) (-695.045) (-698.777) [-695.634] -- 0:00:46
      290000 -- (-693.770) (-697.437) (-693.508) [-693.003] * (-693.356) [-695.722] (-698.405) (-698.614) -- 0:00:46

      Average standard deviation of split frequencies: 0.017077

      290500 -- (-698.018) (-697.493) (-691.560) [-692.745] * (-694.031) (-694.652) [-694.243] (-696.621) -- 0:00:46
      291000 -- (-696.657) (-694.329) [-693.537] (-696.129) * [-694.138] (-694.684) (-698.277) (-694.380) -- 0:00:46
      291500 -- (-692.783) (-697.502) (-699.131) [-693.248] * (-692.932) (-696.145) (-694.993) [-693.981] -- 0:00:46
      292000 -- (-693.794) [-694.670] (-702.075) (-694.522) * (-695.453) (-692.837) (-694.899) [-694.950] -- 0:00:46
      292500 -- (-693.842) [-692.001] (-692.324) (-693.919) * (-691.345) (-696.622) (-695.134) [-694.831] -- 0:00:45
      293000 -- [-695.608] (-695.883) (-693.355) (-691.968) * (-691.394) [-693.690] (-697.032) (-697.509) -- 0:00:45
      293500 -- (-695.108) (-691.598) [-699.631] (-695.645) * (-694.183) (-696.332) (-699.135) [-693.824] -- 0:00:45
      294000 -- [-697.451] (-695.029) (-696.078) (-692.862) * (-694.212) [-692.464] (-696.252) (-692.839) -- 0:00:45
      294500 -- (-698.878) (-694.254) (-697.247) [-691.241] * (-693.963) [-692.456] (-692.128) (-698.292) -- 0:00:45
      295000 -- (-694.422) (-693.133) [-700.256] (-694.937) * (-692.276) [-694.084] (-699.461) (-694.756) -- 0:00:45

      Average standard deviation of split frequencies: 0.016488

      295500 -- [-694.103] (-694.080) (-698.177) (-693.730) * [-693.470] (-693.127) (-705.650) (-701.264) -- 0:00:45
      296000 -- (-697.220) (-693.347) (-691.551) [-691.347] * (-696.076) (-693.962) [-696.772] (-696.768) -- 0:00:45
      296500 -- (-695.290) [-695.982] (-692.685) (-693.414) * [-692.446] (-692.962) (-694.643) (-698.813) -- 0:00:45
      297000 -- (-699.045) [-695.880] (-692.203) (-695.020) * (-693.160) (-697.279) [-694.444] (-694.271) -- 0:00:44
      297500 -- (-696.349) [-695.557] (-692.329) (-694.895) * (-692.895) [-695.481] (-694.037) (-695.653) -- 0:00:47
      298000 -- (-698.474) (-696.060) (-694.088) [-694.500] * (-695.629) (-690.805) (-694.169) [-693.913] -- 0:00:47
      298500 -- (-694.976) [-695.986] (-694.405) (-694.551) * [-690.383] (-693.840) (-695.601) (-695.084) -- 0:00:47
      299000 -- (-698.514) (-694.795) (-693.141) [-690.865] * [-694.116] (-694.961) (-696.506) (-695.483) -- 0:00:46
      299500 -- [-693.919] (-694.937) (-696.376) (-695.756) * [-692.740] (-693.067) (-694.522) (-694.631) -- 0:00:46
      300000 -- (-693.318) (-705.267) [-692.268] (-693.155) * (-691.795) (-694.504) (-690.917) [-695.688] -- 0:00:46

      Average standard deviation of split frequencies: 0.015955

      300500 -- (-693.213) (-702.556) [-692.879] (-692.505) * [-694.330] (-694.905) (-694.324) (-695.595) -- 0:00:46
      301000 -- (-693.774) (-701.996) (-692.128) [-695.228] * [-695.377] (-690.436) (-695.148) (-696.267) -- 0:00:46
      301500 -- (-693.513) (-695.428) [-696.539] (-691.353) * (-693.537) (-693.313) (-693.304) [-691.874] -- 0:00:46
      302000 -- (-700.438) [-693.563] (-694.729) (-693.345) * [-693.744] (-694.130) (-694.404) (-695.498) -- 0:00:46
      302500 -- (-693.294) [-692.574] (-694.161) (-692.991) * (-695.872) [-692.400] (-697.503) (-692.310) -- 0:00:46
      303000 -- [-691.947] (-692.733) (-697.018) (-696.561) * (-697.615) [-693.646] (-696.744) (-692.181) -- 0:00:46
      303500 -- [-698.953] (-692.553) (-696.100) (-693.236) * (-693.824) (-692.345) [-697.079] (-692.428) -- 0:00:45
      304000 -- (-695.393) (-691.755) (-700.425) [-695.226] * (-692.905) (-692.104) (-691.956) [-693.280] -- 0:00:45
      304500 -- (-695.156) (-696.139) [-694.353] (-692.364) * (-693.801) (-695.160) [-693.881] (-696.096) -- 0:00:45
      305000 -- (-693.748) (-693.640) [-693.434] (-693.666) * (-695.030) (-696.224) [-692.271] (-691.226) -- 0:00:45

      Average standard deviation of split frequencies: 0.015949

      305500 -- (-693.491) (-696.547) (-694.094) [-691.068] * (-694.640) (-700.843) [-692.479] (-693.376) -- 0:00:45
      306000 -- [-696.707] (-691.717) (-692.543) (-692.314) * (-692.971) (-699.946) [-691.469] (-699.851) -- 0:00:45
      306500 -- (-694.212) [-694.231] (-694.163) (-693.808) * (-695.054) (-697.454) [-695.343] (-692.881) -- 0:00:45
      307000 -- (-692.752) (-700.813) [-695.284] (-693.641) * (-695.285) (-691.457) [-693.135] (-694.603) -- 0:00:45
      307500 -- (-694.175) (-696.043) [-694.676] (-695.554) * (-694.963) [-694.108] (-692.500) (-691.970) -- 0:00:45
      308000 -- (-692.078) [-697.560] (-695.174) (-693.213) * (-693.539) [-696.129] (-698.291) (-692.529) -- 0:00:44
      308500 -- [-694.231] (-694.307) (-692.829) (-696.758) * (-694.056) (-694.682) [-694.338] (-693.778) -- 0:00:44
      309000 -- (-694.789) [-690.651] (-692.239) (-692.442) * [-693.669] (-692.174) (-692.894) (-696.361) -- 0:00:44
      309500 -- (-694.996) [-692.590] (-694.175) (-695.555) * (-693.762) (-695.590) [-693.245] (-691.407) -- 0:00:44
      310000 -- (-696.872) (-694.455) [-692.240] (-696.368) * (-694.937) (-698.613) (-694.749) [-691.996] -- 0:00:44

      Average standard deviation of split frequencies: 0.015531

      310500 -- [-692.342] (-700.285) (-692.331) (-692.543) * (-696.355) (-696.606) [-693.399] (-691.408) -- 0:00:44
      311000 -- [-692.592] (-692.736) (-693.997) (-695.195) * [-695.802] (-692.910) (-693.410) (-693.119) -- 0:00:44
      311500 -- [-695.253] (-698.666) (-698.083) (-695.610) * (-695.165) [-693.610] (-690.610) (-692.660) -- 0:00:44
      312000 -- (-695.477) (-691.927) (-695.815) [-693.679] * (-694.907) (-696.263) [-692.848] (-692.610) -- 0:00:44
      312500 -- (-694.719) [-693.184] (-695.626) (-696.411) * (-694.767) (-692.825) [-690.774] (-692.714) -- 0:00:46
      313000 -- (-692.124) [-691.057] (-699.009) (-694.304) * (-694.192) (-698.525) (-693.933) [-693.194] -- 0:00:46
      313500 -- [-693.273] (-694.640) (-694.932) (-696.487) * (-703.302) (-692.255) [-693.026] (-693.903) -- 0:00:45
      314000 -- (-695.130) (-696.358) [-691.479] (-694.811) * (-699.159) (-692.741) [-692.232] (-695.270) -- 0:00:45
      314500 -- [-692.966] (-692.501) (-693.325) (-695.201) * (-692.396) (-695.128) [-693.662] (-694.900) -- 0:00:45
      315000 -- (-696.561) [-691.014] (-697.269) (-695.090) * [-695.112] (-691.618) (-690.742) (-693.347) -- 0:00:45

      Average standard deviation of split frequencies: 0.015001

      315500 -- (-695.011) [-691.131] (-694.228) (-694.619) * (-693.655) (-693.116) [-691.132] (-692.706) -- 0:00:45
      316000 -- (-691.120) [-691.962] (-696.032) (-692.494) * (-696.145) (-695.492) (-696.425) [-690.880] -- 0:00:45
      316500 -- (-691.121) [-692.923] (-698.071) (-693.678) * (-697.708) (-692.857) (-696.166) [-692.571] -- 0:00:45
      317000 -- [-696.086] (-694.447) (-699.367) (-693.952) * [-692.297] (-692.817) (-696.128) (-694.703) -- 0:00:45
      317500 -- (-694.471) (-691.258) (-691.787) [-694.620] * [-693.093] (-691.572) (-692.509) (-693.828) -- 0:00:45
      318000 -- (-695.583) (-694.319) (-693.301) [-694.247] * (-693.900) (-691.605) [-693.412] (-690.454) -- 0:00:45
      318500 -- (-693.947) [-692.410] (-698.450) (-695.115) * [-693.893] (-693.621) (-693.912) (-695.999) -- 0:00:44
      319000 -- (-698.553) [-692.949] (-692.819) (-694.676) * [-693.730] (-691.329) (-691.569) (-693.594) -- 0:00:44
      319500 -- (-695.442) (-692.060) (-696.752) [-695.988] * (-693.653) (-694.246) (-693.642) [-691.590] -- 0:00:44
      320000 -- (-692.004) [-692.955] (-692.943) (-695.926) * [-691.692] (-691.794) (-692.198) (-697.006) -- 0:00:44

      Average standard deviation of split frequencies: 0.014182

      320500 -- (-692.681) (-692.477) [-693.714] (-695.959) * (-696.480) [-693.118] (-691.710) (-696.930) -- 0:00:44
      321000 -- [-692.891] (-692.221) (-694.786) (-695.231) * [-696.880] (-693.577) (-692.642) (-695.067) -- 0:00:44
      321500 -- [-694.981] (-697.907) (-697.183) (-693.275) * (-691.436) (-693.160) [-691.813] (-693.203) -- 0:00:44
      322000 -- (-695.126) (-692.349) (-694.447) [-697.544] * [-691.514] (-696.582) (-691.599) (-693.586) -- 0:00:44
      322500 -- (-692.340) (-695.565) (-699.147) [-693.110] * [-693.085] (-693.349) (-696.172) (-693.985) -- 0:00:44
      323000 -- [-693.669] (-694.024) (-695.925) (-692.151) * (-693.101) (-694.898) (-692.222) [-693.982] -- 0:00:44
      323500 -- (-697.278) (-695.347) (-693.392) [-695.194] * (-694.013) (-698.105) [-691.478] (-692.396) -- 0:00:43
      324000 -- (-695.033) (-697.275) (-695.734) [-695.362] * [-692.618] (-691.930) (-692.766) (-693.457) -- 0:00:43
      324500 -- (-695.287) (-694.819) (-694.913) [-693.085] * [-690.975] (-692.722) (-692.623) (-692.062) -- 0:00:43
      325000 -- (-692.842) (-698.066) [-691.629] (-693.911) * [-694.370] (-698.512) (-697.761) (-693.469) -- 0:00:43

      Average standard deviation of split frequencies: 0.013737

      325500 -- (-692.745) (-694.923) (-692.099) [-693.931] * (-693.090) (-697.344) (-692.763) [-691.147] -- 0:00:43
      326000 -- (-693.987) (-695.960) [-693.975] (-692.144) * [-693.989] (-694.164) (-695.890) (-701.175) -- 0:00:43
      326500 -- (-694.746) (-698.336) [-695.195] (-692.261) * (-690.765) [-693.377] (-692.243) (-693.225) -- 0:00:43
      327000 -- (-695.342) (-691.093) (-695.174) [-693.129] * [-692.114] (-692.571) (-697.989) (-692.358) -- 0:00:43
      327500 -- (-694.259) (-692.397) (-695.225) [-695.810] * (-692.121) [-691.614] (-696.477) (-692.710) -- 0:00:43
      328000 -- [-694.346] (-691.570) (-694.374) (-692.488) * (-694.776) (-692.720) (-696.213) [-692.153] -- 0:00:45
      328500 -- (-698.061) [-697.680] (-696.667) (-694.638) * (-692.772) (-695.169) (-694.858) [-693.226] -- 0:00:44
      329000 -- (-696.091) (-692.875) (-695.323) [-693.869] * [-692.718] (-696.683) (-691.921) (-693.433) -- 0:00:44
      329500 -- (-693.153) [-692.774] (-693.292) (-703.316) * (-692.229) (-694.875) (-691.838) [-693.228] -- 0:00:44
      330000 -- (-691.890) (-693.272) [-696.831] (-694.524) * [-690.323] (-694.455) (-697.386) (-702.503) -- 0:00:44

      Average standard deviation of split frequencies: 0.014088

      330500 -- (-694.061) (-692.752) [-696.455] (-691.777) * (-692.926) (-695.091) (-700.632) [-696.289] -- 0:00:44
      331000 -- (-694.082) (-694.486) (-694.579) [-696.657] * (-692.016) (-693.558) [-696.906] (-690.689) -- 0:00:44
      331500 -- (-694.711) (-691.820) [-693.297] (-694.811) * [-692.342] (-695.187) (-693.578) (-694.126) -- 0:00:44
      332000 -- (-695.840) (-691.856) [-693.324] (-693.980) * (-691.223) [-693.246] (-693.442) (-694.875) -- 0:00:44
      332500 -- (-691.521) (-692.900) [-698.080] (-693.890) * (-691.806) [-692.878] (-692.807) (-690.759) -- 0:00:44
      333000 -- [-693.822] (-692.984) (-696.758) (-692.239) * [-696.694] (-694.418) (-696.493) (-697.098) -- 0:00:44
      333500 -- (-692.177) (-693.525) (-694.994) [-694.007] * [-692.933] (-693.627) (-695.826) (-696.435) -- 0:00:43
      334000 -- [-693.381] (-690.938) (-696.528) (-692.922) * [-693.966] (-703.735) (-690.435) (-697.955) -- 0:00:43
      334500 -- (-694.776) (-691.576) [-694.595] (-694.128) * [-693.330] (-691.036) (-692.640) (-695.938) -- 0:00:43
      335000 -- (-693.526) [-694.021] (-695.294) (-695.417) * [-693.128] (-698.447) (-696.718) (-697.795) -- 0:00:43

      Average standard deviation of split frequencies: 0.014030

      335500 -- (-693.057) (-691.786) (-691.853) [-693.344] * [-697.764] (-692.314) (-692.360) (-692.441) -- 0:00:43
      336000 -- (-691.403) [-693.417] (-692.959) (-691.745) * (-697.114) (-697.230) (-693.713) [-694.788] -- 0:00:43
      336500 -- (-691.590) (-693.529) (-692.347) [-693.107] * (-694.354) [-693.749] (-693.278) (-699.100) -- 0:00:43
      337000 -- (-696.941) (-692.561) [-692.144] (-697.603) * (-690.625) (-697.564) (-692.322) [-695.594] -- 0:00:43
      337500 -- (-698.324) [-693.775] (-698.674) (-698.100) * (-696.179) [-696.207] (-693.737) (-695.720) -- 0:00:43
      338000 -- (-693.413) [-691.052] (-696.554) (-695.364) * (-692.299) (-692.122) (-696.397) [-692.684] -- 0:00:43
      338500 -- (-692.966) [-692.204] (-696.383) (-694.811) * (-692.985) (-696.047) [-696.196] (-694.786) -- 0:00:42
      339000 -- [-693.622] (-696.469) (-696.495) (-695.384) * (-695.442) (-693.054) (-694.912) [-693.933] -- 0:00:42
      339500 -- [-695.902] (-693.909) (-695.663) (-696.859) * (-691.174) (-695.530) (-691.425) [-694.039] -- 0:00:42
      340000 -- (-693.042) (-694.951) (-693.121) [-695.519] * (-694.789) [-694.432] (-693.341) (-694.363) -- 0:00:42

      Average standard deviation of split frequencies: 0.014376

      340500 -- (-694.268) (-694.169) (-690.791) [-698.211] * (-695.345) [-694.665] (-691.855) (-694.042) -- 0:00:42
      341000 -- (-693.787) (-696.658) (-697.638) [-693.870] * (-695.295) [-692.133] (-692.759) (-699.825) -- 0:00:42
      341500 -- (-694.015) (-691.165) (-693.869) [-694.324] * [-694.327] (-694.350) (-695.509) (-698.274) -- 0:00:42
      342000 -- (-696.548) (-692.568) [-691.808] (-697.408) * [-693.068] (-693.440) (-698.477) (-695.208) -- 0:00:42
      342500 -- [-694.772] (-693.642) (-692.589) (-704.145) * (-693.064) [-693.027] (-691.344) (-691.251) -- 0:00:42
      343000 -- (-694.912) (-693.091) [-694.047] (-705.209) * (-693.017) (-694.033) [-691.147] (-694.596) -- 0:00:44
      343500 -- [-697.104] (-692.227) (-698.890) (-696.990) * (-691.337) (-693.654) (-692.660) [-693.618] -- 0:00:43
      344000 -- (-692.823) [-692.453] (-694.156) (-697.518) * (-691.798) (-694.784) (-697.575) [-696.207] -- 0:00:43
      344500 -- (-695.506) (-694.203) [-692.552] (-695.359) * (-692.492) [-697.527] (-694.167) (-691.698) -- 0:00:43
      345000 -- (-698.347) (-691.424) [-691.538] (-696.118) * (-693.425) (-692.794) (-693.368) [-692.394] -- 0:00:43

      Average standard deviation of split frequencies: 0.014760

      345500 -- [-695.463] (-695.230) (-692.972) (-696.831) * (-693.541) (-692.245) (-693.241) [-690.467] -- 0:00:43
      346000 -- (-694.262) [-693.949] (-694.664) (-694.227) * (-693.391) (-695.433) (-694.370) [-692.464] -- 0:00:43
      346500 -- (-704.302) [-693.138] (-696.472) (-693.055) * (-696.034) (-693.458) [-691.937] (-694.862) -- 0:00:43
      347000 -- (-704.740) [-695.690] (-693.308) (-697.477) * (-697.150) (-693.981) [-691.664] (-693.618) -- 0:00:43
      347500 -- (-700.539) [-695.209] (-696.486) (-694.060) * (-693.405) [-696.241] (-691.973) (-695.437) -- 0:00:43
      348000 -- (-698.139) (-698.247) (-698.278) [-695.376] * [-692.843] (-693.421) (-692.693) (-695.177) -- 0:00:43
      348500 -- [-693.895] (-693.801) (-698.378) (-696.402) * (-689.362) (-695.711) (-694.093) [-690.297] -- 0:00:42
      349000 -- (-695.147) (-695.471) (-698.426) [-696.050] * (-697.614) (-693.945) (-693.858) [-691.250] -- 0:00:42
      349500 -- (-694.580) [-694.666] (-693.526) (-694.435) * (-697.447) [-694.155] (-692.155) (-694.297) -- 0:00:42
      350000 -- [-691.821] (-693.089) (-694.189) (-691.634) * [-697.742] (-692.394) (-692.751) (-694.709) -- 0:00:42

      Average standard deviation of split frequencies: 0.014787

      350500 -- (-693.050) (-693.810) (-691.892) [-694.519] * [-693.508] (-694.507) (-691.527) (-696.752) -- 0:00:42
      351000 -- (-692.903) (-691.706) (-692.211) [-696.138] * (-692.858) (-692.470) (-694.730) [-697.260] -- 0:00:42
      351500 -- (-695.291) (-691.629) (-692.619) [-694.695] * [-693.478] (-692.476) (-694.131) (-693.117) -- 0:00:42
      352000 -- (-698.068) [-694.105] (-696.047) (-693.711) * (-691.763) [-695.541] (-691.756) (-695.086) -- 0:00:42
      352500 -- (-697.343) [-694.661] (-693.450) (-694.787) * (-695.618) (-694.438) [-692.441] (-693.312) -- 0:00:42
      353000 -- (-693.631) (-693.487) (-692.886) [-691.649] * [-693.225] (-693.105) (-692.327) (-691.157) -- 0:00:42
      353500 -- (-695.487) (-695.057) (-694.466) [-692.975] * (-692.516) (-695.594) (-691.598) [-692.271] -- 0:00:42
      354000 -- (-700.807) (-693.676) [-695.393] (-693.259) * (-696.371) [-693.093] (-692.557) (-692.894) -- 0:00:41
      354500 -- [-693.256] (-694.325) (-697.954) (-694.588) * (-692.262) (-693.768) (-692.693) [-690.312] -- 0:00:41
      355000 -- (-694.747) [-699.326] (-698.876) (-693.716) * (-691.434) (-695.149) (-692.055) [-696.951] -- 0:00:41

      Average standard deviation of split frequencies: 0.015154

      355500 -- [-695.206] (-693.973) (-697.019) (-694.753) * (-692.060) [-695.645] (-693.906) (-694.496) -- 0:00:41
      356000 -- (-695.628) (-692.645) (-694.586) [-695.787] * (-696.973) (-693.776) [-692.346] (-696.152) -- 0:00:41
      356500 -- [-695.375] (-695.021) (-697.909) (-693.965) * (-698.831) (-692.729) [-693.682] (-693.050) -- 0:00:41
      357000 -- [-696.120] (-691.883) (-694.362) (-694.596) * (-694.725) (-691.205) [-691.607] (-698.379) -- 0:00:41
      357500 -- (-691.863) [-692.639] (-695.001) (-694.967) * (-693.422) (-690.771) (-695.709) [-695.017] -- 0:00:41
      358000 -- (-694.071) [-693.742] (-697.185) (-693.858) * (-693.212) [-695.031] (-691.197) (-693.366) -- 0:00:43
      358500 -- (-694.368) [-691.960] (-692.317) (-700.807) * (-696.914) [-694.768] (-693.738) (-694.715) -- 0:00:42
      359000 -- (-701.013) [-691.985] (-691.931) (-693.937) * (-695.934) (-695.925) (-696.372) [-696.065] -- 0:00:42
      359500 -- (-693.097) (-692.248) (-696.454) [-692.940] * (-695.907) [-691.990] (-691.041) (-697.324) -- 0:00:42
      360000 -- (-699.103) (-692.943) [-694.803] (-693.774) * (-696.685) (-695.804) [-692.153] (-693.742) -- 0:00:42

      Average standard deviation of split frequencies: 0.014147

      360500 -- (-695.002) [-696.819] (-694.709) (-694.790) * (-693.856) (-694.360) [-693.193] (-695.794) -- 0:00:42
      361000 -- (-696.515) (-695.480) (-694.101) [-693.679] * (-693.658) [-693.791] (-699.213) (-691.189) -- 0:00:42
      361500 -- (-697.068) (-696.616) (-692.230) [-696.843] * (-692.525) (-694.831) [-690.034] (-692.184) -- 0:00:42
      362000 -- (-699.566) (-692.188) [-690.371] (-693.518) * (-693.213) [-693.983] (-697.330) (-701.128) -- 0:00:42
      362500 -- [-698.621] (-697.446) (-694.912) (-691.612) * (-694.435) [-692.867] (-690.680) (-698.901) -- 0:00:42
      363000 -- [-695.207] (-694.758) (-694.973) (-694.570) * [-691.276] (-693.367) (-696.638) (-697.857) -- 0:00:42
      363500 -- [-692.130] (-691.291) (-694.292) (-693.671) * [-695.027] (-692.252) (-696.283) (-696.188) -- 0:00:42
      364000 -- (-696.581) (-691.296) (-694.910) [-692.916] * (-693.714) (-694.635) [-692.546] (-695.774) -- 0:00:41
      364500 -- (-696.076) [-692.958] (-694.806) (-695.197) * [-698.035] (-695.678) (-695.354) (-694.502) -- 0:00:41
      365000 -- (-695.626) [-693.766] (-695.125) (-692.354) * [-692.949] (-692.796) (-697.926) (-696.322) -- 0:00:41

      Average standard deviation of split frequencies: 0.013941

      365500 -- (-693.621) [-693.243] (-695.550) (-697.952) * (-695.768) (-693.102) [-693.743] (-695.412) -- 0:00:41
      366000 -- [-693.002] (-697.301) (-694.052) (-693.414) * (-699.451) [-690.872] (-691.998) (-695.454) -- 0:00:41
      366500 -- (-693.809) (-693.184) (-694.778) [-693.203] * (-694.272) (-692.937) [-694.674] (-695.922) -- 0:00:41
      367000 -- [-692.155] (-694.176) (-692.684) (-694.154) * (-691.999) (-692.936) (-693.700) [-693.375] -- 0:00:41
      367500 -- [-693.892] (-695.014) (-695.448) (-694.518) * (-695.828) [-692.354] (-693.436) (-705.561) -- 0:00:41
      368000 -- [-692.634] (-695.390) (-695.608) (-693.127) * (-692.823) (-694.997) (-694.651) [-694.673] -- 0:00:41
      368500 -- (-695.410) (-691.717) (-693.900) [-694.594] * (-692.264) (-698.104) (-691.316) [-696.713] -- 0:00:41
      369000 -- [-696.053] (-691.800) (-694.254) (-695.570) * (-693.273) [-695.484] (-693.861) (-692.464) -- 0:00:41
      369500 -- (-692.982) (-691.580) [-695.262] (-695.609) * (-694.618) (-697.994) [-692.761] (-697.353) -- 0:00:40
      370000 -- (-692.172) (-693.742) [-693.168] (-692.046) * [-694.714] (-694.226) (-694.917) (-693.996) -- 0:00:40

      Average standard deviation of split frequencies: 0.013466

      370500 -- [-691.669] (-694.800) (-692.070) (-694.188) * [-692.453] (-693.938) (-696.263) (-694.001) -- 0:00:40
      371000 -- (-692.625) (-694.516) (-693.532) [-693.450] * (-693.124) (-690.824) [-692.397] (-696.441) -- 0:00:40
      371500 -- (-691.502) [-691.235] (-697.347) (-696.472) * (-695.568) [-693.371] (-692.358) (-697.984) -- 0:00:40
      372000 -- [-691.626] (-695.763) (-696.088) (-696.148) * (-692.957) (-694.368) (-693.331) [-696.024] -- 0:00:40
      372500 -- (-696.085) (-693.467) (-697.181) [-694.464] * (-693.535) (-693.883) [-690.894] (-693.558) -- 0:00:40
      373000 -- [-697.208] (-696.232) (-694.258) (-693.590) * [-691.476] (-691.774) (-691.892) (-695.337) -- 0:00:40
      373500 -- (-693.021) (-693.428) (-697.831) [-692.347] * (-694.190) (-694.260) [-692.534] (-697.456) -- 0:00:41
      374000 -- [-693.548] (-690.975) (-694.962) (-694.534) * [-695.248] (-695.899) (-691.833) (-691.859) -- 0:00:41
      374500 -- (-694.256) (-694.405) [-695.815] (-693.226) * (-694.143) [-692.158] (-695.535) (-695.802) -- 0:00:41
      375000 -- (-696.520) [-691.868] (-702.074) (-692.814) * (-692.145) [-693.549] (-693.377) (-693.841) -- 0:00:41

      Average standard deviation of split frequencies: 0.013865

      375500 -- (-692.387) [-691.962] (-697.909) (-692.399) * (-694.835) (-695.557) [-693.454] (-694.474) -- 0:00:41
      376000 -- [-698.356] (-693.871) (-697.854) (-691.256) * [-692.969] (-692.857) (-692.961) (-693.791) -- 0:00:41
      376500 -- [-694.730] (-691.995) (-695.525) (-691.961) * (-694.225) [-698.423] (-693.887) (-699.250) -- 0:00:41
      377000 -- [-692.580] (-690.956) (-695.196) (-694.504) * (-694.237) (-692.333) (-692.116) [-692.049] -- 0:00:41
      377500 -- (-694.557) (-693.002) [-695.210] (-694.707) * [-695.875] (-694.787) (-694.730) (-695.322) -- 0:00:41
      378000 -- (-694.294) [-690.785] (-693.607) (-696.764) * [-695.824] (-692.529) (-692.606) (-691.566) -- 0:00:41
      378500 -- (-693.571) (-691.191) (-697.621) [-694.577] * (-692.070) (-695.148) (-695.748) [-690.761] -- 0:00:41
      379000 -- (-692.957) (-692.958) [-693.406] (-696.730) * (-693.557) (-693.324) [-693.619] (-696.600) -- 0:00:40
      379500 -- (-696.965) (-694.883) (-694.727) [-693.547] * [-690.547] (-696.159) (-693.320) (-693.478) -- 0:00:40
      380000 -- (-694.789) (-692.856) [-693.778] (-694.772) * (-692.502) [-697.722] (-696.307) (-696.489) -- 0:00:40

      Average standard deviation of split frequencies: 0.013403

      380500 -- [-692.150] (-696.888) (-695.291) (-693.446) * (-698.618) (-695.967) (-693.471) [-689.941] -- 0:00:40
      381000 -- [-692.762] (-695.615) (-695.089) (-694.223) * [-693.315] (-698.306) (-692.806) (-695.083) -- 0:00:40
      381500 -- (-691.835) (-697.002) [-692.713] (-702.617) * (-695.276) (-700.221) [-695.364] (-693.273) -- 0:00:40
      382000 -- (-692.883) (-691.061) (-695.407) [-697.748] * [-696.606] (-698.172) (-691.784) (-696.521) -- 0:00:40
      382500 -- (-697.947) [-695.240] (-698.237) (-694.249) * (-694.838) (-693.493) [-693.815] (-693.767) -- 0:00:40
      383000 -- [-694.794] (-696.750) (-693.248) (-697.118) * [-691.281] (-698.062) (-693.243) (-695.758) -- 0:00:40
      383500 -- (-692.408) [-692.336] (-692.790) (-695.571) * [-692.065] (-693.067) (-699.233) (-695.818) -- 0:00:40
      384000 -- (-695.772) [-693.183] (-700.207) (-696.874) * [-693.840] (-691.674) (-697.826) (-692.918) -- 0:00:40
      384500 -- [-695.534] (-691.598) (-698.189) (-692.768) * (-693.299) [-695.354] (-696.388) (-693.838) -- 0:00:40
      385000 -- (-695.061) (-696.011) (-693.080) [-690.904] * (-692.390) [-693.760] (-698.542) (-694.550) -- 0:00:39

      Average standard deviation of split frequencies: 0.013506

      385500 -- (-692.433) (-692.693) [-693.025] (-693.873) * (-692.043) (-691.982) [-696.109] (-696.499) -- 0:00:39
      386000 -- (-691.114) (-697.014) (-691.706) [-695.341] * (-695.426) (-694.146) (-693.742) [-693.396] -- 0:00:39
      386500 -- (-695.236) (-696.456) [-694.716] (-696.645) * (-693.893) (-695.199) [-696.331] (-693.874) -- 0:00:39
      387000 -- [-692.012] (-693.053) (-696.912) (-693.265) * (-692.289) [-696.055] (-694.034) (-696.267) -- 0:00:39
      387500 -- (-695.808) (-693.418) [-690.912] (-699.609) * (-690.992) (-696.247) (-693.745) [-691.146] -- 0:00:39
      388000 -- (-692.209) (-697.928) (-694.431) [-695.364] * [-693.103] (-694.216) (-694.216) (-693.427) -- 0:00:39
      388500 -- (-694.855) (-689.903) (-696.560) [-695.306] * (-691.910) [-691.551] (-692.558) (-693.059) -- 0:00:39
      389000 -- (-696.448) (-692.633) (-691.893) [-692.721] * [-692.219] (-695.502) (-692.910) (-695.410) -- 0:00:40
      389500 -- (-695.741) (-698.423) (-692.159) [-690.941] * (-694.210) [-691.348] (-693.082) (-695.459) -- 0:00:40
      390000 -- (-698.654) (-693.701) (-695.393) [-692.242] * (-691.569) [-692.423] (-692.172) (-695.711) -- 0:00:40

      Average standard deviation of split frequencies: 0.013060

      390500 -- (-700.046) (-691.983) [-695.187] (-695.186) * (-691.375) [-694.928] (-696.364) (-693.651) -- 0:00:40
      391000 -- (-693.593) (-694.014) [-692.682] (-692.915) * [-692.843] (-698.228) (-691.896) (-696.169) -- 0:00:40
      391500 -- (-693.827) (-696.194) [-691.065] (-694.303) * (-692.656) (-693.910) [-692.536] (-694.125) -- 0:00:40
      392000 -- (-692.890) (-695.328) (-693.756) [-694.795] * [-692.854] (-693.909) (-692.994) (-698.760) -- 0:00:40
      392500 -- (-691.288) [-693.885] (-698.181) (-695.821) * [-692.583] (-692.815) (-697.336) (-692.376) -- 0:00:40
      393000 -- [-692.434] (-695.644) (-697.314) (-693.256) * (-693.336) (-695.628) [-699.607] (-693.314) -- 0:00:40
      393500 -- (-692.224) [-692.863] (-694.470) (-694.586) * (-693.717) [-694.574] (-691.873) (-696.211) -- 0:00:40
      394000 -- (-695.876) (-695.937) (-692.372) [-692.801] * [-694.820] (-696.082) (-693.014) (-695.022) -- 0:00:39
      394500 -- (-692.050) (-695.441) [-696.103] (-692.195) * (-696.398) (-698.665) [-691.871] (-692.388) -- 0:00:39
      395000 -- (-693.580) [-697.642] (-695.944) (-693.425) * (-692.668) (-698.098) [-691.932] (-692.351) -- 0:00:39

      Average standard deviation of split frequencies: 0.013025

      395500 -- (-693.024) (-695.599) [-691.881] (-695.557) * [-691.888] (-695.865) (-698.117) (-692.235) -- 0:00:39
      396000 -- (-691.079) [-695.210] (-694.803) (-697.180) * [-692.365] (-696.572) (-695.047) (-695.459) -- 0:00:39
      396500 -- (-695.171) [-695.754] (-691.606) (-693.055) * (-690.981) (-694.572) (-696.279) [-692.625] -- 0:00:39
      397000 -- (-693.017) [-694.945] (-692.560) (-693.387) * (-692.712) (-695.732) (-693.822) [-693.969] -- 0:00:39
      397500 -- (-695.782) (-695.779) [-692.914] (-692.147) * [-692.342] (-695.829) (-697.825) (-695.119) -- 0:00:39
      398000 -- [-695.197] (-695.359) (-690.988) (-695.811) * (-693.284) (-694.797) (-693.338) [-693.165] -- 0:00:39
      398500 -- (-692.759) (-697.026) (-692.040) [-694.649] * (-694.247) (-691.821) (-692.267) [-692.834] -- 0:00:39
      399000 -- (-692.618) (-696.652) [-695.051] (-698.368) * (-692.358) (-691.776) (-697.204) [-691.421] -- 0:00:39
      399500 -- (-693.872) [-695.166] (-694.878) (-695.014) * (-692.800) [-692.372] (-693.182) (-694.861) -- 0:00:39
      400000 -- (-692.699) (-694.414) [-691.519] (-693.712) * (-691.752) [-693.193] (-693.634) (-693.163) -- 0:00:39

      Average standard deviation of split frequencies: 0.012665

      400500 -- (-693.084) (-695.930) (-694.666) [-694.050] * (-692.399) [-692.308] (-693.866) (-692.618) -- 0:00:38
      401000 -- [-693.573] (-695.201) (-694.653) (-693.780) * (-695.603) [-694.909] (-690.825) (-691.165) -- 0:00:38
      401500 -- (-698.669) (-694.809) [-694.404] (-691.689) * (-694.296) (-692.687) (-693.253) [-691.034] -- 0:00:38
      402000 -- [-691.449] (-693.644) (-694.727) (-698.236) * (-693.411) [-691.571] (-690.895) (-697.856) -- 0:00:38
      402500 -- [-695.056] (-692.543) (-697.769) (-693.104) * (-693.200) [-691.334] (-695.372) (-693.470) -- 0:00:38
      403000 -- (-692.042) (-691.713) [-696.548] (-696.330) * (-695.563) [-696.036] (-693.049) (-690.582) -- 0:00:38
      403500 -- [-691.736] (-695.795) (-693.748) (-693.992) * (-695.665) (-692.782) (-692.186) [-690.377] -- 0:00:38
      404000 -- [-695.578] (-692.516) (-695.251) (-693.640) * (-696.561) (-692.034) [-693.283] (-698.235) -- 0:00:38
      404500 -- (-692.403) [-693.130] (-693.077) (-691.751) * (-694.624) [-690.986] (-693.027) (-694.516) -- 0:00:38
      405000 -- [-692.696] (-691.272) (-692.749) (-690.857) * (-695.755) (-691.722) [-693.298] (-694.810) -- 0:00:39

      Average standard deviation of split frequencies: 0.011816

      405500 -- [-691.573] (-692.999) (-692.068) (-693.408) * [-693.298] (-694.961) (-694.240) (-694.658) -- 0:00:39
      406000 -- (-696.887) (-693.831) (-694.510) [-694.175] * (-693.077) (-694.525) [-692.924] (-696.585) -- 0:00:39
      406500 -- [-691.777] (-692.886) (-692.829) (-693.853) * (-697.051) (-693.952) [-694.564] (-691.605) -- 0:00:39
      407000 -- (-694.567) (-694.403) [-694.317] (-699.605) * [-694.005] (-692.371) (-692.834) (-692.015) -- 0:00:39
      407500 -- (-693.169) (-700.895) [-692.089] (-694.136) * (-696.435) (-693.188) (-691.900) [-693.560] -- 0:00:39
      408000 -- (-693.740) (-693.496) [-691.883] (-692.644) * (-697.456) (-694.371) [-692.686] (-692.948) -- 0:00:39
      408500 -- [-694.597] (-694.059) (-692.931) (-692.562) * [-696.716] (-692.974) (-691.455) (-691.744) -- 0:00:39
      409000 -- (-694.989) [-693.376] (-694.978) (-692.314) * (-698.741) [-695.509] (-693.659) (-693.365) -- 0:00:39
      409500 -- [-698.012] (-690.879) (-693.124) (-693.763) * (-693.982) (-697.291) (-692.912) [-695.474] -- 0:00:38
      410000 -- [-694.143] (-692.268) (-692.950) (-695.301) * [-693.404] (-700.644) (-694.842) (-694.188) -- 0:00:38

      Average standard deviation of split frequencies: 0.011817

      410500 -- [-694.453] (-694.880) (-698.714) (-695.441) * (-699.756) (-692.965) (-696.744) [-692.424] -- 0:00:38
      411000 -- (-691.817) [-692.724] (-695.923) (-693.553) * [-696.283] (-696.874) (-694.349) (-697.902) -- 0:00:38
      411500 -- (-697.077) (-692.887) [-692.976] (-691.382) * [-696.581] (-696.152) (-691.227) (-694.212) -- 0:00:38
      412000 -- (-693.139) (-691.738) [-691.921] (-693.443) * (-693.656) (-691.864) (-692.904) [-691.591] -- 0:00:38
      412500 -- (-693.801) [-691.905] (-692.123) (-694.053) * [-695.993] (-694.850) (-691.797) (-692.053) -- 0:00:38
      413000 -- (-693.047) [-692.016] (-694.164) (-692.786) * (-696.705) (-692.363) [-691.696] (-693.588) -- 0:00:38
      413500 -- (-696.157) (-697.072) [-694.785] (-693.940) * (-698.005) (-694.146) [-691.853] (-696.464) -- 0:00:38
      414000 -- (-691.249) [-696.424] (-697.515) (-694.425) * (-693.066) [-695.429] (-689.135) (-694.480) -- 0:00:38
      414500 -- [-691.739] (-694.076) (-695.733) (-696.058) * (-696.447) (-699.937) [-690.994] (-699.415) -- 0:00:38
      415000 -- [-694.300] (-693.071) (-696.589) (-694.970) * (-697.628) [-691.980] (-693.429) (-691.275) -- 0:00:38

      Average standard deviation of split frequencies: 0.011199

      415500 -- (-696.978) [-694.752] (-695.844) (-701.756) * (-694.829) (-691.629) [-693.663] (-693.325) -- 0:00:37
      416000 -- [-692.110] (-693.547) (-695.726) (-703.520) * (-693.135) (-698.343) (-691.779) [-692.584] -- 0:00:37
      416500 -- (-693.585) (-694.326) (-697.388) [-695.895] * (-695.204) [-692.102] (-693.691) (-692.616) -- 0:00:37
      417000 -- (-694.940) (-701.200) (-695.234) [-690.965] * (-699.344) (-694.683) [-693.428] (-693.740) -- 0:00:37
      417500 -- (-691.994) [-692.772] (-696.281) (-694.849) * (-699.021) [-691.811] (-692.083) (-694.821) -- 0:00:37
      418000 -- [-691.327] (-693.289) (-698.558) (-695.873) * (-697.133) (-692.161) [-693.293] (-698.184) -- 0:00:37
      418500 -- (-695.160) [-695.076] (-698.940) (-691.845) * (-704.951) [-692.106] (-693.564) (-696.468) -- 0:00:37
      419000 -- (-695.109) (-695.534) [-693.922] (-697.925) * (-694.405) (-692.928) [-697.926] (-695.462) -- 0:00:37
      419500 -- [-691.092] (-692.913) (-694.834) (-699.489) * (-703.902) [-694.927] (-700.957) (-689.936) -- 0:00:37
      420000 -- (-692.544) (-691.280) [-694.635] (-694.179) * (-693.494) (-696.891) [-695.583] (-694.238) -- 0:00:37

      Average standard deviation of split frequencies: 0.010349

      420500 -- (-691.995) [-691.420] (-697.455) (-693.411) * (-694.197) (-694.202) [-692.058] (-696.570) -- 0:00:38
      421000 -- (-694.576) [-691.015] (-698.627) (-692.822) * (-695.244) (-695.659) [-695.770] (-692.121) -- 0:00:38
      421500 -- (-700.074) (-691.162) (-692.081) [-696.709] * (-695.695) [-693.095] (-692.176) (-694.118) -- 0:00:38
      422000 -- (-695.113) [-690.870] (-695.790) (-698.662) * (-691.327) [-693.105] (-693.114) (-693.131) -- 0:00:38
      422500 -- [-694.922] (-694.308) (-691.783) (-691.557) * (-691.265) (-694.050) (-692.193) [-692.846] -- 0:00:38
      423000 -- (-693.194) [-695.731] (-696.596) (-691.114) * (-694.255) (-695.735) (-695.443) [-692.391] -- 0:00:38
      423500 -- (-693.688) (-693.532) [-693.659] (-694.200) * (-693.823) [-695.730] (-691.821) (-695.061) -- 0:00:38
      424000 -- (-696.958) [-692.635] (-695.187) (-696.992) * (-693.155) (-695.686) (-697.777) [-697.516] -- 0:00:38
      424500 -- [-691.002] (-694.407) (-699.774) (-697.485) * (-691.926) (-692.551) (-695.234) [-696.853] -- 0:00:37
      425000 -- [-691.755] (-693.675) (-693.795) (-694.701) * (-694.422) (-692.561) [-692.349] (-697.031) -- 0:00:37

      Average standard deviation of split frequencies: 0.010480

      425500 -- (-694.781) (-691.179) [-691.279] (-693.547) * (-696.320) (-694.864) [-693.133] (-693.529) -- 0:00:37
      426000 -- (-692.834) (-690.898) (-693.410) [-694.761] * (-695.367) (-694.203) (-695.127) [-692.855] -- 0:00:37
      426500 -- (-695.453) (-692.228) (-692.926) [-693.761] * [-692.878] (-694.137) (-692.818) (-694.064) -- 0:00:37
      427000 -- (-696.740) (-697.419) [-694.639] (-692.237) * (-693.169) (-696.794) (-695.404) [-692.031] -- 0:00:37
      427500 -- [-693.033] (-697.708) (-693.071) (-693.137) * (-694.637) [-693.572] (-696.216) (-696.370) -- 0:00:37
      428000 -- (-693.754) (-695.190) (-691.227) [-694.055] * [-695.329] (-695.382) (-697.133) (-697.523) -- 0:00:37
      428500 -- (-696.798) (-693.133) (-696.647) [-692.647] * (-692.105) (-695.716) [-691.441] (-698.284) -- 0:00:37
      429000 -- [-693.202] (-693.792) (-695.313) (-692.660) * (-694.833) (-695.759) [-692.980] (-692.184) -- 0:00:37
      429500 -- (-694.987) (-694.160) [-692.190] (-695.882) * (-694.032) (-694.153) [-693.128] (-694.791) -- 0:00:37
      430000 -- (-691.512) (-695.445) (-691.395) [-692.267] * (-693.898) (-696.844) (-694.171) [-692.825] -- 0:00:37

      Average standard deviation of split frequencies: 0.010238

      430500 -- (-696.782) (-693.450) (-693.108) [-692.008] * [-693.530] (-696.387) (-697.701) (-691.721) -- 0:00:37
      431000 -- (-695.875) [-690.702] (-694.799) (-692.525) * (-693.007) (-696.554) (-696.695) [-693.016] -- 0:00:36
      431500 -- (-698.002) [-692.930] (-693.848) (-696.392) * (-694.478) (-691.624) [-691.379] (-695.838) -- 0:00:36
      432000 -- (-694.132) (-691.818) (-698.595) [-692.617] * [-691.723] (-694.537) (-697.751) (-696.262) -- 0:00:36
      432500 -- (-697.672) [-690.974] (-692.896) (-700.397) * (-691.652) [-692.702] (-694.792) (-693.767) -- 0:00:36
      433000 -- (-691.357) (-692.517) (-691.183) [-698.945] * [-692.226] (-691.279) (-693.334) (-692.798) -- 0:00:36
      433500 -- (-695.312) (-694.078) [-690.433] (-698.049) * (-697.920) (-691.730) (-696.885) [-695.369] -- 0:00:36
      434000 -- [-690.833] (-692.546) (-694.663) (-692.864) * (-692.529) [-694.045] (-695.736) (-700.607) -- 0:00:36
      434500 -- [-694.118] (-696.953) (-697.605) (-697.319) * (-692.478) [-691.621] (-696.230) (-695.986) -- 0:00:36
      435000 -- (-691.254) (-692.031) [-695.497] (-695.173) * (-693.856) [-694.643] (-694.030) (-695.569) -- 0:00:36

      Average standard deviation of split frequencies: 0.009985

      435500 -- (-696.246) (-692.827) [-691.258] (-695.349) * (-695.633) (-693.250) [-693.332] (-695.515) -- 0:00:36
      436000 -- (-697.658) [-691.414] (-693.030) (-697.650) * (-696.915) (-696.686) (-696.660) [-699.165] -- 0:00:37
      436500 -- (-692.399) (-691.980) [-691.028] (-708.048) * (-694.076) [-692.915] (-697.764) (-697.955) -- 0:00:37
      437000 -- (-694.605) (-695.434) [-693.812] (-695.103) * (-694.804) [-691.837] (-692.304) (-701.002) -- 0:00:37
      437500 -- (-693.312) (-696.293) [-692.989] (-698.259) * [-693.838] (-694.555) (-693.965) (-695.872) -- 0:00:37
      438000 -- (-695.400) (-691.698) (-695.307) [-695.003] * [-693.045] (-695.920) (-698.069) (-693.270) -- 0:00:37
      438500 -- (-691.246) (-691.280) [-693.649] (-696.071) * [-692.543] (-695.524) (-696.603) (-692.599) -- 0:00:37
      439000 -- (-693.487) (-691.628) [-694.469] (-695.297) * (-692.511) (-695.780) [-691.919] (-694.489) -- 0:00:37
      439500 -- (-694.690) (-692.475) (-694.740) [-693.721] * [-693.778] (-694.052) (-693.211) (-693.679) -- 0:00:36
      440000 -- (-694.864) (-691.280) (-690.885) [-695.230] * (-693.556) [-691.926] (-692.329) (-696.104) -- 0:00:36

      Average standard deviation of split frequencies: 0.010131

      440500 -- (-694.759) (-692.997) (-692.973) [-692.444] * (-694.277) [-692.101] (-693.502) (-693.302) -- 0:00:36
      441000 -- (-695.028) [-691.153] (-698.906) (-696.546) * (-692.988) (-692.613) [-691.799] (-693.894) -- 0:00:36
      441500 -- (-693.462) (-694.601) [-693.995] (-694.708) * [-692.147] (-693.937) (-690.390) (-692.289) -- 0:00:36
      442000 -- (-695.139) (-694.047) [-694.612] (-695.660) * [-692.019] (-697.891) (-692.431) (-694.483) -- 0:00:36
      442500 -- (-695.535) (-694.334) (-696.317) [-695.168] * (-693.269) [-693.990] (-691.701) (-694.643) -- 0:00:36
      443000 -- (-696.946) [-694.166] (-692.915) (-691.399) * (-690.107) (-694.610) [-689.943] (-694.927) -- 0:00:36
      443500 -- (-695.217) (-691.993) [-692.040] (-694.864) * (-695.609) (-693.227) (-695.018) [-693.905] -- 0:00:36
      444000 -- (-697.655) (-693.568) [-693.016] (-698.711) * (-695.585) (-695.977) [-697.591] (-691.415) -- 0:00:36
      444500 -- (-699.589) [-690.791] (-694.656) (-696.784) * (-690.138) (-693.757) (-691.928) [-691.769] -- 0:00:36
      445000 -- [-696.162] (-694.880) (-696.380) (-698.668) * (-690.259) (-694.894) (-692.224) [-693.271] -- 0:00:36

      Average standard deviation of split frequencies: 0.009824

      445500 -- [-695.890] (-695.684) (-693.609) (-695.973) * (-694.892) (-695.572) [-692.567] (-691.828) -- 0:00:36
      446000 -- (-695.709) (-694.433) (-692.088) [-694.661] * (-696.245) (-694.127) [-692.186] (-693.208) -- 0:00:36
      446500 -- (-693.978) (-695.331) (-697.735) [-691.855] * (-696.778) (-693.072) (-697.127) [-692.894] -- 0:00:35
      447000 -- (-693.658) (-692.955) [-698.174] (-692.859) * (-700.404) (-695.258) [-692.822] (-693.450) -- 0:00:35
      447500 -- [-695.232] (-692.941) (-691.201) (-696.291) * (-691.614) (-694.882) (-695.727) [-692.125] -- 0:00:35
      448000 -- (-693.694) (-697.426) (-693.504) [-693.742] * (-691.020) [-696.659] (-692.794) (-694.773) -- 0:00:35
      448500 -- (-692.704) (-693.727) (-697.838) [-694.701] * (-691.459) (-697.725) (-692.531) [-692.171] -- 0:00:35
      449000 -- (-695.594) (-691.818) (-700.177) [-692.556] * [-694.673] (-692.241) (-692.557) (-694.286) -- 0:00:35
      449500 -- (-696.919) (-691.058) [-697.225] (-695.349) * (-694.907) (-691.213) [-695.231] (-695.638) -- 0:00:35
      450000 -- (-696.270) (-697.196) (-697.493) [-695.918] * (-692.892) (-695.498) (-693.365) [-698.005] -- 0:00:35

      Average standard deviation of split frequencies: 0.009783

      450500 -- (-693.988) [-695.875] (-692.718) (-695.807) * (-691.268) (-691.277) (-692.392) [-694.654] -- 0:00:35
      451000 -- (-695.856) (-692.274) [-692.117] (-696.134) * (-693.026) [-691.846] (-694.169) (-695.721) -- 0:00:35
      451500 -- (-695.223) [-692.817] (-693.367) (-696.300) * (-691.782) (-696.048) (-693.725) [-696.136] -- 0:00:36
      452000 -- [-692.668] (-693.259) (-693.286) (-695.889) * (-693.313) (-696.776) (-695.139) [-695.290] -- 0:00:36
      452500 -- (-700.216) (-694.130) [-695.211] (-696.900) * (-692.410) (-699.069) [-691.297] (-697.401) -- 0:00:36
      453000 -- (-691.676) (-695.857) (-697.018) [-692.283] * [-693.420] (-697.830) (-694.027) (-697.929) -- 0:00:36
      453500 -- (-693.553) (-694.834) (-695.489) [-693.469] * (-693.559) (-697.125) [-692.575] (-695.438) -- 0:00:36
      454000 -- (-693.742) [-696.241] (-694.429) (-695.389) * (-697.179) (-692.564) (-691.081) [-694.033] -- 0:00:36
      454500 -- (-693.380) [-692.365] (-697.494) (-693.590) * (-691.968) [-694.700] (-696.578) (-692.322) -- 0:00:36
      455000 -- [-692.042] (-695.576) (-693.409) (-692.108) * (-689.691) [-693.409] (-695.108) (-695.361) -- 0:00:35

      Average standard deviation of split frequencies: 0.009547

      455500 -- (-692.176) (-693.924) [-691.504] (-693.601) * (-695.517) [-691.448] (-693.226) (-696.072) -- 0:00:35
      456000 -- (-691.337) [-694.604] (-702.532) (-695.011) * [-695.220] (-694.540) (-692.679) (-695.415) -- 0:00:35
      456500 -- [-694.786] (-691.982) (-693.708) (-694.143) * [-691.389] (-694.832) (-693.354) (-694.902) -- 0:00:35
      457000 -- (-694.335) (-694.682) (-692.596) [-691.777] * [-693.103] (-696.597) (-697.619) (-695.491) -- 0:00:35
      457500 -- (-694.329) (-693.350) [-691.254] (-697.028) * [-691.206] (-693.873) (-693.462) (-696.104) -- 0:00:35
      458000 -- (-694.678) [-692.837] (-691.120) (-691.793) * (-696.495) (-693.678) [-690.792] (-695.714) -- 0:00:35
      458500 -- (-695.566) (-693.683) (-695.470) [-692.898] * (-696.313) (-694.767) (-694.557) [-697.403] -- 0:00:35
      459000 -- (-692.470) [-693.321] (-693.337) (-694.212) * (-695.354) (-694.971) [-689.495] (-701.285) -- 0:00:35
      459500 -- [-692.646] (-696.227) (-693.852) (-692.927) * (-692.611) (-694.586) [-697.361] (-695.034) -- 0:00:35
      460000 -- (-694.545) (-695.172) (-691.942) [-693.573] * (-698.255) (-694.189) (-697.187) [-694.779] -- 0:00:35

      Average standard deviation of split frequencies: 0.009571

      460500 -- [-694.077] (-695.093) (-692.541) (-692.732) * (-692.441) [-693.467] (-696.944) (-695.488) -- 0:00:35
      461000 -- (-692.687) (-692.251) [-691.589] (-694.084) * [-692.607] (-699.298) (-693.020) (-693.248) -- 0:00:35
      461500 -- (-696.569) (-691.293) (-691.259) [-689.684] * (-696.542) (-692.646) [-692.363] (-692.329) -- 0:00:35
      462000 -- (-696.496) (-696.294) [-692.131] (-691.598) * [-691.438] (-693.693) (-693.805) (-694.933) -- 0:00:34
      462500 -- (-692.037) (-697.630) (-692.700) [-690.960] * [-698.479] (-696.726) (-696.223) (-694.744) -- 0:00:34
      463000 -- (-691.362) [-693.014] (-695.233) (-691.799) * (-692.827) (-691.321) (-694.737) [-693.326] -- 0:00:34
      463500 -- (-695.422) [-695.876] (-693.886) (-691.480) * (-694.196) [-691.667] (-698.511) (-694.816) -- 0:00:34
      464000 -- (-696.215) [-693.056] (-694.911) (-694.828) * [-694.175] (-692.297) (-694.220) (-695.684) -- 0:00:34
      464500 -- (-693.476) (-695.899) (-697.326) [-690.352] * (-695.391) [-693.061] (-692.001) (-692.584) -- 0:00:34
      465000 -- (-693.754) [-693.822] (-698.871) (-696.132) * (-696.271) (-695.233) (-691.988) [-694.829] -- 0:00:34

      Average standard deviation of split frequencies: 0.010116

      465500 -- (-693.842) (-695.806) [-690.629] (-693.152) * (-692.708) [-695.850] (-697.633) (-694.825) -- 0:00:34
      466000 -- (-696.177) (-693.153) (-693.088) [-693.061] * (-692.113) (-694.292) [-694.952] (-695.353) -- 0:00:34
      466500 -- (-694.628) (-690.598) (-691.317) [-693.438] * (-694.298) (-692.031) (-694.008) [-692.172] -- 0:00:34
      467000 -- (-695.909) (-693.031) [-689.836] (-694.228) * (-695.466) [-691.991] (-696.573) (-695.581) -- 0:00:35
      467500 -- (-692.049) [-693.249] (-692.268) (-692.087) * [-695.747] (-692.060) (-694.207) (-695.712) -- 0:00:35
      468000 -- (-692.310) (-692.642) [-692.373] (-695.699) * (-692.559) (-696.109) [-696.440] (-694.747) -- 0:00:35
      468500 -- [-696.664] (-694.091) (-691.938) (-693.104) * (-692.609) (-694.504) (-695.864) [-696.248] -- 0:00:35
      469000 -- (-694.323) [-694.715] (-691.007) (-693.878) * (-694.514) (-695.058) (-699.125) [-693.836] -- 0:00:35
      469500 -- (-693.559) (-695.257) (-693.209) [-693.326] * [-694.300] (-697.218) (-692.604) (-699.295) -- 0:00:35
      470000 -- (-693.632) (-692.556) [-692.249] (-692.657) * (-697.257) (-693.620) [-693.312] (-697.912) -- 0:00:34

      Average standard deviation of split frequencies: 0.010310

      470500 -- (-692.913) [-694.676] (-693.364) (-696.383) * (-692.408) (-692.313) [-693.669] (-693.503) -- 0:00:34
      471000 -- (-696.549) (-693.879) [-690.832] (-692.292) * (-692.797) (-694.521) (-693.777) [-692.055] -- 0:00:34
      471500 -- [-699.761] (-692.210) (-693.045) (-696.595) * (-695.043) (-693.102) [-691.447] (-696.015) -- 0:00:34
      472000 -- (-693.671) (-693.018) (-692.963) [-692.584] * (-697.423) (-695.463) (-696.307) [-693.090] -- 0:00:34
      472500 -- (-694.754) (-693.965) [-692.405] (-691.602) * (-692.483) (-696.858) [-693.608] (-695.429) -- 0:00:34
      473000 -- [-692.910] (-694.804) (-694.204) (-691.801) * [-692.707] (-694.710) (-695.309) (-693.930) -- 0:00:34
      473500 -- [-693.360] (-694.832) (-693.471) (-690.501) * (-693.306) (-696.232) (-695.352) [-693.065] -- 0:00:34
      474000 -- (-691.917) (-695.201) (-692.913) [-695.351] * (-696.901) (-692.858) [-691.851] (-691.202) -- 0:00:34
      474500 -- (-693.615) [-691.810] (-695.434) (-697.032) * [-691.904] (-698.506) (-693.586) (-692.860) -- 0:00:34
      475000 -- (-695.992) [-693.203] (-694.332) (-696.224) * (-692.591) (-695.014) (-694.906) [-693.146] -- 0:00:34

      Average standard deviation of split frequencies: 0.011010

      475500 -- (-694.801) [-693.538] (-691.204) (-694.447) * (-692.863) (-693.117) [-691.996] (-691.348) -- 0:00:34
      476000 -- (-697.577) (-692.237) [-695.146] (-695.036) * (-693.670) (-697.871) (-697.076) [-691.178] -- 0:00:34
      476500 -- (-695.378) (-697.154) (-695.889) [-691.443] * (-692.574) (-697.954) (-695.551) [-692.654] -- 0:00:34
      477000 -- (-694.241) [-692.878] (-693.475) (-693.179) * (-691.112) (-695.611) (-696.228) [-696.256] -- 0:00:33
      477500 -- (-695.742) [-693.862] (-690.992) (-692.383) * (-695.286) (-694.044) [-692.667] (-694.014) -- 0:00:33
      478000 -- (-693.074) (-696.799) (-693.078) [-691.080] * (-692.611) [-697.987] (-695.233) (-692.708) -- 0:00:33
      478500 -- (-694.730) (-696.915) (-692.406) [-691.469] * (-691.516) [-695.641] (-690.049) (-691.467) -- 0:00:33
      479000 -- (-697.128) (-700.307) (-700.429) [-690.941] * (-694.483) [-692.509] (-692.491) (-691.442) -- 0:00:33
      479500 -- (-695.940) [-691.898] (-695.174) (-691.370) * (-692.157) (-694.643) (-692.929) [-692.018] -- 0:00:33
      480000 -- (-696.154) (-695.481) [-699.263] (-693.113) * [-695.625] (-692.548) (-695.814) (-693.913) -- 0:00:33

      Average standard deviation of split frequencies: 0.010673

      480500 -- (-695.638) (-693.919) [-693.252] (-696.286) * [-693.768] (-692.981) (-693.870) (-693.278) -- 0:00:33
      481000 -- [-693.430] (-702.017) (-699.015) (-692.118) * (-692.022) (-695.149) (-693.433) [-692.753] -- 0:00:33
      481500 -- (-693.134) (-693.265) [-693.592] (-696.168) * (-698.621) (-695.009) (-694.126) [-694.874] -- 0:00:33
      482000 -- [-693.641] (-692.919) (-694.754) (-695.227) * (-694.912) (-691.620) (-691.834) [-693.304] -- 0:00:33
      482500 -- (-694.620) [-695.036] (-694.712) (-696.753) * (-692.422) (-696.596) [-694.627] (-694.540) -- 0:00:34
      483000 -- (-693.085) [-693.431] (-695.307) (-692.085) * (-693.289) (-694.355) [-694.397] (-690.163) -- 0:00:34
      483500 -- (-698.273) [-693.796] (-693.910) (-693.358) * (-694.565) [-702.114] (-694.590) (-694.202) -- 0:00:34
      484000 -- (-697.897) (-695.744) [-695.743] (-694.270) * [-692.282] (-692.954) (-695.410) (-693.216) -- 0:00:34
      484500 -- (-694.833) (-694.486) (-690.674) [-692.491] * (-693.164) [-694.985] (-692.028) (-693.314) -- 0:00:34
      485000 -- (-692.214) (-693.936) [-690.635] (-691.601) * (-697.018) [-693.973] (-693.342) (-694.902) -- 0:00:33

      Average standard deviation of split frequencies: 0.010898

      485500 -- [-694.227] (-694.219) (-695.544) (-693.430) * (-692.749) (-692.120) (-693.834) [-693.493] -- 0:00:33
      486000 -- (-694.913) [-693.231] (-693.631) (-694.697) * [-692.522] (-698.302) (-695.078) (-693.227) -- 0:00:33
      486500 -- (-696.270) (-692.648) (-697.930) [-692.919] * (-692.193) (-693.063) [-692.499] (-691.961) -- 0:00:33
      487000 -- [-692.632] (-697.799) (-690.835) (-694.598) * (-690.318) [-692.752] (-695.005) (-693.416) -- 0:00:33
      487500 -- (-692.033) (-694.474) [-690.609] (-691.817) * (-693.365) (-694.951) [-693.907] (-691.913) -- 0:00:33
      488000 -- (-696.594) [-692.577] (-693.282) (-690.757) * [-691.288] (-691.188) (-691.710) (-696.146) -- 0:00:33
      488500 -- [-695.612] (-693.416) (-693.052) (-695.496) * (-692.034) [-693.956] (-691.597) (-693.578) -- 0:00:33
      489000 -- [-695.549] (-695.109) (-697.474) (-696.096) * [-691.531] (-699.172) (-691.440) (-694.156) -- 0:00:33
      489500 -- (-693.891) [-692.401] (-697.219) (-700.736) * (-694.384) (-692.987) [-692.378] (-695.723) -- 0:00:33
      490000 -- (-696.842) (-693.722) [-693.520] (-694.561) * [-695.818] (-694.469) (-694.162) (-696.512) -- 0:00:33

      Average standard deviation of split frequencies: 0.010286

      490500 -- (-697.702) (-692.785) [-694.113] (-691.784) * [-696.288] (-693.422) (-694.260) (-695.761) -- 0:00:33
      491000 -- (-694.233) (-693.259) (-690.542) [-693.495] * (-697.085) (-692.144) [-696.304] (-696.494) -- 0:00:33
      491500 -- (-697.097) (-692.758) [-692.346] (-693.558) * (-698.596) (-695.532) [-692.740] (-698.589) -- 0:00:33
      492000 -- (-694.655) (-692.224) (-698.007) [-696.338] * (-696.758) [-692.864] (-693.690) (-695.787) -- 0:00:33
      492500 -- (-693.208) [-692.521] (-694.809) (-692.476) * [-690.965] (-694.710) (-694.624) (-692.965) -- 0:00:32
      493000 -- [-695.926] (-692.601) (-691.212) (-693.801) * (-692.402) (-693.458) (-695.175) [-692.812] -- 0:00:32
      493500 -- (-695.854) (-694.783) (-693.281) [-692.912] * (-692.810) (-698.296) [-693.567] (-694.903) -- 0:00:32
      494000 -- (-695.802) (-694.770) (-693.717) [-694.170] * (-693.518) [-691.806] (-693.473) (-693.296) -- 0:00:32
      494500 -- (-696.628) (-693.897) (-693.711) [-690.526] * [-693.110] (-692.507) (-693.204) (-693.648) -- 0:00:32
      495000 -- [-695.748] (-692.718) (-694.574) (-696.131) * (-692.072) (-698.804) (-698.303) [-690.798] -- 0:00:32

      Average standard deviation of split frequencies: 0.010510

      495500 -- (-693.610) [-695.382] (-692.725) (-692.570) * (-692.465) (-691.129) [-692.567] (-695.230) -- 0:00:32
      496000 -- (-692.491) (-693.482) (-691.861) [-690.885] * (-697.717) [-693.731] (-691.551) (-694.006) -- 0:00:32
      496500 -- (-693.716) (-696.852) [-694.223] (-690.447) * (-696.605) (-693.846) (-692.385) [-695.065] -- 0:00:32
      497000 -- [-695.303] (-698.616) (-695.452) (-691.421) * (-692.236) [-690.449] (-694.590) (-695.520) -- 0:00:32
      497500 -- (-695.002) (-693.495) (-693.153) [-691.737] * (-694.663) (-694.701) (-696.126) [-692.439] -- 0:00:32
      498000 -- (-691.976) [-692.744] (-693.860) (-695.826) * (-696.075) (-696.463) (-691.660) [-692.163] -- 0:00:33
      498500 -- (-690.742) (-693.509) (-694.636) [-691.671] * (-694.359) (-693.214) [-692.823] (-694.856) -- 0:00:33
      499000 -- [-690.920] (-691.764) (-690.944) (-696.220) * [-693.156] (-694.236) (-692.477) (-695.636) -- 0:00:33
      499500 -- [-694.997] (-690.892) (-693.300) (-691.621) * (-694.160) (-697.238) (-693.312) [-693.563] -- 0:00:33
      500000 -- (-693.413) (-691.211) (-693.509) [-694.146] * (-696.833) (-696.700) (-693.027) [-693.074] -- 0:00:33

      Average standard deviation of split frequencies: 0.010856

      500500 -- (-694.999) [-697.535] (-692.469) (-693.856) * (-693.637) (-691.761) (-690.991) [-692.615] -- 0:00:32
      501000 -- (-690.370) (-692.214) (-695.689) [-695.482] * (-693.536) (-696.704) (-694.818) [-693.721] -- 0:00:32
      501500 -- (-694.161) (-692.616) (-693.255) [-693.128] * [-698.741] (-694.053) (-695.583) (-692.210) -- 0:00:32
      502000 -- [-692.972] (-692.470) (-694.516) (-693.071) * (-697.636) [-693.732] (-693.708) (-691.572) -- 0:00:32
      502500 -- (-692.992) (-696.485) (-691.209) [-691.780] * [-696.777] (-692.528) (-694.906) (-696.718) -- 0:00:32
      503000 -- (-694.375) (-694.690) (-694.855) [-694.334] * (-692.418) (-696.593) [-690.539] (-693.428) -- 0:00:32
      503500 -- (-691.697) (-695.575) (-691.356) [-690.711] * (-694.832) (-692.325) (-690.415) [-692.720] -- 0:00:32
      504000 -- (-693.484) [-693.592] (-691.624) (-691.621) * (-693.207) [-693.531] (-692.353) (-692.360) -- 0:00:32
      504500 -- [-693.174] (-692.165) (-691.332) (-690.277) * (-692.879) (-697.518) [-692.428] (-692.203) -- 0:00:32
      505000 -- [-694.995] (-694.091) (-690.834) (-696.245) * (-695.393) [-692.182] (-695.000) (-693.427) -- 0:00:32

      Average standard deviation of split frequencies: 0.011344

      505500 -- (-694.552) (-699.115) [-692.520] (-692.478) * (-694.025) (-691.223) (-692.312) [-697.949] -- 0:00:32
      506000 -- (-693.237) [-693.136] (-694.179) (-691.205) * (-694.275) (-692.546) [-691.792] (-692.006) -- 0:00:32
      506500 -- [-691.397] (-692.399) (-690.041) (-691.478) * (-692.640) [-692.668] (-693.925) (-692.605) -- 0:00:32
      507000 -- (-696.193) (-692.519) (-690.760) [-691.718] * (-694.276) (-690.662) (-693.088) [-697.002] -- 0:00:32
      507500 -- (-694.963) (-695.008) [-694.395] (-691.283) * [-693.696] (-695.357) (-693.832) (-695.789) -- 0:00:32
      508000 -- (-694.175) (-692.843) (-701.508) [-693.718] * [-695.916] (-692.173) (-697.561) (-696.601) -- 0:00:31
      508500 -- [-694.065] (-698.537) (-693.573) (-692.615) * (-695.163) (-694.383) [-695.182] (-702.157) -- 0:00:31
      509000 -- [-694.066] (-695.174) (-695.372) (-693.795) * (-694.555) [-689.723] (-692.758) (-695.483) -- 0:00:31
      509500 -- (-692.680) [-694.468] (-695.994) (-692.683) * (-696.414) [-690.792] (-695.456) (-693.371) -- 0:00:31
      510000 -- (-693.261) (-694.080) [-696.404] (-694.186) * (-696.061) [-692.197] (-691.628) (-694.046) -- 0:00:31

      Average standard deviation of split frequencies: 0.011512

      510500 -- (-694.973) (-693.838) [-692.408] (-691.196) * (-696.245) [-690.806] (-695.150) (-693.005) -- 0:00:31
      511000 -- [-693.816] (-694.626) (-693.036) (-696.755) * (-694.864) (-696.644) (-694.788) [-694.812] -- 0:00:31
      511500 -- [-692.817] (-697.634) (-696.302) (-694.926) * [-692.727] (-697.395) (-695.727) (-698.302) -- 0:00:31
      512000 -- (-695.879) (-696.068) [-689.906] (-695.683) * [-691.553] (-698.342) (-698.224) (-693.177) -- 0:00:31
      512500 -- (-693.466) [-694.667] (-691.832) (-693.389) * (-695.717) [-695.414] (-696.978) (-697.620) -- 0:00:31
      513000 -- (-693.791) (-693.742) (-692.530) [-691.276] * (-697.596) (-691.874) (-691.130) [-694.037] -- 0:00:31
      513500 -- [-693.148] (-691.018) (-694.210) (-692.025) * (-695.759) (-693.427) [-692.088] (-690.324) -- 0:00:32
      514000 -- (-699.085) (-691.124) (-696.961) [-691.236] * (-691.323) (-695.599) (-696.690) [-691.977] -- 0:00:32
      514500 -- (-697.003) (-691.653) (-697.400) [-693.659] * [-693.687] (-698.005) (-694.539) (-696.844) -- 0:00:32
      515000 -- (-695.000) (-693.669) (-695.356) [-692.493] * [-693.871] (-691.970) (-693.061) (-694.456) -- 0:00:32

      Average standard deviation of split frequencies: 0.011876

      515500 -- (-692.403) [-692.048] (-694.409) (-692.431) * (-692.872) (-691.426) [-693.062] (-693.937) -- 0:00:31
      516000 -- (-694.351) (-693.497) [-690.309] (-694.957) * [-692.378] (-690.872) (-689.871) (-700.513) -- 0:00:31
      516500 -- (-695.449) (-695.521) [-693.516] (-693.330) * [-692.498] (-691.828) (-694.980) (-693.015) -- 0:00:31
      517000 -- (-695.088) (-692.652) [-692.310] (-693.307) * (-693.557) [-691.071] (-691.754) (-692.603) -- 0:00:31
      517500 -- [-694.467] (-692.490) (-691.603) (-691.713) * (-694.011) (-692.310) (-693.114) [-692.414] -- 0:00:31
      518000 -- [-690.619] (-694.515) (-692.487) (-696.631) * [-693.825] (-693.301) (-692.479) (-692.181) -- 0:00:31
      518500 -- (-692.028) (-695.717) [-696.733] (-696.353) * (-691.247) (-695.177) [-693.129] (-698.249) -- 0:00:31
      519000 -- [-692.078] (-695.619) (-692.528) (-694.245) * (-693.434) (-693.282) [-695.624] (-692.923) -- 0:00:31
      519500 -- (-693.276) (-692.098) (-696.152) [-692.005] * (-694.136) [-693.606] (-691.150) (-694.982) -- 0:00:31
      520000 -- [-690.425] (-696.696) (-691.203) (-703.386) * (-694.937) [-697.307] (-695.012) (-691.366) -- 0:00:31

      Average standard deviation of split frequencies: 0.012356

      520500 -- (-692.230) (-693.331) [-692.448] (-695.568) * [-692.979] (-693.248) (-694.270) (-694.142) -- 0:00:31
      521000 -- (-692.662) (-693.402) (-694.422) [-692.988] * (-695.387) (-692.348) (-701.116) [-691.762] -- 0:00:31
      521500 -- (-692.577) (-693.973) (-692.952) [-694.055] * (-694.105) (-694.423) (-695.390) [-694.090] -- 0:00:31
      522000 -- (-692.455) (-700.557) [-692.449] (-693.800) * (-692.098) (-696.303) (-693.861) [-691.081] -- 0:00:31
      522500 -- (-694.342) [-693.124] (-692.762) (-696.957) * (-693.568) (-693.285) [-695.331] (-694.352) -- 0:00:31
      523000 -- (-692.873) (-695.027) [-692.615] (-695.736) * [-692.952] (-694.561) (-692.232) (-693.728) -- 0:00:31
      523500 -- (-693.359) (-696.389) (-696.002) [-694.683] * (-693.771) (-696.434) (-692.984) [-692.412] -- 0:00:30
      524000 -- (-690.251) [-693.678] (-697.252) (-695.858) * (-692.849) (-696.227) (-695.333) [-690.595] -- 0:00:30
      524500 -- (-695.119) (-695.923) (-693.704) [-693.268] * (-693.602) (-694.262) (-693.637) [-695.116] -- 0:00:30
      525000 -- (-690.440) (-697.534) [-691.974] (-694.089) * (-692.821) [-694.807] (-694.240) (-691.846) -- 0:00:30

      Average standard deviation of split frequencies: 0.012231

      525500 -- [-689.521] (-694.844) (-693.062) (-695.068) * (-694.583) [-693.958] (-692.366) (-694.834) -- 0:00:30
      526000 -- (-691.047) (-694.954) [-692.164] (-693.662) * (-693.378) [-692.502] (-693.535) (-692.436) -- 0:00:30
      526500 -- [-690.978] (-693.065) (-691.736) (-695.084) * (-695.007) (-698.808) (-693.202) [-691.602] -- 0:00:30
      527000 -- (-691.219) (-695.435) [-692.568] (-693.176) * (-693.834) [-693.734] (-695.031) (-693.950) -- 0:00:30
      527500 -- (-690.743) [-691.240] (-692.241) (-695.450) * (-700.258) (-692.086) [-694.542] (-692.564) -- 0:00:30
      528000 -- [-693.270] (-693.811) (-694.478) (-692.643) * [-695.433] (-693.646) (-692.625) (-694.375) -- 0:00:30
      528500 -- [-691.569] (-691.808) (-695.817) (-691.187) * (-694.484) (-692.470) [-693.253] (-695.063) -- 0:00:30
      529000 -- (-691.988) [-695.873] (-695.204) (-692.673) * [-695.850] (-694.697) (-690.656) (-693.623) -- 0:00:31
      529500 -- [-693.560] (-695.679) (-692.358) (-695.432) * (-695.376) (-698.657) (-695.704) [-693.847] -- 0:00:31
      530000 -- (-695.071) [-691.535] (-692.518) (-692.625) * (-695.435) [-692.475] (-694.331) (-696.071) -- 0:00:31

      Average standard deviation of split frequencies: 0.011862

      530500 -- (-692.174) (-692.192) [-693.772] (-694.979) * (-697.354) (-692.598) [-695.084] (-691.528) -- 0:00:30
      531000 -- (-692.413) [-690.991] (-694.075) (-693.567) * [-695.002] (-694.504) (-694.583) (-694.985) -- 0:00:30
      531500 -- (-692.533) (-692.712) (-692.265) [-693.812] * (-692.651) (-693.804) (-693.301) [-691.246] -- 0:00:30
      532000 -- (-694.719) (-691.163) [-692.317] (-693.035) * (-693.237) (-694.112) (-696.610) [-693.786] -- 0:00:30
      532500 -- (-692.555) (-692.352) [-690.952] (-698.684) * [-694.020] (-692.655) (-694.328) (-691.945) -- 0:00:30
      533000 -- (-693.805) (-697.046) (-691.647) [-694.916] * [-691.700] (-694.287) (-694.752) (-692.786) -- 0:00:30
      533500 -- [-693.887] (-692.909) (-692.406) (-691.497) * (-692.481) (-691.392) (-691.878) [-692.108] -- 0:00:30
      534000 -- [-692.129] (-693.245) (-693.855) (-697.201) * (-693.136) (-694.713) (-695.766) [-694.884] -- 0:00:30
      534500 -- [-693.161] (-692.890) (-695.552) (-692.506) * (-693.834) [-695.205] (-694.935) (-691.282) -- 0:00:30
      535000 -- (-693.422) [-691.457] (-692.143) (-696.892) * (-692.203) (-693.740) (-695.170) [-691.499] -- 0:00:30

      Average standard deviation of split frequencies: 0.011744

      535500 -- (-697.521) (-694.260) [-694.871] (-693.732) * (-691.632) (-694.343) [-694.852] (-691.955) -- 0:00:30
      536000 -- (-693.060) [-693.193] (-693.750) (-696.184) * (-691.952) (-692.588) (-695.692) [-695.906] -- 0:00:30
      536500 -- (-695.880) [-693.928] (-698.712) (-692.491) * (-691.752) (-692.152) [-691.049] (-693.568) -- 0:00:30
      537000 -- (-695.811) (-696.928) (-692.570) [-692.414] * [-691.437] (-692.491) (-691.020) (-694.446) -- 0:00:30
      537500 -- (-693.712) [-690.959] (-694.307) (-695.174) * [-692.971] (-695.555) (-693.825) (-695.123) -- 0:00:30
      538000 -- [-692.461] (-692.948) (-695.505) (-693.431) * [-692.711] (-692.885) (-695.875) (-692.374) -- 0:00:30
      538500 -- [-692.792] (-692.118) (-695.063) (-694.020) * (-696.950) [-690.746] (-692.703) (-693.865) -- 0:00:29
      539000 -- (-691.166) [-693.886] (-695.506) (-693.057) * [-694.113] (-694.109) (-692.038) (-696.577) -- 0:00:29
      539500 -- [-695.831] (-697.322) (-692.918) (-693.306) * (-692.152) [-692.079] (-693.541) (-694.192) -- 0:00:29
      540000 -- (-698.132) (-697.828) (-693.247) [-691.168] * (-693.176) (-695.652) [-692.885] (-695.968) -- 0:00:29

      Average standard deviation of split frequencies: 0.011796

      540500 -- [-696.200] (-694.749) (-692.206) (-694.372) * (-693.574) [-692.296] (-699.158) (-691.188) -- 0:00:29
      541000 -- (-697.809) [-693.930] (-694.926) (-695.317) * (-694.207) (-692.454) [-690.626] (-695.187) -- 0:00:29
      541500 -- (-696.397) (-691.312) (-698.563) [-691.974] * (-696.851) [-692.230] (-693.588) (-692.885) -- 0:00:29
      542000 -- [-693.775] (-692.318) (-700.766) (-698.177) * [-691.383] (-695.014) (-696.183) (-691.474) -- 0:00:29
      542500 -- (-695.074) (-694.198) (-697.757) [-692.431] * (-692.207) [-693.312] (-695.675) (-693.236) -- 0:00:29
      543000 -- (-694.968) (-693.549) [-697.436] (-694.230) * [-698.138] (-696.653) (-695.744) (-694.838) -- 0:00:29
      543500 -- (-692.117) (-693.535) (-694.307) [-692.786] * (-693.353) [-693.498] (-700.822) (-692.191) -- 0:00:29
      544000 -- (-693.111) (-696.081) [-693.750] (-692.008) * (-691.912) [-693.064] (-693.753) (-692.424) -- 0:00:30
      544500 -- [-692.875] (-697.043) (-695.933) (-697.429) * (-695.053) (-694.087) [-690.896] (-694.026) -- 0:00:30
      545000 -- [-694.533] (-694.679) (-693.723) (-693.937) * (-693.152) (-692.497) [-693.660] (-694.141) -- 0:00:30

      Average standard deviation of split frequencies: 0.012240

      545500 -- (-693.842) (-692.548) [-692.362] (-693.225) * (-691.671) (-691.365) [-693.148] (-692.554) -- 0:00:29
      546000 -- [-692.815] (-697.244) (-695.703) (-694.216) * (-692.696) (-692.153) (-696.138) [-693.571] -- 0:00:29
      546500 -- (-701.889) [-691.541] (-692.885) (-694.666) * (-690.654) (-690.492) [-691.923] (-691.371) -- 0:00:29
      547000 -- (-693.661) (-694.515) [-695.704] (-694.532) * (-691.719) (-691.624) [-697.414] (-692.785) -- 0:00:29
      547500 -- (-692.009) (-693.595) (-694.593) [-690.884] * (-693.984) [-693.639] (-701.441) (-691.274) -- 0:00:29
      548000 -- [-694.068] (-694.448) (-702.320) (-691.244) * [-694.558] (-693.567) (-692.137) (-694.698) -- 0:00:29
      548500 -- [-694.931] (-697.660) (-704.424) (-697.241) * [-693.629] (-694.221) (-693.875) (-693.459) -- 0:00:29
      549000 -- (-696.801) (-697.773) (-696.793) [-692.143] * [-693.814] (-697.234) (-690.256) (-691.964) -- 0:00:29
      549500 -- [-698.130] (-698.071) (-698.061) (-694.624) * (-696.414) (-697.684) [-693.052] (-697.183) -- 0:00:29
      550000 -- (-693.126) (-692.046) [-693.615] (-695.219) * (-697.060) (-695.807) (-690.703) [-693.721] -- 0:00:29

      Average standard deviation of split frequencies: 0.012237

      550500 -- [-696.122] (-695.042) (-696.244) (-694.985) * [-693.628] (-694.318) (-696.653) (-696.768) -- 0:00:29
      551000 -- (-692.586) [-696.365] (-693.132) (-692.619) * (-694.656) [-692.753] (-695.256) (-693.805) -- 0:00:29
      551500 -- (-694.557) (-692.093) (-694.835) [-691.716] * (-696.632) [-694.242] (-696.328) (-691.641) -- 0:00:29
      552000 -- (-693.692) (-695.344) (-698.078) [-692.482] * [-692.854] (-694.432) (-693.309) (-694.787) -- 0:00:29
      552500 -- (-692.423) [-694.563] (-697.650) (-692.066) * (-694.619) [-693.916] (-693.715) (-694.820) -- 0:00:29
      553000 -- (-692.360) [-692.041] (-695.071) (-691.898) * (-695.102) [-693.401] (-694.006) (-694.790) -- 0:00:29
      553500 -- (-691.700) [-696.168] (-696.741) (-694.694) * (-695.798) [-697.120] (-693.091) (-693.135) -- 0:00:29
      554000 -- (-694.231) (-690.101) (-695.069) [-692.552] * [-692.259] (-693.976) (-694.881) (-692.309) -- 0:00:28
      554500 -- (-693.773) [-692.373] (-695.494) (-694.433) * (-693.668) (-696.168) [-692.711] (-695.697) -- 0:00:28
      555000 -- [-692.473] (-694.687) (-694.643) (-693.801) * (-691.739) [-693.922] (-693.400) (-693.333) -- 0:00:28

      Average standard deviation of split frequencies: 0.011371

      555500 -- (-695.724) [-690.854] (-699.821) (-696.035) * (-694.002) (-694.826) [-692.433] (-694.667) -- 0:00:28
      556000 -- (-694.456) [-694.158] (-692.087) (-692.460) * (-693.371) (-693.713) (-691.321) [-691.754] -- 0:00:28
      556500 -- (-693.572) [-695.084] (-696.531) (-696.202) * [-695.750] (-694.843) (-692.390) (-695.645) -- 0:00:28
      557000 -- (-693.667) [-693.788] (-691.641) (-692.286) * (-695.147) (-694.185) [-691.110] (-691.934) -- 0:00:28
      557500 -- (-695.192) [-693.396] (-695.378) (-690.544) * (-693.623) (-699.814) (-695.251) [-693.361] -- 0:00:28
      558000 -- (-695.495) (-692.075) [-695.139] (-694.006) * (-692.328) (-696.639) [-691.096] (-693.018) -- 0:00:28
      558500 -- (-694.097) (-692.798) (-696.777) [-692.391] * (-694.492) [-693.850] (-692.476) (-693.722) -- 0:00:28
      559000 -- (-693.145) [-692.292] (-694.825) (-693.800) * (-691.462) (-694.928) (-692.968) [-692.853] -- 0:00:28
      559500 -- (-696.404) (-691.934) [-690.672] (-693.169) * [-691.868] (-694.868) (-691.015) (-693.342) -- 0:00:29
      560000 -- (-691.842) [-692.681] (-695.289) (-692.996) * [-691.957] (-696.952) (-694.799) (-691.444) -- 0:00:29

      Average standard deviation of split frequencies: 0.011326

      560500 -- (-696.129) (-694.018) (-691.579) [-692.609] * [-695.190] (-693.853) (-692.773) (-692.261) -- 0:00:29
      561000 -- (-693.323) (-692.421) (-695.492) [-691.997] * (-695.797) (-693.290) [-691.610] (-694.312) -- 0:00:28
      561500 -- (-693.751) (-692.712) (-694.730) [-693.067] * [-691.383] (-693.467) (-694.221) (-691.206) -- 0:00:28
      562000 -- (-699.111) (-693.238) (-690.482) [-694.559] * (-690.297) (-696.912) [-693.056] (-692.464) -- 0:00:28
      562500 -- (-695.862) [-693.690] (-695.388) (-694.531) * [-694.890] (-693.846) (-690.173) (-691.918) -- 0:00:28
      563000 -- [-694.714] (-694.059) (-695.667) (-694.420) * (-691.496) (-692.813) (-691.887) [-692.823] -- 0:00:28
      563500 -- (-691.880) [-696.581] (-691.429) (-692.960) * (-695.455) (-692.942) [-691.858] (-692.607) -- 0:00:28
      564000 -- (-692.818) [-695.605] (-691.775) (-693.146) * (-696.049) [-692.535] (-697.432) (-695.761) -- 0:00:28
      564500 -- (-695.586) (-694.328) (-693.148) [-692.780] * [-693.687] (-691.740) (-692.871) (-695.136) -- 0:00:28
      565000 -- (-695.281) (-693.505) (-696.572) [-689.906] * (-698.352) (-693.538) [-692.556] (-692.449) -- 0:00:28

      Average standard deviation of split frequencies: 0.011415

      565500 -- (-692.458) (-695.892) (-693.465) [-692.342] * (-696.091) [-692.169] (-692.357) (-691.076) -- 0:00:28
      566000 -- (-691.401) (-694.316) [-692.718] (-691.985) * [-692.165] (-694.384) (-694.345) (-695.422) -- 0:00:28
      566500 -- (-696.632) (-695.544) (-695.034) [-693.509] * (-694.384) (-693.910) [-693.385] (-695.482) -- 0:00:28
      567000 -- (-692.644) (-695.923) (-691.588) [-691.804] * [-692.691] (-694.737) (-697.412) (-692.804) -- 0:00:28
      567500 -- (-696.211) [-691.821] (-692.571) (-692.051) * (-691.536) (-691.346) [-691.746] (-693.175) -- 0:00:28
      568000 -- (-694.770) (-694.848) [-693.569] (-692.772) * [-692.052] (-692.268) (-695.310) (-694.312) -- 0:00:28
      568500 -- (-694.492) (-691.417) (-692.587) [-697.748] * (-693.844) (-692.747) [-694.634] (-691.682) -- 0:00:28
      569000 -- (-696.518) (-693.884) (-695.612) [-693.734] * [-691.614] (-693.586) (-695.584) (-692.996) -- 0:00:28
      569500 -- [-691.854] (-694.245) (-695.716) (-691.124) * [-691.141] (-693.341) (-692.358) (-693.378) -- 0:00:27
      570000 -- (-690.675) (-692.658) (-693.045) [-693.274] * (-698.935) [-698.487] (-695.938) (-694.873) -- 0:00:27

      Average standard deviation of split frequencies: 0.011225

      570500 -- (-691.826) (-692.941) (-691.575) [-695.861] * (-689.990) (-691.550) [-692.541] (-698.771) -- 0:00:27
      571000 -- (-694.139) [-692.956] (-696.199) (-693.186) * (-693.055) [-693.901] (-695.955) (-695.088) -- 0:00:27
      571500 -- (-695.626) [-692.760] (-695.911) (-693.646) * (-693.388) [-694.517] (-695.466) (-696.238) -- 0:00:27
      572000 -- (-692.828) (-692.824) (-693.061) [-692.852] * (-694.093) [-693.796] (-695.342) (-691.978) -- 0:00:27
      572500 -- (-691.544) [-691.070] (-695.963) (-690.691) * (-692.531) (-697.142) (-697.427) [-692.862] -- 0:00:27
      573000 -- [-692.311] (-691.478) (-697.070) (-700.140) * [-692.262] (-690.730) (-691.306) (-694.523) -- 0:00:27
      573500 -- (-693.641) [-692.802] (-699.482) (-691.688) * (-691.915) (-697.930) (-696.757) [-693.757] -- 0:00:27
      574000 -- (-698.995) (-692.866) [-695.184] (-692.829) * (-692.331) [-691.330] (-692.406) (-692.401) -- 0:00:27
      574500 -- (-692.565) (-692.972) [-694.000] (-692.764) * (-691.577) (-696.514) (-691.836) [-691.951] -- 0:00:27
      575000 -- (-692.342) (-694.817) (-696.638) [-692.168] * (-692.954) [-692.489] (-697.311) (-695.730) -- 0:00:28

      Average standard deviation of split frequencies: 0.011410

      575500 -- [-692.930] (-696.679) (-696.331) (-696.030) * (-692.318) [-690.895] (-695.685) (-694.779) -- 0:00:28
      576000 -- [-690.909] (-691.500) (-692.297) (-693.526) * [-691.846] (-694.611) (-697.830) (-694.176) -- 0:00:27
      576500 -- (-694.878) (-696.245) [-696.130] (-693.168) * (-692.844) [-696.903] (-699.294) (-695.831) -- 0:00:27
      577000 -- (-691.969) (-695.435) (-701.220) [-696.064] * [-696.879] (-692.044) (-697.707) (-695.074) -- 0:00:27
      577500 -- (-696.668) [-693.216] (-694.391) (-691.093) * (-697.729) [-694.428] (-693.815) (-695.414) -- 0:00:27
      578000 -- (-693.081) (-692.249) [-692.929] (-691.878) * (-703.110) (-695.088) [-690.620] (-692.965) -- 0:00:27
      578500 -- (-698.558) (-695.220) (-692.472) [-691.683] * (-695.539) (-692.459) (-691.300) [-693.407] -- 0:00:27
      579000 -- (-697.456) (-696.808) [-693.444] (-693.738) * [-693.753] (-694.243) (-691.312) (-696.526) -- 0:00:27
      579500 -- (-697.758) (-696.620) (-693.542) [-692.078] * (-693.968) (-697.047) [-692.692] (-693.953) -- 0:00:27
      580000 -- (-694.387) [-691.161] (-690.619) (-690.056) * (-696.386) (-692.513) [-691.655] (-696.376) -- 0:00:27

      Average standard deviation of split frequencies: 0.011461

      580500 -- (-694.606) (-694.774) (-692.782) [-693.905] * (-698.195) (-692.116) (-693.701) [-692.743] -- 0:00:27
      581000 -- (-693.845) [-692.076] (-695.332) (-697.376) * [-696.493] (-695.390) (-696.094) (-693.095) -- 0:00:27
      581500 -- (-696.713) [-692.757] (-693.224) (-693.201) * (-698.663) (-695.014) [-692.575] (-698.607) -- 0:00:27
      582000 -- (-690.774) [-694.021] (-692.321) (-694.348) * (-695.009) (-694.227) (-692.180) [-692.401] -- 0:00:27
      582500 -- [-692.031] (-694.660) (-695.132) (-691.505) * [-692.220] (-694.710) (-692.125) (-693.158) -- 0:00:27
      583000 -- (-692.695) (-695.748) [-691.720] (-691.665) * (-696.276) (-692.596) (-695.935) [-692.085] -- 0:00:27
      583500 -- (-695.715) (-695.322) (-694.643) [-697.731] * (-696.237) (-699.390) (-697.385) [-693.092] -- 0:00:27
      584000 -- (-693.664) [-694.252] (-693.204) (-691.966) * (-695.833) (-697.708) [-693.391] (-693.467) -- 0:00:27
      584500 -- [-690.580] (-696.367) (-701.279) (-696.080) * (-694.019) (-696.745) [-692.760] (-691.582) -- 0:00:27
      585000 -- [-694.028] (-696.171) (-694.087) (-693.756) * (-694.733) (-695.470) [-692.738] (-695.428) -- 0:00:26

      Average standard deviation of split frequencies: 0.011128

      585500 -- (-693.569) [-692.300] (-692.924) (-692.872) * (-695.945) [-693.101] (-694.146) (-696.351) -- 0:00:26
      586000 -- (-692.760) [-691.982] (-695.206) (-693.710) * (-695.114) [-692.315] (-696.094) (-696.116) -- 0:00:26
      586500 -- [-693.854] (-692.456) (-697.460) (-694.425) * (-697.437) (-695.266) (-696.659) [-695.660] -- 0:00:26
      587000 -- (-692.918) (-693.863) [-696.702] (-695.154) * [-691.343] (-693.834) (-698.747) (-695.507) -- 0:00:26
      587500 -- (-697.513) (-700.518) [-692.557] (-698.664) * (-691.922) [-695.142] (-693.570) (-693.966) -- 0:00:26
      588000 -- (-696.489) [-696.046] (-690.107) (-696.181) * (-693.387) (-691.790) (-693.316) [-693.577] -- 0:00:26
      588500 -- (-697.151) [-695.343] (-691.721) (-693.117) * (-692.377) [-690.971] (-692.495) (-693.359) -- 0:00:26
      589000 -- (-691.972) (-693.329) (-691.358) [-695.832] * [-693.093] (-691.053) (-691.773) (-695.232) -- 0:00:26
      589500 -- (-694.937) (-695.439) [-692.908] (-701.172) * (-691.418) (-696.196) [-692.800] (-695.754) -- 0:00:26
      590000 -- (-692.717) (-694.199) (-694.677) [-694.896] * (-698.854) [-690.707] (-693.803) (-694.968) -- 0:00:27

      Average standard deviation of split frequencies: 0.011314

      590500 -- (-692.750) (-694.901) (-700.760) [-693.966] * (-697.169) [-693.309] (-692.834) (-694.545) -- 0:00:27
      591000 -- [-696.209] (-697.851) (-698.454) (-694.359) * [-694.222] (-691.954) (-693.296) (-694.462) -- 0:00:26
      591500 -- [-698.687] (-692.715) (-694.277) (-697.284) * (-691.196) (-693.076) [-695.227] (-694.425) -- 0:00:26
      592000 -- (-691.274) (-692.211) [-692.332] (-692.598) * (-693.022) (-705.502) [-693.611] (-696.719) -- 0:00:26
      592500 -- [-692.547] (-696.016) (-693.479) (-692.179) * (-694.839) [-691.800] (-694.363) (-697.227) -- 0:00:26
      593000 -- (-694.190) [-693.292] (-693.492) (-690.126) * (-693.883) (-692.241) (-694.542) [-700.617] -- 0:00:26
      593500 -- (-693.164) (-691.980) (-693.108) [-692.117] * (-693.890) [-690.885] (-696.957) (-694.196) -- 0:00:26
      594000 -- (-693.106) [-692.461] (-698.691) (-689.952) * [-694.171] (-694.423) (-697.896) (-693.578) -- 0:00:26
      594500 -- [-692.087] (-699.931) (-693.273) (-692.253) * (-694.655) (-696.091) [-691.231] (-693.395) -- 0:00:26
      595000 -- (-693.335) (-693.984) (-692.577) [-691.352] * [-691.706] (-693.055) (-693.719) (-695.396) -- 0:00:26

      Average standard deviation of split frequencies: 0.011117

      595500 -- (-695.113) [-693.186] (-693.388) (-695.498) * (-693.075) (-697.198) [-692.415] (-693.807) -- 0:00:26
      596000 -- [-697.403] (-693.118) (-694.387) (-694.125) * (-691.912) (-696.964) [-693.719] (-693.383) -- 0:00:26
      596500 -- (-692.202) (-692.102) [-692.735] (-696.942) * [-694.532] (-698.062) (-692.455) (-695.123) -- 0:00:26
      597000 -- [-696.508] (-690.817) (-691.222) (-692.399) * (-693.709) (-697.181) (-692.518) [-693.948] -- 0:00:26
      597500 -- [-692.792] (-693.571) (-695.781) (-693.660) * (-694.932) [-694.123] (-693.684) (-693.641) -- 0:00:26
      598000 -- (-696.270) [-691.412] (-692.500) (-696.010) * (-694.502) (-695.275) [-691.891] (-695.023) -- 0:00:26
      598500 -- (-693.496) [-693.446] (-696.315) (-691.297) * (-693.329) [-692.527] (-695.556) (-697.989) -- 0:00:26
      599000 -- (-697.244) (-694.047) (-693.327) [-695.824] * [-692.684] (-691.833) (-696.826) (-691.795) -- 0:00:26
      599500 -- (-692.847) (-697.535) (-691.132) [-690.199] * [-691.637] (-693.420) (-694.670) (-695.764) -- 0:00:26
      600000 -- [-692.855] (-694.810) (-696.774) (-694.771) * (-694.046) (-691.827) [-692.030] (-693.796) -- 0:00:25

      Average standard deviation of split frequencies: 0.011554

      600500 -- [-697.239] (-692.322) (-694.834) (-693.754) * [-692.438] (-695.397) (-692.496) (-696.104) -- 0:00:25
      601000 -- (-693.386) (-692.124) [-689.558] (-692.941) * (-695.207) (-696.049) (-691.406) [-694.498] -- 0:00:25
      601500 -- (-696.540) (-693.401) (-693.901) [-697.262] * [-694.488] (-692.839) (-693.817) (-694.085) -- 0:00:25
      602000 -- [-695.956] (-700.356) (-694.082) (-697.592) * (-694.284) (-693.064) (-693.085) [-691.629] -- 0:00:25
      602500 -- (-695.744) (-694.284) [-694.120] (-694.329) * [-693.128] (-694.519) (-693.560) (-696.392) -- 0:00:25
      603000 -- (-690.722) (-694.698) (-695.659) [-692.684] * (-691.689) [-695.221] (-694.244) (-692.864) -- 0:00:25
      603500 -- (-693.112) (-704.821) [-692.385] (-695.791) * (-695.492) [-690.944] (-700.296) (-694.492) -- 0:00:25
      604000 -- (-693.500) (-691.561) (-692.528) [-693.967] * (-693.498) [-696.199] (-694.999) (-697.347) -- 0:00:25
      604500 -- (-694.680) [-692.397] (-697.764) (-695.310) * [-696.883] (-694.183) (-694.812) (-694.552) -- 0:00:26
      605000 -- [-694.736] (-691.098) (-693.672) (-695.363) * (-693.143) (-692.421) (-693.954) [-694.494] -- 0:00:26

      Average standard deviation of split frequencies: 0.012187

      605500 -- (-696.810) (-692.018) (-692.050) [-695.259] * (-692.390) [-693.376] (-693.595) (-694.429) -- 0:00:26
      606000 -- (-692.867) (-692.887) (-695.806) [-693.987] * [-692.973] (-693.671) (-693.198) (-695.289) -- 0:00:26
      606500 -- (-691.453) (-696.593) (-695.221) [-695.143] * [-694.875] (-694.828) (-697.729) (-695.652) -- 0:00:25
      607000 -- (-694.078) (-692.246) [-693.065] (-694.906) * [-695.815] (-694.066) (-692.891) (-696.616) -- 0:00:25
      607500 -- (-696.891) [-692.649] (-696.217) (-692.339) * [-696.737] (-693.024) (-693.421) (-691.802) -- 0:00:25
      608000 -- [-694.917] (-694.556) (-694.329) (-696.197) * (-699.656) [-693.469] (-693.269) (-691.969) -- 0:00:25
      608500 -- (-691.376) (-693.428) (-693.900) [-692.997] * (-694.794) [-692.693] (-692.348) (-693.308) -- 0:00:25
      609000 -- (-692.582) (-696.774) (-690.555) [-695.137] * (-697.745) [-694.205] (-694.556) (-691.265) -- 0:00:25
      609500 -- (-693.160) (-693.684) (-693.871) [-693.843] * (-695.376) [-693.325] (-694.501) (-697.616) -- 0:00:25
      610000 -- [-692.594] (-694.903) (-693.777) (-692.842) * (-696.045) (-693.772) [-692.847] (-695.482) -- 0:00:25

      Average standard deviation of split frequencies: 0.012094

      610500 -- (-693.970) [-693.210] (-694.597) (-696.745) * (-690.383) (-693.579) (-691.386) [-691.166] -- 0:00:25
      611000 -- (-696.146) [-693.069] (-689.532) (-694.210) * (-691.741) (-694.788) (-694.033) [-694.224] -- 0:00:25
      611500 -- (-693.984) (-692.866) (-693.403) [-693.282] * (-693.003) (-692.079) [-691.545] (-696.555) -- 0:00:25
      612000 -- (-693.985) (-696.333) [-692.217] (-693.736) * [-693.644] (-694.123) (-691.635) (-690.400) -- 0:00:25
      612500 -- (-694.689) [-694.027] (-693.861) (-695.217) * (-692.050) (-699.311) [-695.693] (-692.859) -- 0:00:25
      613000 -- (-694.186) (-693.304) (-694.302) [-692.273] * (-692.220) (-696.305) (-694.833) [-693.512] -- 0:00:25
      613500 -- (-694.630) (-695.079) [-692.137] (-693.685) * [-695.705] (-691.753) (-693.648) (-693.673) -- 0:00:25
      614000 -- [-693.135] (-696.267) (-694.355) (-695.315) * (-698.479) (-692.842) (-691.870) [-692.976] -- 0:00:25
      614500 -- [-691.864] (-695.695) (-694.770) (-695.945) * (-693.190) (-695.628) [-694.104] (-695.822) -- 0:00:25
      615000 -- (-694.486) (-697.612) [-696.240] (-696.603) * (-695.550) (-695.055) (-693.109) [-693.686] -- 0:00:25

      Average standard deviation of split frequencies: 0.012499

      615500 -- (-695.490) (-691.427) (-694.998) [-693.069] * [-693.085] (-693.661) (-692.064) (-700.911) -- 0:00:24
      616000 -- (-694.734) (-696.120) (-696.117) [-694.715] * (-692.043) (-692.928) (-692.688) [-692.624] -- 0:00:24
      616500 -- [-693.034] (-696.006) (-696.802) (-694.576) * (-693.974) (-690.463) [-692.677] (-693.455) -- 0:00:24
      617000 -- (-693.881) (-697.152) [-691.467] (-695.455) * (-698.221) [-693.133] (-692.826) (-692.599) -- 0:00:24
      617500 -- [-691.313] (-693.176) (-694.933) (-694.752) * (-697.017) (-692.371) [-690.500] (-694.577) -- 0:00:24
      618000 -- [-692.196] (-696.260) (-695.274) (-697.793) * [-690.837] (-691.743) (-691.347) (-693.863) -- 0:00:24
      618500 -- (-691.530) (-695.631) (-694.057) [-698.506] * [-692.278] (-693.516) (-692.480) (-694.097) -- 0:00:24
      619000 -- (-693.840) [-693.710] (-694.116) (-694.368) * (-696.536) [-694.357] (-693.596) (-694.546) -- 0:00:24
      619500 -- (-692.737) (-693.931) (-695.476) [-695.377] * [-695.580] (-693.650) (-692.836) (-694.126) -- 0:00:24
      620000 -- (-698.879) (-695.918) [-693.804] (-694.431) * (-693.951) (-693.298) [-692.983] (-695.661) -- 0:00:25

      Average standard deviation of split frequencies: 0.012405

      620500 -- (-693.783) (-693.916) [-690.417] (-694.333) * (-694.207) (-693.970) [-696.426] (-692.840) -- 0:00:25
      621000 -- (-692.430) (-694.796) [-692.023] (-695.005) * (-693.143) [-694.732] (-694.855) (-693.242) -- 0:00:25
      621500 -- (-695.808) (-695.976) (-692.116) [-697.905] * (-693.777) [-693.110] (-694.406) (-693.720) -- 0:00:24
      622000 -- [-693.363] (-696.192) (-693.454) (-695.397) * [-694.482] (-695.062) (-691.992) (-692.439) -- 0:00:24
      622500 -- (-695.443) [-693.887] (-697.824) (-696.035) * (-694.051) [-693.594] (-693.161) (-696.476) -- 0:00:24
      623000 -- [-690.817] (-692.789) (-697.326) (-696.415) * (-692.416) (-696.517) (-693.348) [-695.898] -- 0:00:24
      623500 -- [-691.577] (-692.375) (-695.299) (-697.324) * (-694.317) (-694.469) (-698.620) [-691.689] -- 0:00:24
      624000 -- (-692.094) [-696.524] (-698.431) (-694.842) * (-694.016) (-695.274) [-691.455] (-691.657) -- 0:00:24
      624500 -- (-692.489) (-693.730) [-692.288] (-696.687) * [-694.867] (-695.799) (-689.923) (-694.569) -- 0:00:24
      625000 -- [-691.967] (-695.433) (-694.494) (-694.411) * (-698.026) (-695.162) [-696.087] (-694.015) -- 0:00:24

      Average standard deviation of split frequencies: 0.011798

      625500 -- (-692.833) (-692.475) (-695.349) [-693.201] * (-691.950) (-693.478) (-692.496) [-694.202] -- 0:00:24
      626000 -- [-693.819] (-695.769) (-695.645) (-693.265) * (-692.074) (-695.610) [-694.828] (-692.543) -- 0:00:24
      626500 -- (-695.201) (-694.158) [-694.822] (-695.293) * (-693.550) [-697.075] (-694.584) (-694.216) -- 0:00:24
      627000 -- [-697.804] (-695.892) (-696.257) (-693.316) * [-693.811] (-693.795) (-693.607) (-694.598) -- 0:00:24
      627500 -- [-692.813] (-697.475) (-699.381) (-695.718) * (-693.593) [-696.069] (-694.939) (-693.642) -- 0:00:24
      628000 -- (-692.759) (-697.372) (-692.376) [-697.289] * (-697.768) (-691.110) (-695.376) [-695.166] -- 0:00:24
      628500 -- [-693.060] (-694.305) (-694.029) (-691.531) * [-696.031] (-696.813) (-695.666) (-691.718) -- 0:00:24
      629000 -- [-693.356] (-692.504) (-695.849) (-692.917) * (-698.387) (-694.362) (-698.083) [-691.351] -- 0:00:24
      629500 -- (-694.206) (-691.326) [-693.045] (-700.963) * (-694.732) (-697.071) (-692.897) [-691.926] -- 0:00:24
      630000 -- [-695.723] (-693.716) (-695.223) (-694.090) * (-693.589) (-695.160) (-694.555) [-698.066] -- 0:00:24

      Average standard deviation of split frequencies: 0.012399

      630500 -- (-692.564) [-693.942] (-693.868) (-692.673) * (-692.842) [-696.744] (-695.368) (-693.538) -- 0:00:24
      631000 -- (-693.995) (-693.485) (-694.146) [-694.265] * (-691.737) (-695.433) (-694.761) [-693.018] -- 0:00:23
      631500 -- (-693.045) [-694.702] (-698.915) (-695.398) * (-695.030) (-694.232) [-693.473] (-692.962) -- 0:00:23
      632000 -- (-692.542) (-695.113) (-695.518) [-693.001] * [-691.744] (-694.893) (-693.461) (-693.003) -- 0:00:23
      632500 -- (-690.633) (-692.820) (-693.764) [-693.659] * (-694.111) (-693.281) [-695.750] (-693.331) -- 0:00:23
      633000 -- [-694.186] (-691.980) (-697.043) (-694.286) * (-695.911) (-693.986) (-691.657) [-695.392] -- 0:00:23
      633500 -- (-692.243) (-692.869) [-694.476] (-692.448) * [-693.602] (-694.483) (-691.812) (-707.784) -- 0:00:23
      634000 -- (-699.506) (-693.179) (-692.627) [-695.486] * (-696.210) [-693.069] (-693.896) (-697.240) -- 0:00:23
      634500 -- [-689.922] (-692.549) (-692.955) (-694.524) * (-693.423) [-696.064] (-695.044) (-693.415) -- 0:00:23
      635000 -- (-691.712) (-693.679) [-692.139] (-694.826) * (-691.572) [-695.784] (-692.896) (-692.289) -- 0:00:23

      Average standard deviation of split frequencies: 0.011859

      635500 -- (-694.891) [-690.905] (-691.615) (-691.105) * (-695.886) (-696.667) (-695.770) [-695.971] -- 0:00:24
      636000 -- (-696.193) (-692.090) (-693.936) [-692.534] * [-693.670] (-697.222) (-691.970) (-696.402) -- 0:00:24
      636500 -- [-694.424] (-693.043) (-692.474) (-693.998) * (-692.974) (-697.909) [-693.610] (-694.188) -- 0:00:23
      637000 -- (-692.766) (-692.820) [-690.614] (-696.011) * (-692.601) [-695.866] (-695.983) (-695.549) -- 0:00:23
      637500 -- [-695.246] (-693.049) (-694.475) (-693.236) * (-696.339) [-692.167] (-693.337) (-696.113) -- 0:00:23
      638000 -- (-694.603) [-690.557] (-693.340) (-692.933) * (-694.706) [-693.844] (-691.985) (-695.323) -- 0:00:23
      638500 -- [-692.987] (-691.677) (-691.936) (-691.208) * (-692.675) (-696.401) [-691.134] (-695.444) -- 0:00:23
      639000 -- (-694.812) (-694.004) (-694.482) [-692.787] * (-695.068) (-694.358) [-692.149] (-695.727) -- 0:00:23
      639500 -- (-692.594) (-693.938) (-691.634) [-693.177] * (-697.877) (-695.826) [-693.468] (-696.671) -- 0:00:23
      640000 -- (-691.994) [-694.722] (-693.340) (-692.164) * [-694.393] (-696.325) (-693.590) (-696.868) -- 0:00:23

      Average standard deviation of split frequencies: 0.012509

      640500 -- [-696.220] (-693.569) (-697.345) (-691.472) * [-693.644] (-698.850) (-694.535) (-703.754) -- 0:00:23
      641000 -- [-695.822] (-695.803) (-692.035) (-693.653) * (-693.079) (-694.463) [-690.633] (-700.012) -- 0:00:23
      641500 -- (-694.471) (-694.285) [-693.632] (-690.726) * (-691.876) (-695.277) [-690.791] (-693.806) -- 0:00:23
      642000 -- (-694.774) (-693.587) (-692.227) [-695.436] * (-693.170) (-694.083) [-692.219] (-697.035) -- 0:00:23
      642500 -- (-694.336) (-690.964) [-691.440] (-691.581) * (-693.142) [-693.065] (-692.571) (-693.071) -- 0:00:23
      643000 -- (-691.999) (-694.525) (-692.059) [-691.070] * [-692.406] (-697.446) (-691.991) (-694.340) -- 0:00:23
      643500 -- (-691.892) (-699.184) [-691.058] (-693.873) * [-690.673] (-696.118) (-697.285) (-692.838) -- 0:00:23
      644000 -- [-694.746] (-692.794) (-693.961) (-693.381) * (-691.406) (-696.905) (-703.979) [-693.274] -- 0:00:23
      644500 -- (-695.128) (-693.855) [-691.883] (-698.547) * (-693.056) (-696.822) [-695.204] (-691.456) -- 0:00:23
      645000 -- (-693.915) (-695.798) (-691.517) [-691.898] * (-695.928) (-695.453) (-695.256) [-693.389] -- 0:00:23

      Average standard deviation of split frequencies: 0.011919

      645500 -- (-693.890) (-695.208) [-690.464] (-696.196) * (-692.845) [-694.776] (-693.955) (-696.869) -- 0:00:23
      646000 -- (-692.799) (-693.382) (-695.783) [-691.257] * (-692.489) (-697.640) [-694.410] (-695.612) -- 0:00:23
      646500 -- [-691.953] (-691.615) (-692.910) (-694.521) * [-692.236] (-699.675) (-693.324) (-692.933) -- 0:00:22
      647000 -- (-693.714) (-694.680) [-696.803] (-691.796) * [-692.345] (-696.435) (-694.447) (-695.174) -- 0:00:22
      647500 -- (-691.812) (-692.414) (-694.954) [-691.181] * (-692.869) [-692.982] (-695.554) (-693.221) -- 0:00:22
      648000 -- (-692.859) (-692.208) [-693.844] (-698.555) * (-691.457) [-694.769] (-693.573) (-692.033) -- 0:00:22
      648500 -- [-693.916] (-689.917) (-697.291) (-696.171) * (-693.191) [-694.477] (-694.189) (-695.940) -- 0:00:22
      649000 -- (-695.449) (-690.358) [-695.224] (-691.610) * (-692.739) (-692.506) (-699.484) [-691.878] -- 0:00:22
      649500 -- [-695.803] (-693.724) (-696.114) (-690.183) * (-694.387) [-695.308] (-695.311) (-692.305) -- 0:00:22
      650000 -- [-692.945] (-693.907) (-695.417) (-697.102) * [-692.339] (-694.748) (-694.096) (-691.446) -- 0:00:22

      Average standard deviation of split frequencies: 0.012231

      650500 -- (-695.078) (-697.405) (-694.875) [-691.434] * (-693.455) (-693.989) [-691.629] (-693.327) -- 0:00:22
      651000 -- [-693.424] (-696.117) (-693.558) (-691.788) * [-692.469] (-694.802) (-695.040) (-695.350) -- 0:00:23
      651500 -- (-693.948) (-691.165) (-692.663) [-696.186] * (-693.234) (-692.762) (-690.809) [-693.554] -- 0:00:23
      652000 -- (-696.143) (-693.717) [-691.894] (-694.897) * (-697.455) (-693.290) [-690.770] (-692.633) -- 0:00:22
      652500 -- (-692.802) [-691.411] (-693.731) (-693.674) * [-693.322] (-697.724) (-694.432) (-699.324) -- 0:00:22
      653000 -- [-694.965] (-694.463) (-695.325) (-693.314) * (-696.530) (-696.317) [-692.387] (-692.031) -- 0:00:22
      653500 -- [-693.765] (-692.941) (-695.848) (-692.703) * [-694.918] (-693.343) (-695.474) (-692.554) -- 0:00:22
      654000 -- (-694.288) (-696.257) (-696.892) [-692.267] * (-697.468) (-697.527) (-696.258) [-690.704] -- 0:00:22
      654500 -- [-696.595] (-697.661) (-698.571) (-695.032) * (-693.090) (-695.656) (-692.108) [-691.470] -- 0:00:22
      655000 -- (-694.891) [-694.822] (-694.487) (-694.708) * (-693.299) (-694.106) [-692.362] (-691.901) -- 0:00:22

      Average standard deviation of split frequencies: 0.012216

      655500 -- (-695.470) [-693.742] (-693.477) (-693.382) * (-694.607) (-692.901) (-696.851) [-693.262] -- 0:00:22
      656000 -- (-692.442) [-692.595] (-694.709) (-695.338) * [-692.798] (-696.801) (-695.706) (-697.654) -- 0:00:22
      656500 -- [-693.859] (-694.049) (-694.437) (-692.470) * (-693.291) (-692.084) [-692.596] (-698.723) -- 0:00:22
      657000 -- (-693.207) (-694.114) [-691.634] (-692.816) * [-693.688] (-695.738) (-693.766) (-693.431) -- 0:00:22
      657500 -- (-693.936) [-695.047] (-691.133) (-691.719) * (-694.585) (-692.674) [-690.368] (-693.916) -- 0:00:22
      658000 -- (-694.177) (-693.948) (-694.524) [-692.889] * (-696.136) (-693.649) [-695.555] (-696.182) -- 0:00:22
      658500 -- (-692.692) (-693.597) [-696.315] (-691.205) * (-696.920) (-694.277) (-694.015) [-692.446] -- 0:00:22
      659000 -- (-693.902) (-695.134) [-692.178] (-695.531) * (-694.727) [-693.537] (-693.495) (-696.101) -- 0:00:22
      659500 -- (-692.639) (-694.139) (-694.608) [-693.656] * (-696.386) (-693.106) (-691.289) [-693.681] -- 0:00:22
      660000 -- (-692.330) (-696.152) [-693.119] (-696.218) * (-693.542) (-691.889) [-693.040] (-693.465) -- 0:00:22

      Average standard deviation of split frequencies: 0.011878

      660500 -- [-697.574] (-694.372) (-695.752) (-691.125) * (-695.666) [-693.802] (-692.688) (-694.378) -- 0:00:22
      661000 -- (-705.791) [-695.113] (-693.919) (-692.793) * (-692.597) (-695.146) (-692.192) [-693.390] -- 0:00:22
      661500 -- (-695.519) (-696.408) [-692.068] (-694.631) * (-694.184) [-693.042] (-692.320) (-697.616) -- 0:00:22
      662000 -- (-697.657) [-692.680] (-694.699) (-697.707) * (-696.747) [-692.589] (-693.568) (-696.007) -- 0:00:21
      662500 -- (-695.756) [-691.408] (-696.090) (-700.747) * (-696.540) [-693.156] (-692.849) (-697.060) -- 0:00:21
      663000 -- (-695.148) (-692.941) [-694.602] (-694.980) * (-695.254) (-694.427) [-691.275] (-696.227) -- 0:00:21
      663500 -- [-698.969] (-694.699) (-694.852) (-695.133) * (-696.363) (-691.679) [-693.880] (-696.691) -- 0:00:21
      664000 -- (-695.850) (-693.020) [-693.916] (-698.562) * [-695.816] (-690.626) (-691.427) (-695.856) -- 0:00:21
      664500 -- (-694.170) [-689.525] (-696.928) (-693.419) * (-694.699) (-691.888) [-695.461] (-693.856) -- 0:00:21
      665000 -- [-693.515] (-691.816) (-700.153) (-692.218) * (-699.824) (-691.083) [-698.100] (-697.321) -- 0:00:21

      Average standard deviation of split frequencies: 0.011866

      665500 -- (-693.242) [-692.239] (-690.634) (-689.952) * (-691.695) [-695.590] (-694.823) (-692.055) -- 0:00:21
      666000 -- (-695.634) (-693.965) (-695.126) [-693.690] * [-693.384] (-696.293) (-694.165) (-692.878) -- 0:00:21
      666500 -- (-692.837) (-694.050) [-694.502] (-695.392) * (-694.123) (-691.955) [-697.312] (-696.411) -- 0:00:22
      667000 -- (-696.803) (-695.048) (-694.323) [-692.188] * (-696.295) (-696.202) (-697.591) [-695.024] -- 0:00:21
      667500 -- (-695.780) (-693.462) [-691.351] (-694.783) * (-694.294) (-693.810) (-696.844) [-690.540] -- 0:00:21
      668000 -- (-697.035) (-695.925) [-693.001] (-694.317) * (-692.944) [-692.060] (-695.549) (-692.782) -- 0:00:21
      668500 -- (-691.705) (-693.916) (-691.621) [-692.072] * (-692.569) (-695.200) [-694.976] (-694.360) -- 0:00:21
      669000 -- (-695.069) [-697.076] (-698.591) (-695.796) * (-695.684) (-697.494) (-691.606) [-693.902] -- 0:00:21
      669500 -- (-695.117) (-694.691) (-691.028) [-694.279] * (-694.595) (-694.912) [-691.809] (-695.211) -- 0:00:21
      670000 -- (-695.097) (-693.939) [-692.222] (-693.616) * (-695.705) (-696.093) (-694.004) [-695.528] -- 0:00:21

      Average standard deviation of split frequencies: 0.011027

      670500 -- (-695.589) [-692.343] (-691.489) (-690.664) * (-696.816) (-694.697) [-694.658] (-694.336) -- 0:00:21
      671000 -- (-695.067) (-697.139) (-697.471) [-699.961] * (-696.989) [-694.341] (-702.706) (-697.164) -- 0:00:21
      671500 -- (-693.801) [-699.375] (-694.137) (-699.054) * (-691.514) (-696.557) [-698.697] (-701.830) -- 0:00:21
      672000 -- (-693.157) [-692.039] (-695.371) (-697.404) * (-692.599) [-690.317] (-695.880) (-695.118) -- 0:00:21
      672500 -- (-694.533) [-693.706] (-691.888) (-700.513) * [-697.000] (-694.716) (-692.849) (-695.499) -- 0:00:21
      673000 -- [-692.647] (-693.412) (-691.545) (-694.548) * (-694.333) (-693.901) (-692.703) [-692.725] -- 0:00:21
      673500 -- (-694.454) (-693.033) (-692.419) [-692.194] * [-693.030] (-691.010) (-699.269) (-696.188) -- 0:00:21
      674000 -- (-692.831) [-691.846] (-695.010) (-692.660) * (-694.725) [-695.329] (-695.901) (-697.160) -- 0:00:21
      674500 -- [-690.637] (-693.476) (-692.583) (-691.850) * [-693.070] (-698.296) (-696.043) (-696.478) -- 0:00:21
      675000 -- (-691.581) (-694.316) [-695.090] (-693.072) * (-697.253) [-695.431] (-696.499) (-695.778) -- 0:00:21

      Average standard deviation of split frequencies: 0.010765

      675500 -- (-693.749) [-692.312] (-692.295) (-697.081) * [-691.915] (-694.359) (-698.872) (-694.243) -- 0:00:21
      676000 -- (-697.657) (-696.712) (-692.723) [-693.668] * [-698.716] (-693.045) (-694.082) (-694.796) -- 0:00:21
      676500 -- (-692.319) (-693.295) [-695.136] (-696.518) * (-693.583) (-692.738) (-693.877) [-694.271] -- 0:00:21
      677000 -- [-692.139] (-697.295) (-694.235) (-692.390) * (-695.539) [-695.444] (-695.157) (-698.641) -- 0:00:20
      677500 -- (-692.762) (-698.152) (-694.125) [-691.104] * (-695.971) (-700.385) [-693.310] (-698.904) -- 0:00:20
      678000 -- (-693.721) (-691.391) (-695.231) [-692.739] * (-695.175) (-695.771) [-694.794] (-697.080) -- 0:00:20
      678500 -- [-690.344] (-698.170) (-695.801) (-696.510) * (-695.440) (-691.537) [-693.316] (-698.854) -- 0:00:20
      679000 -- (-695.176) [-696.716] (-700.155) (-695.850) * (-696.094) [-695.762] (-693.880) (-694.485) -- 0:00:20
      679500 -- (-693.048) (-694.175) [-691.363] (-691.190) * (-695.538) (-692.830) (-693.709) [-692.675] -- 0:00:20
      680000 -- [-689.799] (-693.100) (-695.630) (-701.912) * (-694.695) [-694.367] (-690.645) (-695.582) -- 0:00:20

      Average standard deviation of split frequencies: 0.010908

      680500 -- [-695.783] (-695.434) (-694.866) (-694.494) * (-692.526) (-696.088) (-696.763) [-694.286] -- 0:00:20
      681000 -- (-698.220) (-692.860) (-693.741) [-692.213] * (-695.273) (-694.663) (-693.241) [-692.115] -- 0:00:20
      681500 -- (-698.404) (-692.542) [-693.197] (-692.706) * (-695.314) (-690.728) [-691.936] (-694.515) -- 0:00:21
      682000 -- (-694.524) [-694.955] (-700.674) (-695.426) * (-695.137) (-691.318) [-693.264] (-695.139) -- 0:00:20
      682500 -- (-694.877) (-693.230) [-691.461] (-691.809) * [-692.354] (-692.546) (-695.469) (-692.565) -- 0:00:20
      683000 -- (-691.793) (-694.264) [-696.992] (-693.230) * (-694.624) (-692.987) (-694.731) [-693.435] -- 0:00:20
      683500 -- [-691.823] (-696.868) (-693.516) (-692.800) * (-694.824) (-693.304) (-692.697) [-693.054] -- 0:00:20
      684000 -- (-693.207) (-694.395) [-693.336] (-695.220) * (-694.580) (-693.014) [-694.197] (-692.246) -- 0:00:20
      684500 -- [-693.262] (-693.122) (-692.481) (-693.375) * [-694.753] (-692.595) (-693.597) (-691.788) -- 0:00:20
      685000 -- [-692.077] (-697.364) (-695.722) (-696.075) * [-692.228] (-694.584) (-693.422) (-695.285) -- 0:00:20

      Average standard deviation of split frequencies: 0.010752

      685500 -- (-697.003) (-695.329) [-694.555] (-695.970) * [-693.488] (-696.171) (-693.260) (-695.800) -- 0:00:20
      686000 -- (-691.882) [-696.484] (-693.636) (-692.473) * (-697.354) (-694.619) [-696.944] (-694.682) -- 0:00:20
      686500 -- (-691.590) [-694.374] (-698.744) (-696.829) * (-694.948) (-693.252) (-695.698) [-694.226] -- 0:00:20
      687000 -- (-694.581) (-696.080) [-692.617] (-696.558) * (-694.564) (-695.821) [-692.369] (-695.728) -- 0:00:20
      687500 -- (-696.798) (-699.837) [-694.413] (-697.753) * (-696.768) (-693.185) (-694.086) [-693.162] -- 0:00:20
      688000 -- (-692.719) (-697.738) [-692.891] (-695.392) * (-695.083) [-691.495] (-694.858) (-696.368) -- 0:00:20
      688500 -- (-693.765) [-692.773] (-691.722) (-698.996) * (-694.133) (-693.921) (-693.575) [-692.895] -- 0:00:20
      689000 -- [-691.094] (-694.341) (-692.448) (-692.129) * [-692.518] (-696.389) (-694.410) (-692.478) -- 0:00:20
      689500 -- (-695.745) (-694.715) [-695.419] (-693.177) * (-695.257) [-695.632] (-696.644) (-691.080) -- 0:00:20
      690000 -- (-694.683) (-692.851) [-693.133] (-696.260) * (-692.037) [-699.729] (-692.203) (-692.911) -- 0:00:20

      Average standard deviation of split frequencies: 0.010622

      690500 -- (-695.026) (-694.087) [-693.770] (-696.271) * (-693.208) [-692.338] (-694.076) (-693.267) -- 0:00:20
      691000 -- (-693.516) (-695.649) (-694.420) [-695.544] * [-692.553] (-692.178) (-694.662) (-694.945) -- 0:00:20
      691500 -- (-691.732) (-694.125) [-693.408] (-696.629) * [-692.779] (-692.890) (-699.630) (-698.627) -- 0:00:20
      692000 -- (-692.430) (-696.989) [-691.091] (-697.015) * (-694.538) (-694.371) (-695.570) [-694.067] -- 0:00:20
      692500 -- (-696.303) (-699.686) [-691.632] (-696.890) * (-698.297) [-696.466] (-697.971) (-692.626) -- 0:00:19
      693000 -- (-691.916) (-695.396) (-693.368) [-695.598] * (-694.413) [-702.662] (-697.484) (-693.199) -- 0:00:19
      693500 -- (-692.194) (-698.906) [-697.445] (-694.548) * [-697.080] (-694.789) (-692.689) (-693.998) -- 0:00:19
      694000 -- (-694.333) (-693.950) [-695.668] (-692.146) * [-692.454] (-695.380) (-693.414) (-697.486) -- 0:00:19
      694500 -- (-693.099) [-695.123] (-691.709) (-691.942) * (-694.536) [-696.620] (-693.499) (-695.554) -- 0:00:19
      695000 -- (-691.982) (-699.244) (-696.505) [-690.935] * [-693.474] (-692.211) (-694.413) (-700.585) -- 0:00:19

      Average standard deviation of split frequencies: 0.010792

      695500 -- (-696.652) (-693.570) (-691.693) [-690.162] * (-692.899) (-693.685) (-693.078) [-693.431] -- 0:00:19
      696000 -- (-699.498) (-693.792) [-696.720] (-696.110) * (-691.289) (-692.378) [-693.037] (-697.081) -- 0:00:19
      696500 -- [-693.736] (-696.168) (-692.825) (-700.725) * (-692.512) (-693.291) [-691.164] (-698.002) -- 0:00:19
      697000 -- (-694.098) (-693.833) [-695.103] (-695.750) * (-692.646) (-692.812) [-691.427] (-696.028) -- 0:00:19
      697500 -- (-694.653) [-693.758] (-697.734) (-692.567) * (-692.502) (-691.520) (-691.121) [-696.249] -- 0:00:19
      698000 -- [-694.289] (-693.666) (-693.882) (-695.528) * (-693.583) (-695.267) (-693.423) [-694.692] -- 0:00:19
      698500 -- [-693.822] (-690.667) (-694.385) (-695.650) * (-695.877) (-695.241) [-692.315] (-693.231) -- 0:00:19
      699000 -- (-691.164) [-693.740] (-692.394) (-695.301) * (-691.345) (-695.104) [-690.918] (-691.883) -- 0:00:19
      699500 -- (-692.379) (-696.023) (-696.628) [-695.638] * (-694.331) (-693.424) [-692.256] (-693.701) -- 0:00:19
      700000 -- (-692.860) (-694.321) (-694.306) [-691.596] * [-695.325] (-694.721) (-691.855) (-691.54