--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:59:29 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2654/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -692.34 -697.87
2 -692.33 -696.53
--------------------------------------
TOTAL -692.34 -697.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.863616 0.087519 0.373989 1.484248 0.841070 1380.37 1440.68 1.000
r(A<->C){all} 0.168400 0.018747 0.000045 0.435323 0.134791 303.57 331.43 1.000
r(A<->G){all} 0.169294 0.021530 0.000120 0.470548 0.126976 183.29 218.93 1.004
r(A<->T){all} 0.133047 0.015185 0.000074 0.382133 0.096839 167.02 225.97 1.008
r(C<->G){all} 0.181319 0.021406 0.000072 0.471646 0.145929 214.86 225.31 1.011
r(C<->T){all} 0.130328 0.013976 0.000021 0.367920 0.097093 247.87 261.01 1.000
r(G<->T){all} 0.217613 0.024577 0.000426 0.529423 0.182453 164.21 201.79 1.004
pi(A){all} 0.235690 0.000352 0.201253 0.273276 0.235708 1010.30 1237.51 1.000
pi(C){all} 0.284092 0.000412 0.245927 0.325404 0.283466 1268.80 1341.40 1.000
pi(G){all} 0.290608 0.000399 0.250500 0.328380 0.290697 1057.12 1279.06 1.000
pi(T){all} 0.189610 0.000313 0.152821 0.221852 0.189100 1274.04 1353.65 1.000
alpha{1,2} 0.233803 0.057797 0.003509 0.628750 0.169601 1267.42 1384.21 1.000
alpha{3} 0.391240 0.209067 0.000150 1.351097 0.219084 1152.88 1260.69 1.000
pinvar{all} 0.992443 0.000039 0.981274 0.999766 0.993970 1442.90 1459.93 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -669.907009
Model 2: PositiveSelection -669.669216
Model 0: one-ratio -669.669203
Model 7: beta -669.90701
Model 8: beta&w>1 -669.669216
Model 0 vs 1 0.4756119999999555
Model 2 vs 1 0.47558600000002116
Model 8 vs 7 0.4755880000000161
>C1
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C2
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C3
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C4
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C5
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C6
MMLRLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=165
C1 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C2 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C3 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C4 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C5 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C6 MMLRLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
*** **********************************************
C1 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C2 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C3 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C4 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C5 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C6 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
**************************************************
C1 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C2 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C3 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C4 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C5 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C6 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
**************************************************
C1 DNGALTDVVVHPLEK
C2 DNGALTDVVVHPLEK
C3 DNGALTDVVVHPLEK
C4 DNGALTDVVVHPLEK
C5 DNGALTDVVVHPLEK
C6 DNGALTDVVVHPLEK
***************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4950]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4950]--->[4950]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.466 Mb, Max= 30.697 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C2 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C3 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C4 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C5 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
C6 MMLRLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
*** **********************************************
C1 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C2 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C3 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C4 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C5 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
C6 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
**************************************************
C1 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C2 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C3 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C4 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C5 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
C6 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
**************************************************
C1 DNGALTDVVVHPLEK
C2 DNGALTDVVVHPLEK
C3 DNGALTDVVVHPLEK
C4 DNGALTDVVVHPLEK
C5 DNGALTDVVVHPLEK
C6 DNGALTDVVVHPLEK
***************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.39 C1 C6 99.39
TOP 5 0 99.39 C6 C1 99.39
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.39 C2 C6 99.39
TOP 5 1 99.39 C6 C2 99.39
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.39 C3 C6 99.39
TOP 5 2 99.39 C6 C3 99.39
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.39 C4 C6 99.39
TOP 5 3 99.39 C6 C4 99.39
BOT 4 5 99.39 C5 C6 99.39
TOP 5 4 99.39 C6 C5 99.39
AVG 0 C1 * 99.88
AVG 1 C2 * 99.88
AVG 2 C3 * 99.88
AVG 3 C4 * 99.88
AVG 4 C5 * 99.88
AVG 5 C6 * 99.39
TOT TOT * 99.80
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
C2 ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
C3 ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
C4 ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
C5 ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
C6 ATGATGCTACGGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
********** ***************************************
C1 CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
C2 CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
C3 CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
C4 CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
C5 CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
C6 CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
**************************************************
C1 ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
C2 ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
C3 ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
C4 ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
C5 ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
C6 ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
**************************************************
C1 GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
C2 GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
C3 GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
C4 GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
C5 GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
C6 GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
**************************************************
C1 GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
C2 GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
C3 GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
C4 GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
C5 GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
C6 GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
**************************************************
C1 CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
C2 CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
C3 CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
C4 CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
C5 CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
C6 CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
**************************************************
C1 CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
C2 CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
C3 CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
C4 CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
C5 CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
C6 CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
**************************************************
C1 ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
C2 ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
C3 ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
C4 ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
C5 ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
C6 ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
**************************************************
C1 CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
C2 CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
C3 CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
C4 CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
C5 CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
C6 CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
**************************************************
C1 GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
C2 GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
C3 GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
C4 GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
C5 GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
C6 GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
*********************************************
>C1
ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
>C2
ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
>C3
ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
>C4
ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
>C5
ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
>C6
ATGATGCTACGGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA
CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC
ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG
GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG
GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA
CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG
CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC
ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC
CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC
GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
>C1
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C2
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C3
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C4
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C5
MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
>C6
MMLRLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
DNGALTDVVVHPLEK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 495 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579859880
Setting output file names to "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1950597824
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5163787124
Seed = 81099158
Swapseed = 1579859880
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1111.236595 -- -24.965149
Chain 2 -- -1111.236360 -- -24.965149
Chain 3 -- -1111.235045 -- -24.965149
Chain 4 -- -1111.236532 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1111.235045 -- -24.965149
Chain 2 -- -1111.236595 -- -24.965149
Chain 3 -- -1111.236595 -- -24.965149
Chain 4 -- -1111.236532 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1111.237] (-1111.236) (-1111.235) (-1111.237) * [-1111.235] (-1111.237) (-1111.237) (-1111.237)
500 -- (-705.404) [-696.524] (-699.232) (-693.710) * (-702.177) (-698.520) [-696.643] (-698.853) -- 0:00:00
1000 -- [-693.645] (-699.505) (-697.829) (-692.375) * (-696.355) (-703.169) (-704.067) [-700.247] -- 0:00:00
1500 -- (-697.214) (-695.114) (-696.812) [-702.668] * (-699.629) (-702.294) (-706.886) [-699.025] -- 0:00:00
2000 -- [-694.788] (-708.973) (-701.493) (-698.706) * [-696.091] (-696.002) (-697.352) (-698.226) -- 0:00:00
2500 -- (-701.048) (-697.179) (-695.594) [-694.775] * [-695.434] (-694.660) (-696.986) (-704.534) -- 0:00:00
3000 -- [-697.132] (-694.664) (-700.877) (-700.820) * (-697.726) (-697.586) [-695.580] (-694.986) -- 0:00:00
3500 -- (-699.949) (-702.107) [-695.561] (-696.493) * [-698.083] (-700.995) (-700.826) (-696.891) -- 0:00:00
4000 -- (-696.664) (-697.941) [-697.711] (-696.692) * (-695.048) [-702.675] (-695.506) (-697.711) -- 0:00:00
4500 -- (-703.008) (-700.692) [-693.556] (-695.417) * [-698.440] (-697.484) (-698.227) (-696.982) -- 0:00:00
5000 -- (-703.173) (-702.338) [-703.125] (-699.354) * (-697.078) [-694.694] (-698.212) (-697.087) -- 0:00:00
Average standard deviation of split frequencies: 0.094281
5500 -- [-690.499] (-705.697) (-696.714) (-700.020) * (-696.970) (-697.091) [-704.660] (-696.158) -- 0:00:00
6000 -- (-703.371) (-698.649) [-690.742] (-696.605) * (-691.883) (-696.444) [-699.713] (-698.817) -- 0:00:00
6500 -- (-702.349) [-698.321] (-699.491) (-700.835) * [-701.929] (-699.878) (-695.204) (-698.543) -- 0:00:00
7000 -- (-700.710) (-697.955) [-691.286] (-698.768) * (-707.086) (-698.653) (-700.517) [-697.504] -- 0:02:21
7500 -- (-703.532) (-700.288) [-699.988] (-717.811) * (-703.105) [-693.097] (-696.799) (-698.076) -- 0:02:12
8000 -- [-693.822] (-700.654) (-702.808) (-701.943) * [-692.358] (-700.402) (-704.637) (-700.299) -- 0:02:04
8500 -- (-702.469) (-701.780) (-697.594) [-695.753] * (-701.965) (-700.101) [-695.256] (-697.182) -- 0:01:56
9000 -- (-697.552) (-718.175) [-696.037] (-701.276) * [-698.386] (-699.659) (-703.573) (-701.291) -- 0:01:50
9500 -- [-695.239] (-694.538) (-697.202) (-694.837) * (-701.786) [-699.151] (-697.551) (-702.833) -- 0:01:44
10000 -- [-694.427] (-700.186) (-693.993) (-700.102) * (-695.586) [-696.288] (-692.779) (-699.279) -- 0:01:39
Average standard deviation of split frequencies: 0.090493
10500 -- [-702.997] (-701.312) (-696.169) (-707.089) * [-702.708] (-702.587) (-692.291) (-703.872) -- 0:01:34
11000 -- (-697.096) (-694.230) [-694.223] (-706.063) * (-706.351) [-696.136] (-695.258) (-707.442) -- 0:01:29
11500 -- (-698.196) (-692.851) [-710.151] (-700.620) * (-705.677) [-698.937] (-691.995) (-701.405) -- 0:01:25
12000 -- (-700.169) (-696.776) (-710.954) [-705.000] * [-699.108] (-700.908) (-697.337) (-699.217) -- 0:01:22
12500 -- (-696.717) (-694.872) (-713.835) [-700.580] * [-698.075] (-699.526) (-694.837) (-701.409) -- 0:01:19
13000 -- (-704.162) [-694.277] (-691.047) (-694.575) * [-694.972] (-698.465) (-694.827) (-695.989) -- 0:01:15
13500 -- (-706.341) (-695.971) (-692.219) [-694.735] * (-700.917) (-693.692) [-692.671] (-699.097) -- 0:01:13
14000 -- (-701.794) (-694.434) (-692.151) [-698.427] * (-700.042) (-702.355) [-693.672] (-698.700) -- 0:01:10
14500 -- (-700.104) (-694.877) (-690.926) [-695.326] * (-710.970) (-693.326) (-695.877) [-694.404] -- 0:01:07
15000 -- [-691.796] (-698.518) (-691.075) (-697.781) * (-707.108) (-701.720) (-692.562) [-699.709] -- 0:01:05
Average standard deviation of split frequencies: 0.078076
15500 -- [-702.940] (-694.047) (-690.030) (-694.285) * (-703.317) (-703.301) (-692.569) [-696.337] -- 0:01:03
16000 -- (-697.880) (-696.815) (-692.769) [-706.844] * (-703.969) [-698.630] (-691.784) (-701.619) -- 0:01:01
16500 -- (-693.471) (-695.630) (-692.635) [-697.166] * (-693.788) [-695.025] (-691.089) (-712.051) -- 0:00:59
17000 -- (-699.141) (-695.336) (-693.497) [-694.910] * (-699.351) [-697.058] (-692.502) (-695.409) -- 0:00:57
17500 -- (-695.653) (-691.093) (-692.684) [-693.078] * (-706.038) (-697.894) (-693.140) [-698.941] -- 0:00:56
18000 -- (-703.899) (-693.435) [-690.408] (-692.765) * (-701.962) [-697.887] (-692.066) (-694.625) -- 0:00:54
18500 -- (-706.034) (-694.714) [-692.381] (-693.450) * (-702.179) (-701.044) [-692.672] (-695.023) -- 0:00:53
19000 -- (-719.675) (-692.529) [-692.980] (-696.279) * (-703.717) [-697.399] (-694.334) (-691.880) -- 0:01:43
19500 -- (-692.367) (-691.621) (-702.123) [-699.523] * (-695.932) (-700.483) (-692.024) [-693.452] -- 0:01:40
20000 -- (-690.863) (-694.620) [-691.483] (-703.621) * (-699.405) [-695.211] (-694.201) (-693.060) -- 0:01:38
Average standard deviation of split frequencies: 0.067162
20500 -- (-690.830) [-694.783] (-697.757) (-702.995) * (-694.540) [-697.679] (-693.693) (-691.755) -- 0:01:35
21000 -- (-691.623) (-694.987) [-689.311] (-699.182) * (-694.522) (-694.609) (-693.595) [-692.237] -- 0:01:33
21500 -- (-692.591) (-694.025) (-690.051) [-691.761] * [-691.067] (-699.258) (-697.145) (-693.417) -- 0:01:31
22000 -- (-691.894) (-692.924) [-692.174] (-692.547) * (-695.267) (-708.410) (-692.329) [-691.359] -- 0:01:28
22500 -- [-690.442] (-693.224) (-694.612) (-696.636) * (-692.099) (-698.241) (-694.446) [-694.124] -- 0:01:26
23000 -- (-691.052) (-695.269) [-692.411] (-693.984) * (-695.924) (-700.270) [-691.175] (-693.640) -- 0:01:24
23500 -- [-690.609] (-694.163) (-691.705) (-697.022) * (-699.686) (-699.234) [-692.106] (-694.205) -- 0:01:23
24000 -- (-690.180) [-693.390] (-696.511) (-694.088) * [-693.143] (-698.968) (-692.545) (-694.911) -- 0:01:21
24500 -- [-692.096] (-695.109) (-693.411) (-692.067) * (-693.446) [-696.267] (-691.825) (-694.081) -- 0:01:19
25000 -- [-691.761] (-695.415) (-691.337) (-692.009) * (-694.101) (-701.888) [-696.023] (-692.960) -- 0:01:18
Average standard deviation of split frequencies: 0.047486
25500 -- (-693.573) (-694.050) (-695.421) [-694.879] * (-691.854) [-701.940] (-691.994) (-694.010) -- 0:01:16
26000 -- (-696.261) (-696.033) [-692.458] (-693.651) * [-692.766] (-696.785) (-697.521) (-694.319) -- 0:01:14
26500 -- (-693.376) [-693.407] (-694.701) (-694.361) * [-692.652] (-698.123) (-694.395) (-693.528) -- 0:01:13
27000 -- (-694.620) (-692.913) (-692.737) [-695.734] * [-691.794] (-695.682) (-694.304) (-693.452) -- 0:01:12
27500 -- (-696.344) [-696.910] (-698.674) (-693.908) * (-694.878) (-698.089) [-693.445] (-690.339) -- 0:01:10
28000 -- (-693.261) (-693.850) (-692.755) [-690.804] * (-695.269) [-693.687] (-692.542) (-692.831) -- 0:01:09
28500 -- (-695.236) [-692.997] (-692.448) (-699.108) * [-691.022] (-696.745) (-690.851) (-694.240) -- 0:01:08
29000 -- (-691.021) (-693.458) [-696.651] (-695.040) * [-691.837] (-694.036) (-694.669) (-694.414) -- 0:01:06
29500 -- [-692.393] (-696.154) (-695.002) (-694.364) * [-693.644] (-696.911) (-693.394) (-694.576) -- 0:01:05
30000 -- (-694.059) (-695.566) [-692.547] (-697.238) * (-693.860) (-693.574) [-692.774] (-692.109) -- 0:01:04
Average standard deviation of split frequencies: 0.046116
30500 -- [-695.668] (-693.166) (-693.547) (-694.982) * (-694.566) (-696.045) (-694.911) [-694.646] -- 0:01:03
31000 -- [-695.094] (-696.541) (-690.336) (-693.194) * (-695.779) (-692.404) [-692.250] (-700.152) -- 0:01:02
31500 -- (-692.262) (-696.486) (-691.129) [-690.565] * (-692.604) [-693.661] (-694.896) (-696.138) -- 0:01:01
32000 -- (-695.133) [-695.079] (-692.501) (-692.829) * (-693.940) (-694.413) (-694.173) [-694.579] -- 0:01:30
32500 -- (-695.020) [-692.019] (-692.581) (-691.663) * (-694.215) (-694.869) [-691.684] (-692.313) -- 0:01:29
33000 -- (-694.332) (-695.424) (-691.220) [-692.464] * (-696.107) [-694.422] (-696.481) (-693.172) -- 0:01:27
33500 -- (-694.665) (-693.786) (-694.129) [-693.924] * (-696.000) (-694.059) (-692.207) [-690.443] -- 0:01:26
34000 -- [-693.854] (-701.080) (-693.239) (-692.607) * [-691.201] (-695.215) (-691.298) (-692.965) -- 0:01:25
34500 -- (-692.374) (-694.638) [-695.093] (-693.645) * (-695.609) [-696.607] (-697.949) (-696.130) -- 0:01:23
35000 -- (-692.491) [-694.243] (-697.164) (-691.014) * [-695.962] (-696.373) (-698.629) (-693.890) -- 0:01:22
Average standard deviation of split frequencies: 0.049468
35500 -- (-692.337) [-693.165] (-694.987) (-691.758) * (-692.841) (-692.858) (-697.370) [-696.185] -- 0:01:21
36000 -- (-696.486) (-693.981) [-691.415] (-695.679) * (-691.644) (-694.693) (-696.842) [-692.951] -- 0:01:20
36500 -- (-693.727) [-695.114] (-690.971) (-693.743) * (-693.297) (-698.157) (-691.615) [-693.929] -- 0:01:19
37000 -- [-694.483] (-693.132) (-694.204) (-694.564) * (-694.867) [-699.608] (-692.184) (-695.561) -- 0:01:18
37500 -- (-692.737) (-695.021) [-693.345] (-694.247) * (-696.197) (-695.662) (-692.628) [-696.578] -- 0:01:17
38000 -- [-693.906] (-694.334) (-693.466) (-693.863) * (-694.972) [-698.452] (-690.472) (-697.936) -- 0:01:15
38500 -- [-692.935] (-695.068) (-693.116) (-695.360) * (-695.727) (-698.829) [-692.413] (-694.895) -- 0:01:14
39000 -- (-694.634) [-692.715] (-694.182) (-692.405) * (-693.428) (-696.475) (-694.352) [-694.140] -- 0:01:13
39500 -- (-692.720) [-694.059] (-696.046) (-695.409) * (-691.677) [-691.474] (-694.028) (-695.947) -- 0:01:12
40000 -- [-692.609] (-692.114) (-699.072) (-693.969) * (-704.040) [-696.566] (-692.954) (-696.284) -- 0:01:12
Average standard deviation of split frequencies: 0.047012
40500 -- [-690.514] (-693.911) (-693.504) (-696.008) * (-691.773) (-697.174) [-691.896] (-695.145) -- 0:01:11
41000 -- [-692.927] (-696.737) (-692.784) (-695.151) * (-692.687) [-692.935] (-694.829) (-697.053) -- 0:01:10
41500 -- (-691.500) (-695.193) (-693.203) [-694.173] * [-692.168] (-695.453) (-696.449) (-693.534) -- 0:01:09
42000 -- (-691.995) (-693.288) (-694.159) [-694.485] * (-694.699) (-693.354) [-696.629] (-693.449) -- 0:01:08
42500 -- (-694.264) [-695.975] (-692.537) (-693.189) * (-692.602) (-694.221) (-694.218) [-695.434] -- 0:01:07
43000 -- (-693.002) [-693.744] (-694.037) (-694.957) * (-694.332) (-695.268) (-695.485) [-692.798] -- 0:01:06
43500 -- (-700.489) (-692.523) (-693.160) [-695.471] * (-690.812) (-694.221) (-695.114) [-693.115] -- 0:01:05
44000 -- [-693.922] (-693.707) (-692.328) (-694.822) * (-692.405) [-691.484] (-693.788) (-695.083) -- 0:01:05
44500 -- [-693.277] (-694.381) (-693.960) (-693.064) * [-693.263] (-693.110) (-696.928) (-694.078) -- 0:01:04
45000 -- (-691.969) [-692.314] (-693.406) (-693.177) * [-694.793] (-692.573) (-692.971) (-691.600) -- 0:01:03
Average standard deviation of split frequencies: 0.033818
45500 -- (-692.639) (-692.369) (-694.901) [-693.970] * [-693.640] (-695.716) (-694.045) (-697.599) -- 0:01:02
46000 -- [-693.889] (-694.432) (-695.188) (-697.248) * [-691.813] (-694.252) (-696.674) (-696.708) -- 0:01:02
46500 -- (-695.551) (-692.381) (-695.778) [-695.369] * (-690.216) (-698.395) [-692.825] (-694.614) -- 0:01:01
47000 -- [-691.540] (-691.836) (-694.291) (-694.657) * [-693.600] (-695.978) (-696.596) (-693.063) -- 0:01:21
47500 -- (-692.022) (-694.666) (-696.729) [-696.147] * (-693.651) (-693.332) (-691.391) [-692.761] -- 0:01:20
48000 -- (-695.293) [-695.208] (-693.098) (-694.966) * (-695.934) (-697.393) [-692.143] (-695.395) -- 0:01:19
48500 -- (-694.308) [-691.722] (-694.870) (-693.318) * (-696.183) (-695.270) [-691.784] (-695.106) -- 0:01:18
49000 -- [-694.110] (-690.893) (-690.885) (-696.144) * [-694.644] (-691.728) (-691.476) (-693.892) -- 0:01:17
49500 -- (-695.105) (-693.929) (-694.251) [-694.910] * (-692.969) [-690.625] (-695.327) (-695.391) -- 0:01:16
50000 -- (-693.737) [-692.930] (-694.610) (-694.154) * (-692.234) [-691.749] (-698.983) (-698.307) -- 0:01:16
Average standard deviation of split frequencies: 0.040317
50500 -- [-693.649] (-693.462) (-697.086) (-693.656) * (-695.749) [-693.186] (-695.264) (-695.580) -- 0:01:15
51000 -- (-692.571) [-695.143] (-695.805) (-694.632) * [-694.882] (-692.219) (-694.469) (-697.533) -- 0:01:14
51500 -- [-697.693] (-694.753) (-697.595) (-691.768) * (-693.841) [-692.245] (-693.220) (-694.587) -- 0:01:13
52000 -- (-696.789) (-693.173) (-694.315) [-691.712] * [-696.473] (-693.443) (-693.369) (-696.395) -- 0:01:12
52500 -- (-692.831) (-693.022) (-692.569) [-694.163] * (-694.356) [-692.045] (-693.871) (-693.959) -- 0:01:12
53000 -- [-695.349] (-694.418) (-692.274) (-691.129) * (-692.807) (-691.977) [-692.273] (-693.845) -- 0:01:11
53500 -- (-695.537) (-695.830) [-691.008] (-693.847) * (-696.547) (-697.295) (-696.539) [-694.910] -- 0:01:10
54000 -- (-695.533) (-694.909) (-695.711) [-691.654] * [-694.245] (-692.075) (-691.842) (-699.176) -- 0:01:10
54500 -- [-694.279] (-695.123) (-694.405) (-691.218) * (-695.653) (-694.982) (-700.285) [-695.632] -- 0:01:09
55000 -- [-691.830] (-694.709) (-694.752) (-695.496) * (-694.123) (-694.506) (-697.014) [-695.081] -- 0:01:08
Average standard deviation of split frequencies: 0.032343
55500 -- [-692.331] (-693.235) (-693.541) (-693.387) * (-693.929) (-695.064) (-694.946) [-694.073] -- 0:01:08
56000 -- (-693.974) [-695.258] (-693.429) (-692.998) * [-695.267] (-692.468) (-695.495) (-694.545) -- 0:01:07
56500 -- (-692.216) (-693.570) [-692.668] (-698.719) * [-691.386] (-694.650) (-696.137) (-692.580) -- 0:01:06
57000 -- (-695.211) [-691.772] (-691.657) (-694.267) * (-692.674) [-695.193] (-697.788) (-693.856) -- 0:01:06
57500 -- (-696.979) [-692.140] (-696.751) (-694.004) * (-693.723) (-694.241) (-694.478) [-695.307] -- 0:01:05
58000 -- [-691.766] (-697.119) (-698.886) (-694.578) * (-692.462) (-692.649) (-695.981) [-693.276] -- 0:01:04
58500 -- (-695.226) (-695.318) (-693.379) [-696.007] * (-693.244) [-691.845] (-695.937) (-692.780) -- 0:01:04
59000 -- (-694.446) [-691.896] (-691.411) (-696.487) * (-692.974) (-693.481) (-696.877) [-693.000] -- 0:01:03
59500 -- (-696.271) [-695.367] (-692.586) (-699.561) * (-691.525) (-691.957) (-693.389) [-691.339] -- 0:01:03
60000 -- (-694.021) (-690.690) [-689.679] (-697.680) * (-696.764) (-692.860) [-691.551] (-692.847) -- 0:01:02
Average standard deviation of split frequencies: 0.031082
60500 -- (-694.579) [-692.645] (-696.675) (-697.097) * (-695.957) (-691.242) (-693.869) [-695.742] -- 0:01:02
61000 -- (-696.719) (-699.045) (-696.780) [-696.419] * (-692.755) (-695.290) [-692.821] (-696.577) -- 0:01:01
61500 -- (-691.607) [-694.958] (-697.553) (-691.798) * (-693.374) (-694.483) (-694.021) [-693.115] -- 0:01:01
62000 -- (-694.022) [-693.644] (-693.554) (-692.219) * [-692.594] (-691.780) (-694.685) (-691.562) -- 0:01:00
62500 -- (-693.651) [-695.205] (-692.324) (-692.602) * [-693.487] (-698.282) (-697.264) (-692.820) -- 0:01:00
63000 -- (-692.798) (-698.730) [-692.293] (-696.342) * (-693.071) (-691.745) [-691.155] (-693.080) -- 0:01:14
63500 -- [-691.673] (-692.835) (-694.167) (-693.466) * (-698.045) [-691.555] (-694.098) (-697.708) -- 0:01:13
64000 -- (-694.049) (-692.751) (-692.725) [-695.541] * (-699.658) (-695.007) (-694.797) [-696.829] -- 0:01:13
64500 -- (-693.564) (-694.633) [-691.433] (-693.423) * (-691.052) [-694.133] (-693.600) (-692.304) -- 0:01:12
65000 -- (-692.444) (-703.537) [-692.431] (-693.201) * [-693.096] (-698.050) (-694.186) (-694.131) -- 0:01:11
Average standard deviation of split frequencies: 0.026529
65500 -- [-691.064] (-696.696) (-690.069) (-693.388) * (-696.998) [-693.720] (-693.349) (-692.577) -- 0:01:11
66000 -- (-691.942) (-697.165) [-692.853] (-696.468) * (-703.991) (-692.170) (-695.671) [-691.595] -- 0:01:10
66500 -- (-692.517) [-692.306] (-692.828) (-693.693) * [-693.005] (-695.878) (-691.688) (-694.125) -- 0:01:10
67000 -- (-693.247) (-698.017) [-695.139] (-692.979) * (-694.246) [-691.799] (-694.907) (-692.064) -- 0:01:09
67500 -- (-697.296) [-693.396] (-692.412) (-691.775) * (-692.008) (-692.628) [-691.864] (-693.699) -- 0:01:09
68000 -- (-696.540) [-691.729] (-690.699) (-694.609) * [-692.371] (-695.177) (-692.952) (-696.295) -- 0:01:08
68500 -- (-696.981) (-691.738) (-693.438) [-693.513] * (-692.544) (-693.292) [-691.998] (-695.014) -- 0:01:07
69000 -- [-695.152] (-694.726) (-693.207) (-693.801) * (-691.568) [-693.035] (-693.593) (-693.284) -- 0:01:07
69500 -- (-696.394) [-695.673] (-698.054) (-695.573) * (-692.198) (-690.912) [-692.582] (-691.702) -- 0:01:06
70000 -- (-695.638) [-694.103] (-697.578) (-696.211) * [-693.016] (-693.888) (-692.326) (-692.006) -- 0:01:06
Average standard deviation of split frequencies: 0.025349
70500 -- (-699.787) [-692.412] (-696.506) (-701.930) * (-694.291) [-696.679] (-694.065) (-692.232) -- 0:01:05
71000 -- (-694.441) [-693.446] (-695.416) (-693.092) * (-691.917) (-693.317) [-691.779] (-692.721) -- 0:01:05
71500 -- [-691.397] (-693.164) (-695.486) (-693.834) * (-691.137) (-695.894) [-692.148] (-692.257) -- 0:01:04
72000 -- (-691.602) [-693.458] (-694.508) (-695.845) * (-692.244) (-693.140) (-695.764) [-691.818] -- 0:01:04
72500 -- (-701.592) (-690.634) [-695.108] (-694.118) * [-694.606] (-691.474) (-692.399) (-692.156) -- 0:01:03
73000 -- (-694.236) [-691.711] (-694.712) (-694.502) * [-695.984] (-694.492) (-691.644) (-692.117) -- 0:01:03
73500 -- (-693.515) [-692.159] (-698.575) (-694.192) * [-695.819] (-693.489) (-695.280) (-694.440) -- 0:01:03
74000 -- (-699.915) (-694.426) (-695.107) [-695.018] * (-697.929) (-695.096) [-691.505] (-692.371) -- 0:01:02
74500 -- (-693.266) [-691.731] (-694.576) (-692.787) * (-693.372) (-693.835) [-694.124] (-693.019) -- 0:01:02
75000 -- (-692.981) (-693.578) (-695.346) [-694.556] * (-695.306) [-695.164] (-692.765) (-691.572) -- 0:01:01
Average standard deviation of split frequencies: 0.022199
75500 -- (-692.215) (-692.615) [-696.648] (-693.968) * (-691.279) (-692.472) (-693.988) [-696.327] -- 0:01:01
76000 -- (-695.149) (-694.407) (-694.863) [-691.892] * (-697.418) [-692.286] (-694.012) (-694.800) -- 0:01:00
76500 -- [-693.935] (-696.210) (-693.643) (-694.546) * [-693.051] (-697.640) (-693.937) (-693.778) -- 0:01:00
77000 -- [-696.669] (-692.251) (-695.188) (-700.603) * (-694.405) (-701.829) [-692.857] (-693.659) -- 0:00:59
77500 -- (-692.596) [-695.444] (-694.894) (-702.984) * (-691.091) (-697.408) [-696.968] (-694.312) -- 0:00:59
78000 -- (-692.702) (-698.943) (-691.227) [-696.913] * (-692.926) [-690.678] (-694.759) (-694.846) -- 0:00:59
78500 -- (-692.457) (-695.786) (-690.947) [-690.451] * [-696.046] (-692.690) (-697.469) (-695.632) -- 0:00:58
79000 -- (-698.678) (-695.799) [-692.211] (-694.842) * (-690.453) (-692.539) [-696.914] (-697.201) -- 0:01:09
79500 -- (-695.713) (-695.087) (-693.667) [-694.428] * [-690.891] (-693.245) (-692.467) (-694.687) -- 0:01:09
80000 -- (-693.029) [-692.860] (-695.945) (-694.254) * [-692.856] (-690.651) (-699.104) (-695.646) -- 0:01:09
Average standard deviation of split frequencies: 0.021530
80500 -- (-694.641) [-694.598] (-692.391) (-697.612) * (-691.359) (-692.694) [-693.029] (-692.554) -- 0:01:08
81000 -- (-692.693) (-698.623) (-693.168) [-691.120] * (-691.520) (-690.878) [-695.278] (-694.174) -- 0:01:08
81500 -- [-693.192] (-694.779) (-696.013) (-698.566) * (-691.998) [-691.157] (-693.174) (-691.850) -- 0:01:07
82000 -- (-694.357) (-692.456) (-691.464) [-693.205] * (-692.777) (-693.687) [-691.630] (-689.733) -- 0:01:07
82500 -- [-693.013] (-694.509) (-693.397) (-692.751) * [-693.679] (-691.999) (-691.981) (-693.001) -- 0:01:06
83000 -- (-691.162) (-695.434) (-695.003) [-692.506] * [-691.733] (-695.102) (-696.208) (-693.052) -- 0:01:06
83500 -- (-695.334) [-695.196] (-694.735) (-692.814) * (-692.180) (-695.101) (-692.304) [-696.122] -- 0:01:05
84000 -- [-694.822] (-692.685) (-692.911) (-692.568) * [-691.910] (-699.450) (-693.330) (-694.861) -- 0:01:05
84500 -- (-693.067) (-691.242) [-695.010] (-691.980) * [-692.804] (-693.864) (-695.325) (-696.123) -- 0:01:05
85000 -- [-692.995] (-692.739) (-694.336) (-696.019) * (-692.474) (-693.480) [-692.290] (-694.074) -- 0:01:04
Average standard deviation of split frequencies: 0.022503
85500 -- (-696.247) (-696.422) [-697.853] (-694.239) * (-691.852) (-696.411) [-694.278] (-693.890) -- 0:01:04
86000 -- (-695.274) (-692.911) [-697.115] (-695.076) * (-692.872) (-692.928) [-691.039] (-694.209) -- 0:01:03
86500 -- (-693.273) (-697.238) [-692.149] (-694.492) * (-694.775) (-693.717) [-691.080] (-694.738) -- 0:01:03
87000 -- (-695.860) [-695.831] (-696.548) (-692.950) * (-694.662) [-691.903] (-691.641) (-689.787) -- 0:01:02
87500 -- (-694.549) (-692.614) [-692.476] (-693.403) * (-694.820) (-694.872) (-691.629) [-693.567] -- 0:01:02
88000 -- (-694.429) [-693.992] (-695.077) (-694.174) * (-695.673) (-693.395) (-693.472) [-691.413] -- 0:01:02
88500 -- (-694.915) (-698.851) [-697.069] (-694.320) * (-695.754) (-695.436) [-690.278] (-694.041) -- 0:01:01
89000 -- (-695.123) [-693.315] (-696.528) (-694.892) * (-694.395) (-695.782) [-691.488] (-699.434) -- 0:01:01
89500 -- (-698.984) [-693.184] (-694.302) (-693.530) * (-693.253) (-697.035) [-691.664] (-692.075) -- 0:01:01
90000 -- [-695.063] (-696.777) (-701.249) (-696.069) * (-692.485) (-695.854) [-694.190] (-695.971) -- 0:01:00
Average standard deviation of split frequencies: 0.021071
90500 -- (-691.881) (-693.801) [-696.318] (-698.016) * (-694.112) (-695.609) (-694.470) [-692.362] -- 0:01:00
91000 -- (-695.008) (-696.031) [-695.348] (-691.808) * [-691.629] (-692.312) (-694.114) (-694.189) -- 0:00:59
91500 -- (-692.421) (-695.315) [-691.001] (-691.948) * (-696.053) (-692.647) (-696.266) [-694.790] -- 0:00:59
92000 -- [-691.846] (-697.591) (-699.116) (-693.651) * (-692.790) (-692.086) (-697.521) [-692.904] -- 0:00:59
92500 -- [-694.232] (-697.515) (-697.773) (-694.628) * (-693.955) (-692.412) (-695.585) [-695.568] -- 0:00:58
93000 -- [-691.567] (-693.578) (-699.024) (-695.494) * (-692.444) [-691.430] (-698.239) (-692.754) -- 0:00:58
93500 -- (-692.368) [-693.935] (-701.796) (-694.531) * (-690.671) (-698.242) [-689.855] (-691.867) -- 0:00:58
94000 -- (-694.477) (-696.298) (-700.494) [-692.074] * [-693.319] (-693.295) (-693.047) (-693.808) -- 0:00:57
94500 -- (-691.386) (-692.370) [-695.291] (-693.499) * (-703.888) (-696.081) (-690.894) [-697.045] -- 0:01:07
95000 -- [-697.799] (-695.095) (-696.373) (-694.540) * (-704.390) (-692.432) [-691.281] (-693.183) -- 0:01:06
Average standard deviation of split frequencies: 0.020220
95500 -- (-693.628) (-692.889) (-695.301) [-693.543] * [-690.768] (-699.575) (-693.976) (-691.567) -- 0:01:06
96000 -- (-692.412) (-693.238) (-697.370) [-697.918] * [-691.807] (-692.401) (-690.907) (-692.628) -- 0:01:05
96500 -- (-696.191) [-691.502] (-694.562) (-692.244) * [-691.801] (-697.418) (-694.050) (-693.205) -- 0:01:05
97000 -- (-693.430) [-693.723] (-696.147) (-694.867) * (-696.726) [-696.007] (-692.265) (-694.449) -- 0:01:05
97500 -- (-691.768) (-696.152) (-695.874) [-692.141] * [-691.932] (-697.242) (-691.472) (-697.411) -- 0:01:04
98000 -- (-697.076) (-696.696) (-696.111) [-693.138] * (-691.205) (-697.236) [-693.478] (-695.198) -- 0:01:04
98500 -- [-697.873] (-692.323) (-699.773) (-697.861) * (-695.828) (-694.685) (-693.802) [-693.124] -- 0:01:04
99000 -- (-693.081) [-694.842] (-699.714) (-693.179) * (-694.045) [-694.156] (-695.713) (-692.989) -- 0:01:03
99500 -- (-690.368) [-694.420] (-694.432) (-693.709) * [-692.369] (-693.283) (-694.224) (-693.327) -- 0:01:03
100000 -- (-692.937) [-694.742] (-695.070) (-691.620) * [-693.109] (-693.140) (-694.175) (-692.424) -- 0:01:02
Average standard deviation of split frequencies: 0.020384
100500 -- (-693.704) (-694.833) [-697.048] (-696.520) * (-696.229) (-696.210) [-693.235] (-693.721) -- 0:01:02
101000 -- [-694.978] (-694.135) (-695.004) (-696.809) * (-694.415) (-696.990) [-694.362] (-690.644) -- 0:01:02
101500 -- (-692.611) [-693.664] (-695.959) (-695.618) * (-693.759) (-697.543) [-692.391] (-693.712) -- 0:01:01
102000 -- (-694.909) (-691.680) (-695.694) [-692.676] * (-694.433) (-691.370) [-695.806] (-695.105) -- 0:01:01
102500 -- [-690.657] (-694.332) (-693.864) (-695.029) * (-693.981) [-693.239] (-692.352) (-691.912) -- 0:01:01
103000 -- (-696.011) (-689.556) (-694.346) [-695.694] * (-695.680) (-694.700) [-694.473] (-691.113) -- 0:01:00
103500 -- [-691.431] (-694.944) (-693.523) (-696.066) * [-694.236] (-694.656) (-697.165) (-693.141) -- 0:01:00
104000 -- (-693.297) (-694.452) [-699.849] (-694.581) * (-694.063) (-692.647) [-693.595] (-695.713) -- 0:01:00
104500 -- (-694.809) [-693.636] (-691.542) (-692.450) * (-691.808) (-692.947) [-692.691] (-696.199) -- 0:00:59
105000 -- [-693.275] (-692.585) (-694.697) (-695.775) * [-694.497] (-700.188) (-691.950) (-698.481) -- 0:00:59
Average standard deviation of split frequencies: 0.021742
105500 -- [-693.832] (-692.536) (-691.964) (-693.845) * (-692.292) (-696.716) (-691.536) [-691.739] -- 0:00:59
106000 -- (-694.126) [-693.181] (-692.615) (-693.110) * [-695.572] (-695.446) (-696.034) (-694.673) -- 0:00:59
106500 -- (-692.079) (-693.845) (-693.560) [-694.247] * (-695.392) [-693.259] (-694.455) (-694.246) -- 0:00:58
107000 -- (-692.319) [-691.728] (-694.735) (-692.887) * (-694.559) (-693.297) (-693.510) [-692.912] -- 0:00:58
107500 -- (-695.465) [-692.560] (-694.176) (-693.703) * (-697.797) (-693.863) [-692.686] (-692.474) -- 0:00:58
108000 -- (-695.274) [-693.788] (-692.071) (-693.010) * (-690.475) (-692.017) [-691.400] (-691.971) -- 0:00:57
108500 -- (-692.349) [-693.942] (-695.167) (-692.983) * [-691.957] (-698.958) (-691.799) (-692.357) -- 0:00:57
109000 -- (-698.137) (-692.480) [-694.102] (-692.709) * (-691.691) [-694.468] (-692.180) (-692.911) -- 0:00:57
109500 -- [-694.378] (-693.632) (-692.087) (-693.023) * (-692.924) (-694.408) [-692.248] (-694.340) -- 0:00:56
110000 -- (-695.640) (-696.803) [-692.214] (-696.667) * (-694.430) (-693.425) [-694.188] (-693.865) -- 0:01:04
Average standard deviation of split frequencies: 0.024138
110500 -- [-694.889] (-692.619) (-693.535) (-696.782) * (-693.636) [-692.852] (-693.586) (-696.741) -- 0:01:04
111000 -- (-696.080) (-692.404) [-695.486] (-697.374) * (-693.462) [-693.742] (-695.982) (-693.791) -- 0:01:04
111500 -- (-696.116) [-691.826] (-694.278) (-695.327) * [-695.206] (-695.911) (-694.939) (-696.300) -- 0:01:03
112000 -- (-695.127) [-691.895] (-700.894) (-692.499) * [-694.026] (-694.089) (-697.533) (-694.943) -- 0:01:03
112500 -- (-695.796) (-695.380) (-695.325) [-694.976] * (-692.809) (-695.262) [-691.911] (-696.253) -- 0:01:03
113000 -- (-693.261) [-695.743] (-696.678) (-698.862) * (-693.597) (-692.855) [-694.732] (-694.880) -- 0:01:02
113500 -- (-694.574) (-693.264) (-696.056) [-692.641] * [-693.941] (-693.213) (-693.671) (-694.527) -- 0:01:02
114000 -- (-696.943) [-690.910] (-692.524) (-693.568) * (-692.861) (-695.691) (-694.106) [-692.828] -- 0:01:02
114500 -- [-694.577] (-692.238) (-695.474) (-693.483) * (-692.474) (-693.626) [-693.432] (-694.282) -- 0:01:01
115000 -- (-695.373) (-693.158) (-692.511) [-693.495] * (-694.769) (-692.388) [-690.623] (-694.100) -- 0:01:01
Average standard deviation of split frequencies: 0.025512
115500 -- [-694.343] (-698.366) (-692.418) (-694.546) * (-691.335) (-694.564) (-691.800) [-693.281] -- 0:01:01
116000 -- (-695.993) (-693.702) [-694.937] (-695.516) * (-694.492) [-696.044] (-695.478) (-693.598) -- 0:01:00
116500 -- (-692.402) [-691.731] (-692.950) (-695.216) * (-693.617) (-691.994) [-691.568] (-694.327) -- 0:01:00
117000 -- (-698.220) (-692.831) (-700.611) [-695.521] * [-694.658] (-694.516) (-694.396) (-694.877) -- 0:01:00
117500 -- (-692.626) (-695.560) (-692.365) [-701.407] * (-695.144) (-694.021) (-693.661) [-693.050] -- 0:01:00
118000 -- [-691.533] (-694.365) (-690.885) (-693.614) * [-694.848] (-698.774) (-694.042) (-696.969) -- 0:00:59
118500 -- [-691.218] (-696.453) (-695.563) (-693.117) * [-693.035] (-698.086) (-692.396) (-692.374) -- 0:00:59
119000 -- (-692.831) [-692.438] (-692.246) (-698.214) * [-694.131] (-696.652) (-695.725) (-695.910) -- 0:00:59
119500 -- [-692.791] (-694.174) (-695.441) (-695.696) * [-691.208] (-694.331) (-693.117) (-693.255) -- 0:00:58
120000 -- [-693.112] (-696.077) (-695.989) (-694.072) * (-691.623) (-695.130) (-693.175) [-691.748] -- 0:00:58
Average standard deviation of split frequencies: 0.024674
120500 -- [-692.288] (-695.920) (-696.963) (-694.171) * [-692.280] (-693.650) (-694.661) (-696.158) -- 0:00:58
121000 -- [-692.860] (-700.035) (-697.070) (-696.090) * (-696.225) [-693.913] (-691.108) (-692.642) -- 0:00:58
121500 -- [-694.065] (-693.009) (-703.947) (-694.535) * [-695.496] (-693.123) (-694.473) (-694.265) -- 0:00:57
122000 -- (-693.106) (-693.266) (-695.619) [-694.609] * [-692.105] (-693.703) (-691.340) (-692.364) -- 0:00:57
122500 -- [-692.936] (-695.219) (-692.665) (-692.752) * [-693.168] (-696.112) (-692.511) (-691.422) -- 0:00:57
123000 -- (-696.537) (-693.359) [-693.739] (-695.910) * (-691.457) (-692.557) (-694.634) [-692.917] -- 0:00:57
123500 -- [-698.287] (-691.089) (-692.716) (-692.638) * [-691.311] (-695.303) (-692.650) (-692.930) -- 0:00:56
124000 -- (-698.655) [-694.625] (-697.180) (-693.099) * (-696.952) (-692.915) (-693.201) [-693.118] -- 0:00:56
124500 -- (-690.837) (-699.044) [-695.615] (-697.643) * (-691.300) (-691.947) (-693.699) [-692.610] -- 0:00:56
125000 -- (-692.049) [-690.775] (-693.270) (-699.791) * (-691.268) [-693.281] (-690.325) (-691.561) -- 0:00:56
Average standard deviation of split frequencies: 0.023826
125500 -- (-692.908) (-692.424) [-693.044] (-695.327) * [-692.161] (-693.311) (-691.657) (-691.057) -- 0:01:02
126000 -- (-692.518) (-692.312) [-696.704] (-694.574) * (-693.965) (-692.610) (-692.658) [-692.691] -- 0:01:02
126500 -- (-692.708) [-690.379] (-696.217) (-693.837) * (-693.243) (-694.630) (-691.171) [-691.962] -- 0:01:02
127000 -- [-693.330] (-695.833) (-691.670) (-694.929) * [-693.604] (-692.535) (-693.292) (-693.239) -- 0:01:01
127500 -- [-693.205] (-693.538) (-692.134) (-693.063) * (-695.247) [-691.479] (-692.660) (-693.689) -- 0:01:01
128000 -- (-692.239) [-692.398] (-695.173) (-692.200) * [-693.511] (-694.800) (-694.274) (-693.444) -- 0:01:01
128500 -- (-690.802) [-695.286] (-694.224) (-693.608) * (-696.261) (-693.455) [-692.746] (-692.786) -- 0:01:01
129000 -- (-691.166) [-692.306] (-698.081) (-692.541) * (-694.979) [-690.604] (-693.771) (-693.919) -- 0:01:00
129500 -- (-692.031) (-692.961) (-698.181) [-692.954] * (-692.097) [-692.130] (-691.589) (-697.150) -- 0:01:00
130000 -- (-692.042) (-699.625) [-695.495] (-694.709) * (-696.947) [-696.529] (-691.308) (-695.873) -- 0:01:00
Average standard deviation of split frequencies: 0.022406
130500 -- (-694.269) (-698.122) (-692.692) [-695.082] * (-693.279) (-691.896) [-691.248] (-696.250) -- 0:00:59
131000 -- [-690.933] (-693.460) (-693.289) (-693.149) * (-692.651) (-695.527) [-694.859] (-691.346) -- 0:00:59
131500 -- [-692.858] (-692.110) (-692.748) (-693.494) * (-691.838) (-693.191) [-695.479] (-693.639) -- 0:00:59
132000 -- (-692.267) (-698.060) [-691.682] (-693.989) * (-691.630) (-694.889) (-697.969) [-691.131] -- 0:00:59
132500 -- (-692.784) (-699.361) [-692.423] (-690.616) * (-693.264) (-694.790) (-696.953) [-691.533] -- 0:00:58
133000 -- (-692.822) (-696.571) [-690.502] (-692.633) * (-695.325) [-691.982] (-695.710) (-691.457) -- 0:00:58
133500 -- (-692.777) (-694.705) (-692.310) [-691.465] * (-693.802) [-691.171] (-697.988) (-694.419) -- 0:00:58
134000 -- (-692.617) [-692.989] (-692.166) (-697.325) * (-693.639) (-697.375) [-693.170] (-693.361) -- 0:00:58
134500 -- [-691.274] (-693.627) (-698.565) (-692.576) * [-693.515] (-697.324) (-694.835) (-691.415) -- 0:00:57
135000 -- [-692.334] (-694.728) (-693.204) (-693.331) * (-696.558) [-696.916] (-692.313) (-693.276) -- 0:00:57
Average standard deviation of split frequencies: 0.022145
135500 -- (-694.920) (-692.359) (-699.470) [-693.242] * (-697.362) [-694.351] (-695.671) (-693.732) -- 0:00:57
136000 -- (-693.531) [-696.220] (-694.903) (-694.705) * [-697.929] (-696.247) (-691.292) (-692.904) -- 0:00:57
136500 -- [-692.129] (-693.459) (-696.438) (-693.676) * (-694.097) [-695.230] (-694.455) (-691.883) -- 0:00:56
137000 -- (-696.042) (-693.723) (-691.714) [-695.168] * [-691.364] (-698.636) (-693.924) (-694.278) -- 0:00:56
137500 -- (-693.207) [-693.478] (-696.727) (-693.784) * (-692.824) (-691.794) [-692.817] (-692.543) -- 0:00:56
138000 -- (-703.069) [-691.677] (-696.005) (-693.368) * [-690.457] (-691.648) (-694.048) (-694.280) -- 0:00:56
138500 -- (-692.295) (-692.531) [-698.395] (-692.264) * (-695.524) [-691.692] (-692.932) (-692.346) -- 0:00:55
139000 -- (-693.746) (-691.329) [-695.430] (-696.524) * [-694.628] (-692.655) (-693.422) (-692.596) -- 0:00:55
139500 -- (-694.537) (-692.367) [-696.716] (-693.408) * (-692.247) [-692.252] (-692.040) (-692.842) -- 0:00:55
140000 -- (-692.085) [-691.351] (-696.872) (-693.448) * (-700.560) [-693.796] (-694.852) (-695.552) -- 0:00:55
Average standard deviation of split frequencies: 0.021684
140500 -- (-696.743) [-693.730] (-696.514) (-693.935) * [-695.652] (-694.397) (-691.522) (-695.198) -- 0:00:55
141000 -- (-694.168) [-690.628] (-696.295) (-694.207) * (-698.378) [-695.297] (-692.826) (-691.938) -- 0:01:00
141500 -- (-694.314) (-692.942) (-695.070) [-695.570] * (-694.397) (-698.565) [-692.163] (-695.116) -- 0:01:00
142000 -- (-694.578) (-691.508) (-693.753) [-694.364] * [-693.377] (-693.247) (-699.462) (-694.537) -- 0:01:00
142500 -- (-692.293) [-694.444] (-692.854) (-697.159) * (-693.440) (-693.697) [-694.578] (-698.414) -- 0:01:00
143000 -- (-696.840) (-692.687) (-693.791) [-697.270] * (-691.010) (-693.065) (-696.423) [-692.959] -- 0:00:59
143500 -- (-694.690) (-693.617) [-693.189] (-696.776) * [-691.284] (-694.191) (-693.202) (-692.573) -- 0:00:59
144000 -- (-693.899) (-691.303) [-693.151] (-697.977) * (-691.743) [-691.622] (-705.490) (-693.861) -- 0:00:59
144500 -- (-692.097) (-692.544) [-694.666] (-694.106) * (-694.312) (-692.743) (-701.050) [-697.116] -- 0:00:59
145000 -- (-696.718) (-694.525) [-694.640] (-693.799) * (-697.994) [-692.953] (-693.289) (-692.961) -- 0:00:58
Average standard deviation of split frequencies: 0.020702
145500 -- (-694.399) (-690.842) (-693.952) [-692.971] * (-691.742) (-693.866) [-695.417] (-694.772) -- 0:00:58
146000 -- [-696.596] (-691.948) (-692.034) (-692.140) * (-694.691) (-700.273) [-691.554] (-693.250) -- 0:00:58
146500 -- [-692.239] (-696.897) (-694.856) (-692.237) * [-691.802] (-697.102) (-692.368) (-693.486) -- 0:00:58
147000 -- (-694.485) [-693.456] (-693.805) (-695.460) * [-694.777] (-692.566) (-693.882) (-696.581) -- 0:00:58
147500 -- (-691.893) (-693.801) (-692.162) [-693.784] * (-693.308) (-692.692) [-692.787] (-695.140) -- 0:00:57
148000 -- (-691.540) (-695.447) [-693.477] (-693.256) * (-697.181) (-695.020) [-694.457] (-692.302) -- 0:00:57
148500 -- (-691.978) (-694.632) (-695.397) [-691.425] * [-692.595] (-695.100) (-693.280) (-694.301) -- 0:00:57
149000 -- (-698.862) (-692.910) [-691.590] (-695.700) * [-692.388] (-695.230) (-693.699) (-696.625) -- 0:00:57
149500 -- (-696.389) [-694.179] (-694.284) (-691.999) * [-693.533] (-697.414) (-695.020) (-691.837) -- 0:00:56
150000 -- (-696.438) [-696.100] (-692.634) (-692.687) * (-692.510) (-699.472) (-696.717) [-693.291] -- 0:00:56
Average standard deviation of split frequencies: 0.021902
150500 -- (-694.401) (-696.512) [-692.831] (-692.614) * (-697.277) (-694.329) [-692.945] (-695.639) -- 0:00:56
151000 -- (-693.485) (-694.735) [-692.440] (-692.547) * (-697.141) (-695.360) (-693.859) [-693.760] -- 0:00:56
151500 -- [-691.205] (-694.898) (-694.883) (-695.725) * [-694.012] (-695.383) (-694.520) (-693.670) -- 0:00:56
152000 -- (-694.414) [-693.571] (-694.454) (-691.304) * [-694.880] (-694.978) (-694.083) (-693.015) -- 0:00:55
152500 -- (-697.680) (-701.170) (-699.039) [-692.331] * (-694.229) [-692.734] (-691.217) (-692.296) -- 0:00:55
153000 -- (-697.995) [-695.579] (-697.552) (-694.616) * (-693.779) (-696.800) [-691.925] (-690.926) -- 0:00:55
153500 -- [-692.719] (-693.866) (-698.326) (-694.145) * [-694.699] (-701.147) (-695.519) (-693.324) -- 0:00:55
154000 -- (-691.921) (-697.733) (-692.357) [-695.279] * (-695.673) (-695.660) (-696.756) [-696.974] -- 0:00:54
154500 -- (-691.951) (-696.131) [-692.057] (-692.884) * (-693.411) (-698.150) (-692.993) [-697.147] -- 0:00:54
155000 -- [-691.719] (-690.158) (-692.979) (-693.185) * (-692.983) (-694.478) (-694.612) [-696.136] -- 0:00:54
Average standard deviation of split frequencies: 0.021686
155500 -- (-691.427) (-691.725) [-690.294] (-691.597) * (-694.547) (-697.079) [-693.767] (-691.553) -- 0:00:54
156000 -- [-693.042] (-693.495) (-697.616) (-693.231) * (-692.920) [-692.854] (-694.904) (-691.630) -- 0:00:54
156500 -- [-691.808] (-692.683) (-694.379) (-693.581) * (-694.938) [-692.566] (-693.935) (-695.087) -- 0:00:59
157000 -- (-693.560) [-691.359] (-693.300) (-693.921) * (-696.868) (-692.124) (-691.690) [-696.677] -- 0:00:59
157500 -- (-694.315) (-694.322) [-692.385] (-694.128) * (-693.507) (-694.978) (-696.461) [-695.577] -- 0:00:58
158000 -- (-701.153) [-695.049] (-695.185) (-695.684) * (-693.227) (-692.597) (-695.867) [-692.910] -- 0:00:58
158500 -- (-697.080) (-699.127) (-697.184) [-692.363] * (-693.926) (-693.983) (-693.506) [-692.325] -- 0:00:58
159000 -- (-694.418) (-694.934) (-696.924) [-693.038] * [-694.180] (-691.387) (-694.778) (-698.605) -- 0:00:58
159500 -- (-694.728) [-694.369] (-696.466) (-691.915) * (-693.360) [-695.216] (-692.198) (-695.309) -- 0:00:57
160000 -- (-696.545) [-691.115] (-693.257) (-693.359) * (-696.245) (-696.297) (-692.677) [-696.080] -- 0:00:57
Average standard deviation of split frequencies: 0.023127
160500 -- (-693.646) [-691.742] (-699.339) (-693.853) * [-695.392] (-694.576) (-696.200) (-696.465) -- 0:00:57
161000 -- (-695.234) (-691.105) (-693.420) [-693.376] * [-691.305] (-696.306) (-691.428) (-696.943) -- 0:00:57
161500 -- (-697.419) (-695.495) [-691.336] (-691.385) * (-697.006) (-693.229) [-690.355] (-696.687) -- 0:00:57
162000 -- [-694.157] (-694.877) (-694.789) (-691.299) * (-692.338) [-695.477] (-694.028) (-696.208) -- 0:00:56
162500 -- (-695.104) (-693.543) (-692.669) [-691.093] * (-695.857) [-693.773] (-692.319) (-695.273) -- 0:00:56
163000 -- [-693.262] (-693.025) (-694.308) (-700.507) * (-692.991) [-690.863] (-691.587) (-694.560) -- 0:00:56
163500 -- [-692.449] (-691.677) (-694.155) (-690.471) * (-695.479) [-691.729] (-689.769) (-695.139) -- 0:00:56
164000 -- (-693.461) [-693.036] (-694.050) (-696.091) * (-692.313) [-695.767] (-692.620) (-693.377) -- 0:00:56
164500 -- (-692.741) (-693.891) (-695.497) [-691.104] * (-695.501) (-692.080) (-695.617) [-692.023] -- 0:00:55
165000 -- (-691.277) (-697.028) [-696.193] (-695.782) * (-692.468) [-693.814] (-696.180) (-691.861) -- 0:00:55
Average standard deviation of split frequencies: 0.022008
165500 -- (-694.027) (-695.912) [-693.490] (-693.968) * [-693.067] (-693.901) (-694.162) (-692.785) -- 0:00:55
166000 -- (-693.626) (-697.054) (-695.901) [-695.943] * (-695.304) (-692.228) [-691.370] (-693.735) -- 0:00:55
166500 -- (-697.431) [-695.343] (-693.883) (-695.718) * (-698.311) (-694.482) [-694.114] (-694.771) -- 0:00:55
167000 -- (-692.514) [-697.638] (-693.933) (-691.302) * (-695.332) (-690.416) (-694.811) [-696.254] -- 0:00:54
167500 -- (-691.053) (-695.184) [-697.979] (-693.244) * [-696.368] (-691.105) (-694.248) (-693.266) -- 0:00:54
168000 -- [-694.624] (-693.560) (-693.217) (-693.215) * (-694.481) [-693.305] (-692.243) (-693.849) -- 0:00:54
168500 -- (-693.184) (-695.990) [-698.722] (-691.752) * (-692.601) [-691.217] (-694.170) (-694.970) -- 0:00:54
169000 -- (-695.601) (-694.428) (-694.273) [-692.221] * [-695.360] (-690.355) (-695.494) (-694.029) -- 0:00:54
169500 -- [-693.273] (-693.545) (-692.471) (-694.459) * [-692.087] (-693.500) (-694.484) (-692.407) -- 0:00:53
170000 -- (-692.581) (-693.546) (-693.016) [-693.096] * (-696.811) [-694.037] (-691.660) (-694.978) -- 0:00:53
Average standard deviation of split frequencies: 0.019795
170500 -- (-691.697) (-693.589) [-692.450] (-694.922) * (-696.173) [-691.576] (-690.038) (-692.243) -- 0:00:53
171000 -- [-691.948] (-694.684) (-696.946) (-692.105) * (-693.308) (-690.817) (-695.816) [-694.169] -- 0:00:53
171500 -- (-693.391) (-694.322) [-692.149] (-692.728) * (-696.815) (-693.377) [-691.378] (-692.139) -- 0:00:53
172000 -- (-697.568) (-693.393) [-693.386] (-691.758) * (-695.478) [-691.579] (-691.060) (-692.248) -- 0:00:52
172500 -- (-692.898) [-694.229] (-694.012) (-692.944) * (-693.572) (-692.051) (-695.340) [-693.433] -- 0:00:57
173000 -- (-694.607) (-695.572) (-694.467) [-692.583] * (-693.870) [-692.918] (-693.925) (-694.618) -- 0:00:57
173500 -- (-694.117) (-695.797) [-696.440] (-698.833) * (-693.161) (-697.472) [-693.110] (-698.975) -- 0:00:57
174000 -- [-693.908] (-695.839) (-692.531) (-696.214) * (-692.956) [-692.907] (-693.930) (-692.614) -- 0:00:56
174500 -- [-691.334] (-693.293) (-696.555) (-692.659) * (-696.124) (-694.967) [-695.186] (-693.683) -- 0:00:56
175000 -- (-690.162) (-695.266) [-693.178] (-691.650) * (-696.178) (-692.492) (-696.011) [-693.701] -- 0:00:56
Average standard deviation of split frequencies: 0.020167
175500 -- (-691.072) [-690.976] (-696.129) (-692.062) * (-694.105) [-692.244] (-696.347) (-694.776) -- 0:00:56
176000 -- (-692.758) [-692.953] (-690.555) (-692.008) * [-691.541] (-692.285) (-693.243) (-698.084) -- 0:00:56
176500 -- (-694.074) (-696.449) (-692.642) [-694.223] * [-693.227] (-691.935) (-695.655) (-694.894) -- 0:00:55
177000 -- (-697.159) (-695.307) [-691.606] (-693.944) * (-695.972) (-693.314) (-693.995) [-695.305] -- 0:00:55
177500 -- (-695.673) [-689.847] (-694.841) (-694.273) * (-691.916) [-694.930] (-695.187) (-695.139) -- 0:00:55
178000 -- (-694.786) (-692.885) (-694.663) [-691.149] * (-693.618) (-693.398) (-696.357) [-695.892] -- 0:00:55
178500 -- (-694.049) [-693.556] (-696.282) (-692.433) * (-694.816) [-693.453] (-694.042) (-694.704) -- 0:00:55
179000 -- (-694.587) (-692.954) (-696.551) [-693.808] * (-701.900) [-693.168] (-697.643) (-695.172) -- 0:00:55
179500 -- (-692.051) (-691.257) (-693.358) [-693.547] * (-694.142) [-694.225] (-692.774) (-692.825) -- 0:00:54
180000 -- [-694.277] (-691.958) (-694.650) (-691.490) * (-695.625) (-699.272) [-694.681] (-697.096) -- 0:00:54
Average standard deviation of split frequencies: 0.019406
180500 -- (-694.760) [-693.581] (-692.522) (-692.409) * (-694.191) [-693.913] (-696.100) (-693.743) -- 0:00:54
181000 -- (-695.333) (-690.815) (-692.750) [-694.379] * (-697.915) (-695.360) (-698.215) [-694.753] -- 0:00:54
181500 -- [-695.980] (-697.579) (-695.480) (-692.839) * [-694.910] (-694.396) (-694.847) (-696.093) -- 0:00:54
182000 -- (-695.993) (-697.103) (-695.738) [-695.216] * (-694.704) (-692.113) (-692.700) [-694.627] -- 0:00:53
182500 -- (-694.838) (-696.686) [-696.302] (-697.435) * (-696.158) [-691.745] (-695.123) (-693.212) -- 0:00:53
183000 -- (-696.425) (-694.153) [-692.349] (-691.503) * [-695.351] (-691.621) (-700.598) (-694.315) -- 0:00:53
183500 -- (-693.705) [-693.734] (-696.459) (-695.266) * (-696.085) (-694.048) (-694.923) [-695.826] -- 0:00:53
184000 -- (-694.584) [-694.401] (-693.996) (-692.731) * [-695.722] (-695.782) (-692.900) (-695.346) -- 0:00:53
184500 -- [-697.358] (-695.833) (-693.737) (-691.425) * (-695.288) (-692.083) (-692.569) [-693.124] -- 0:00:53
185000 -- (-703.865) [-694.949] (-695.262) (-691.097) * (-698.124) (-695.469) [-691.758] (-692.851) -- 0:00:52
Average standard deviation of split frequencies: 0.020698
185500 -- (-699.210) (-694.833) (-693.746) [-693.126] * (-705.921) (-694.938) [-693.784] (-694.508) -- 0:00:52
186000 -- (-695.996) (-693.098) (-694.441) [-694.541] * (-702.785) (-696.093) [-692.711] (-691.370) -- 0:00:52
186500 -- (-693.244) (-693.122) (-692.426) [-692.669] * (-696.085) [-692.673] (-692.454) (-693.534) -- 0:00:52
187000 -- (-694.843) (-696.202) (-693.140) [-693.803] * (-692.102) (-694.452) [-692.880] (-692.956) -- 0:00:52
187500 -- (-696.581) (-695.180) [-696.254] (-695.384) * (-700.586) (-695.826) (-692.057) [-693.494] -- 0:00:52
188000 -- (-693.617) [-694.042] (-696.683) (-693.029) * (-700.502) (-694.488) (-689.591) [-690.852] -- 0:00:56
188500 -- (-691.438) (-690.703) [-693.768] (-694.580) * (-695.430) (-695.346) [-691.632] (-693.236) -- 0:00:55
189000 -- [-692.888] (-693.679) (-693.668) (-691.108) * [-696.088] (-692.344) (-692.706) (-691.082) -- 0:00:55
189500 -- (-692.622) (-697.498) [-692.886] (-695.569) * (-696.592) (-691.643) (-694.363) [-692.769] -- 0:00:55
190000 -- [-692.895] (-692.544) (-692.424) (-694.877) * (-697.283) [-692.465] (-692.819) (-692.773) -- 0:00:55
Average standard deviation of split frequencies: 0.021290
190500 -- (-692.614) (-694.492) [-692.205] (-699.840) * [-697.810] (-691.296) (-689.527) (-691.432) -- 0:00:55
191000 -- (-695.353) (-693.267) (-694.204) [-697.504] * [-696.162] (-692.505) (-691.447) (-693.676) -- 0:00:55
191500 -- [-691.556] (-692.640) (-692.536) (-699.583) * (-696.390) (-691.947) [-691.499] (-697.728) -- 0:00:54
192000 -- (-695.429) (-693.474) (-692.193) [-693.826] * (-695.762) (-693.636) (-693.382) [-695.738] -- 0:00:54
192500 -- (-695.111) (-691.563) [-693.052] (-695.202) * [-696.798] (-693.443) (-694.764) (-697.082) -- 0:00:54
193000 -- [-692.418] (-691.908) (-694.819) (-696.121) * [-691.970] (-692.940) (-692.350) (-694.343) -- 0:00:54
193500 -- [-695.495] (-694.683) (-692.299) (-695.676) * (-695.456) [-691.326] (-692.738) (-693.568) -- 0:00:54
194000 -- (-692.012) (-693.874) (-698.802) [-691.032] * (-692.317) (-693.544) (-692.822) [-692.935] -- 0:00:54
194500 -- (-697.797) [-694.118] (-700.088) (-695.587) * (-693.067) (-690.583) [-693.958] (-692.688) -- 0:00:53
195000 -- (-695.694) (-696.229) (-696.282) [-692.544] * (-693.956) (-697.265) (-691.565) [-692.826] -- 0:00:53
Average standard deviation of split frequencies: 0.021080
195500 -- (-693.758) [-694.024] (-696.218) (-692.952) * [-694.893] (-695.758) (-696.486) (-694.340) -- 0:00:53
196000 -- (-694.465) (-694.890) (-693.618) [-698.782] * (-693.712) (-692.744) (-697.077) [-695.989] -- 0:00:53
196500 -- (-698.482) (-695.390) (-695.204) [-691.673] * (-699.979) (-692.322) [-693.313] (-693.475) -- 0:00:53
197000 -- [-699.041] (-697.574) (-692.617) (-696.221) * (-694.921) (-694.010) [-692.560] (-694.039) -- 0:00:52
197500 -- (-698.631) (-693.585) (-700.987) [-699.081] * (-694.480) [-692.794] (-692.545) (-692.236) -- 0:00:52
198000 -- (-697.569) (-692.621) [-694.346] (-696.720) * (-695.020) (-692.434) (-691.714) [-692.154] -- 0:00:52
198500 -- (-693.559) (-690.537) [-691.291] (-692.092) * (-696.179) (-693.553) [-691.772] (-694.633) -- 0:00:52
199000 -- (-695.606) [-695.531] (-691.034) (-692.034) * (-694.339) (-693.092) [-691.281] (-691.072) -- 0:00:52
199500 -- [-694.960] (-695.531) (-690.932) (-691.389) * (-694.123) (-694.788) (-692.947) [-691.701] -- 0:00:52
200000 -- (-694.596) (-692.785) [-693.290] (-693.021) * (-694.156) (-691.033) [-695.059] (-692.591) -- 0:00:51
Average standard deviation of split frequencies: 0.022611
200500 -- (-694.364) (-694.553) [-695.348] (-692.000) * (-697.124) (-696.746) (-692.570) [-691.014] -- 0:00:51
201000 -- (-695.851) [-692.418] (-693.114) (-694.064) * (-696.824) (-693.410) [-692.761] (-693.730) -- 0:00:51
201500 -- [-691.175] (-691.001) (-692.766) (-690.907) * [-695.169] (-696.152) (-693.863) (-697.831) -- 0:00:51
202000 -- (-694.088) (-694.358) (-691.960) [-692.748] * (-693.336) (-694.183) (-691.821) [-695.924] -- 0:00:51
202500 -- [-692.928] (-692.372) (-694.068) (-691.437) * (-694.415) (-693.773) [-694.093] (-694.282) -- 0:00:51
203000 -- (-691.750) (-699.291) [-692.377] (-700.283) * (-694.967) (-692.977) [-692.428] (-693.998) -- 0:00:51
203500 -- (-696.918) [-696.452] (-691.837) (-699.273) * (-696.173) [-693.899] (-691.627) (-694.164) -- 0:00:50
204000 -- (-694.435) (-695.425) (-691.261) [-699.793] * (-696.971) [-694.189] (-693.651) (-696.332) -- 0:00:54
204500 -- (-698.212) (-693.781) [-694.298] (-698.158) * (-695.498) (-695.145) (-693.875) [-693.251] -- 0:00:54
205000 -- (-693.413) (-693.485) [-692.466] (-692.111) * (-691.155) (-694.387) [-693.657] (-691.493) -- 0:00:54
Average standard deviation of split frequencies: 0.020730
205500 -- (-698.464) (-691.332) (-695.238) [-694.553] * (-695.379) (-695.225) [-693.339] (-694.034) -- 0:00:54
206000 -- (-696.966) [-693.304] (-694.765) (-696.810) * (-696.190) [-693.768] (-693.791) (-693.023) -- 0:00:53
206500 -- [-693.505] (-692.878) (-698.308) (-697.390) * (-698.095) (-693.148) (-695.987) [-694.701] -- 0:00:53
207000 -- [-696.351] (-691.778) (-695.071) (-694.721) * (-694.759) (-693.448) [-694.488] (-692.113) -- 0:00:53
207500 -- [-695.871] (-694.124) (-692.755) (-691.473) * (-702.965) [-693.546] (-691.973) (-693.423) -- 0:00:53
208000 -- (-696.026) (-696.957) [-695.223] (-690.327) * [-699.500] (-692.770) (-692.367) (-695.170) -- 0:00:53
208500 -- (-696.410) [-695.775] (-696.568) (-695.462) * (-695.121) [-693.402] (-692.981) (-693.823) -- 0:00:53
209000 -- (-695.611) (-696.086) [-691.166] (-695.466) * (-698.845) [-692.113] (-690.620) (-692.812) -- 0:00:52
209500 -- (-693.717) (-690.835) [-694.659] (-695.993) * (-698.385) (-694.167) (-702.484) [-694.407] -- 0:00:52
210000 -- (-697.333) (-692.368) [-695.674] (-695.806) * (-694.286) (-695.443) [-694.408] (-690.655) -- 0:00:52
Average standard deviation of split frequencies: 0.019218
210500 -- (-694.639) [-693.476] (-695.775) (-692.649) * (-692.455) (-692.639) (-690.833) [-692.136] -- 0:00:52
211000 -- (-700.284) (-694.550) [-695.360] (-694.210) * (-695.299) (-693.915) (-693.675) [-696.196] -- 0:00:52
211500 -- [-695.684] (-692.517) (-690.531) (-693.333) * (-691.921) (-693.657) (-693.611) [-690.976] -- 0:00:52
212000 -- (-690.876) (-695.642) [-690.254] (-692.941) * (-694.466) (-695.807) [-690.511] (-692.094) -- 0:00:52
212500 -- (-695.827) (-696.891) [-692.481] (-696.165) * [-694.209] (-691.648) (-693.228) (-692.876) -- 0:00:51
213000 -- [-694.466] (-695.527) (-692.836) (-696.775) * (-695.852) (-696.044) [-691.760] (-697.003) -- 0:00:51
213500 -- [-692.872] (-691.346) (-692.014) (-692.641) * [-693.807] (-694.829) (-691.722) (-694.317) -- 0:00:51
214000 -- (-694.415) (-692.963) [-695.050] (-696.320) * [-691.193] (-694.112) (-695.085) (-693.711) -- 0:00:51
214500 -- [-695.878] (-691.270) (-692.874) (-691.830) * (-693.900) [-692.769] (-693.416) (-700.139) -- 0:00:51
215000 -- (-698.243) [-692.358] (-691.750) (-695.422) * (-695.513) (-697.289) [-693.906] (-697.764) -- 0:00:51
Average standard deviation of split frequencies: 0.018615
215500 -- (-699.095) (-695.432) (-692.089) [-694.130] * (-693.378) (-689.920) (-693.249) [-692.653] -- 0:00:50
216000 -- (-695.290) (-693.115) [-695.649] (-691.418) * [-694.294] (-694.574) (-696.346) (-692.713) -- 0:00:50
216500 -- (-699.801) (-693.555) (-700.056) [-694.012] * [-694.209] (-695.243) (-693.160) (-691.330) -- 0:00:50
217000 -- (-695.597) [-694.908] (-698.305) (-693.684) * (-692.515) (-702.763) [-693.960] (-696.211) -- 0:00:50
217500 -- (-691.413) (-693.958) [-692.382] (-691.602) * (-693.745) (-694.547) [-690.914] (-694.941) -- 0:00:50
218000 -- (-692.459) [-689.913] (-691.459) (-697.903) * (-693.071) [-694.040] (-693.058) (-692.738) -- 0:00:50
218500 -- (-693.029) (-693.612) [-694.813] (-693.268) * (-693.529) (-693.171) [-693.628] (-692.799) -- 0:00:50
219000 -- (-693.634) (-695.960) [-694.369] (-691.914) * (-697.050) (-694.735) (-692.109) [-693.941] -- 0:00:49
219500 -- (-695.479) (-692.910) [-691.474] (-693.012) * (-697.463) (-696.901) (-692.669) [-691.825] -- 0:00:49
220000 -- (-694.020) [-692.671] (-700.887) (-694.076) * [-692.845] (-696.715) (-693.484) (-701.382) -- 0:00:53
Average standard deviation of split frequencies: 0.018221
220500 -- (-697.029) [-691.683] (-697.267) (-696.384) * (-691.993) (-696.890) [-690.531] (-696.842) -- 0:00:53
221000 -- (-695.137) [-690.780] (-694.631) (-692.155) * [-694.415] (-697.360) (-692.121) (-695.255) -- 0:00:52
221500 -- (-692.427) [-693.975] (-694.944) (-693.866) * (-694.057) (-696.855) [-692.193] (-693.487) -- 0:00:52
222000 -- (-697.360) (-691.616) (-693.409) [-691.695] * (-696.502) [-694.685] (-691.847) (-696.431) -- 0:00:52
222500 -- (-694.545) (-693.386) (-693.539) [-691.716] * (-695.318) (-697.109) (-690.236) [-693.539] -- 0:00:52
223000 -- (-691.986) [-697.384] (-695.738) (-693.101) * (-692.165) [-694.369] (-691.607) (-696.617) -- 0:00:52
223500 -- (-695.594) (-693.831) (-692.659) [-695.523] * (-695.332) [-692.161] (-693.387) (-696.962) -- 0:00:52
224000 -- (-697.113) (-691.018) (-694.714) [-700.102] * [-695.180] (-694.225) (-694.472) (-693.544) -- 0:00:51
224500 -- (-697.166) (-692.642) [-692.262] (-694.931) * (-696.644) [-693.850] (-692.253) (-694.807) -- 0:00:51
225000 -- (-692.452) (-694.132) [-695.944] (-694.481) * (-700.530) (-693.185) (-694.908) [-693.472] -- 0:00:51
Average standard deviation of split frequencies: 0.019141
225500 -- (-691.956) (-697.806) [-692.491] (-694.546) * (-694.581) [-692.475] (-695.547) (-692.332) -- 0:00:51
226000 -- (-693.167) (-695.310) [-691.683] (-695.090) * (-697.894) (-692.277) (-695.402) [-693.309] -- 0:00:51
226500 -- (-694.521) (-691.408) [-695.896] (-698.507) * (-696.680) (-696.521) (-692.587) [-693.446] -- 0:00:51
227000 -- (-695.813) (-697.544) [-692.251] (-696.936) * [-695.097] (-696.157) (-698.662) (-694.156) -- 0:00:51
227500 -- [-696.800] (-693.060) (-692.286) (-697.821) * (-692.329) (-692.279) [-690.183] (-694.399) -- 0:00:50
228000 -- (-693.440) [-692.270] (-696.972) (-697.216) * (-695.298) [-691.250] (-693.430) (-694.896) -- 0:00:50
228500 -- [-694.145] (-699.836) (-694.706) (-698.696) * [-691.642] (-691.651) (-696.477) (-691.135) -- 0:00:50
229000 -- (-695.123) [-692.716] (-695.352) (-697.954) * (-694.018) [-695.509] (-694.793) (-700.897) -- 0:00:50
229500 -- (-697.713) (-693.276) (-692.161) [-692.337] * (-694.337) [-697.142] (-695.023) (-691.686) -- 0:00:50
230000 -- [-692.654] (-695.328) (-691.571) (-691.806) * [-693.701] (-693.882) (-698.886) (-691.662) -- 0:00:50
Average standard deviation of split frequencies: 0.017551
230500 -- [-696.648] (-693.147) (-695.951) (-694.996) * (-698.074) (-696.245) (-693.976) [-691.224] -- 0:00:50
231000 -- [-691.689] (-694.508) (-692.675) (-691.021) * (-694.675) [-691.678] (-692.790) (-692.692) -- 0:00:49
231500 -- (-693.691) (-692.424) [-694.821] (-692.046) * (-694.933) (-696.032) (-692.477) [-693.834] -- 0:00:49
232000 -- (-694.104) (-694.978) (-693.739) [-689.982] * [-691.498] (-695.448) (-692.564) (-690.179) -- 0:00:49
232500 -- (-699.540) [-690.762] (-694.525) (-693.126) * (-692.489) (-696.139) (-694.167) [-693.686] -- 0:00:49
233000 -- (-695.327) (-695.412) (-694.192) [-691.356] * (-695.896) (-690.742) (-692.596) [-690.928] -- 0:00:49
233500 -- (-696.077) (-696.573) [-693.466] (-692.561) * [-695.680] (-691.859) (-695.010) (-693.449) -- 0:00:49
234000 -- (-693.784) (-695.079) (-693.549) [-692.829] * (-698.366) [-692.644] (-697.135) (-695.535) -- 0:00:49
234500 -- (-698.049) (-692.966) [-696.204] (-693.163) * (-695.344) (-691.501) [-691.413] (-696.009) -- 0:00:48
235000 -- (-701.152) [-692.100] (-697.714) (-692.792) * [-695.032] (-694.322) (-693.276) (-692.393) -- 0:00:48
Average standard deviation of split frequencies: 0.016567
235500 -- (-698.676) [-693.322] (-696.798) (-692.072) * (-691.057) (-695.597) [-692.565] (-696.421) -- 0:00:51
236000 -- (-695.379) (-691.261) [-697.437] (-692.524) * [-692.259] (-697.801) (-694.284) (-697.858) -- 0:00:51
236500 -- (-692.776) [-691.908] (-695.034) (-693.303) * (-694.893) (-694.619) [-689.825] (-694.712) -- 0:00:51
237000 -- [-695.240] (-692.292) (-696.455) (-693.406) * [-695.844] (-693.850) (-691.529) (-692.840) -- 0:00:51
237500 -- (-693.115) (-693.368) (-693.578) [-693.584] * (-695.623) (-695.862) [-692.106] (-692.646) -- 0:00:51
238000 -- (-694.896) (-694.161) (-695.405) [-692.152] * [-694.805] (-697.347) (-698.525) (-694.240) -- 0:00:51
238500 -- (-692.158) [-691.248] (-695.434) (-692.398) * [-692.963] (-694.825) (-698.555) (-694.749) -- 0:00:51
239000 -- (-695.313) (-695.604) (-695.559) [-691.745] * (-692.938) [-692.654] (-691.871) (-696.854) -- 0:00:50
239500 -- (-692.270) (-694.688) [-694.691] (-691.996) * (-698.507) (-697.343) [-693.572] (-695.957) -- 0:00:50
240000 -- [-693.195] (-695.231) (-693.774) (-695.613) * (-694.503) (-693.496) [-695.109] (-697.258) -- 0:00:50
Average standard deviation of split frequencies: 0.017168
240500 -- (-696.101) [-695.501] (-693.693) (-693.536) * (-693.555) (-692.057) (-692.399) [-693.507] -- 0:00:50
241000 -- (-692.714) (-691.022) (-694.073) [-691.253] * (-694.245) [-693.594] (-693.988) (-693.011) -- 0:00:50
241500 -- (-692.151) [-693.169] (-697.546) (-694.662) * (-694.948) [-694.208] (-693.581) (-692.064) -- 0:00:50
242000 -- (-699.946) [-692.325] (-694.144) (-694.332) * (-695.384) (-694.510) (-692.363) [-692.639] -- 0:00:50
242500 -- (-694.573) [-694.540] (-694.104) (-690.211) * (-697.852) (-695.074) [-694.385] (-697.858) -- 0:00:49
243000 -- (-694.734) [-691.279] (-697.181) (-693.202) * (-694.110) (-693.366) (-693.308) [-692.208] -- 0:00:49
243500 -- (-697.854) [-695.655] (-691.617) (-692.171) * (-695.821) (-692.085) (-693.710) [-693.492] -- 0:00:49
244000 -- (-694.122) [-694.308] (-691.847) (-693.957) * (-697.346) [-693.723] (-692.803) (-692.904) -- 0:00:49
244500 -- (-694.500) [-692.566] (-699.347) (-695.500) * (-697.096) [-690.629] (-691.529) (-691.192) -- 0:00:49
245000 -- (-692.139) [-692.647] (-693.275) (-698.489) * (-691.322) (-696.863) (-691.987) [-702.305] -- 0:00:49
Average standard deviation of split frequencies: 0.018374
245500 -- (-697.734) [-693.671] (-692.209) (-691.240) * [-693.343] (-691.980) (-696.075) (-699.194) -- 0:00:49
246000 -- [-692.785] (-695.325) (-694.163) (-692.670) * (-693.643) (-701.321) [-694.948] (-699.244) -- 0:00:49
246500 -- (-693.322) (-691.203) [-692.404] (-691.267) * (-694.371) [-692.492] (-693.713) (-696.083) -- 0:00:48
247000 -- (-698.949) (-694.883) [-694.825] (-693.355) * (-693.422) (-693.926) [-695.996] (-695.875) -- 0:00:48
247500 -- [-698.330] (-690.885) (-696.674) (-691.010) * (-693.854) (-695.141) [-694.893] (-698.030) -- 0:00:48
248000 -- (-696.297) (-692.587) (-694.789) [-691.889] * [-692.690] (-691.695) (-692.018) (-695.049) -- 0:00:48
248500 -- (-696.081) [-691.493] (-697.766) (-693.143) * (-692.552) [-694.615] (-697.736) (-693.903) -- 0:00:48
249000 -- [-694.681] (-695.662) (-696.220) (-693.682) * [-693.430] (-696.959) (-693.941) (-694.238) -- 0:00:48
249500 -- [-691.364] (-692.821) (-692.218) (-690.976) * (-695.437) [-697.106] (-691.022) (-695.686) -- 0:00:48
250000 -- [-691.965] (-691.750) (-694.371) (-696.205) * (-696.760) [-692.062] (-694.251) (-696.447) -- 0:00:48
Average standard deviation of split frequencies: 0.017921
250500 -- (-692.473) [-690.309] (-691.522) (-698.783) * (-696.598) (-694.305) [-691.522] (-694.960) -- 0:00:47
251000 -- (-692.680) (-692.212) [-691.791] (-694.049) * (-695.829) (-692.814) (-690.586) [-692.010] -- 0:00:50
251500 -- (-692.208) [-696.453] (-696.240) (-694.233) * (-695.201) [-694.636] (-692.624) (-693.282) -- 0:00:50
252000 -- (-693.302) (-693.564) [-691.253] (-696.312) * (-695.445) (-695.676) (-695.368) [-691.602] -- 0:00:50
252500 -- (-698.125) (-692.671) [-691.769] (-692.446) * (-692.610) (-690.874) (-693.498) [-698.708] -- 0:00:50
253000 -- (-693.463) [-693.209] (-691.862) (-693.596) * (-691.746) (-694.909) (-694.731) [-694.651] -- 0:00:50
253500 -- [-692.946] (-696.160) (-702.097) (-691.047) * (-694.029) (-693.138) (-693.958) [-693.517] -- 0:00:50
254000 -- [-692.781] (-692.686) (-692.241) (-692.709) * [-692.733] (-698.403) (-691.604) (-693.496) -- 0:00:49
254500 -- (-693.793) (-694.410) (-690.523) [-692.341] * (-697.049) [-693.981] (-694.194) (-698.504) -- 0:00:49
255000 -- (-690.906) (-692.359) [-693.588] (-695.630) * (-692.310) [-694.238] (-692.343) (-695.744) -- 0:00:49
Average standard deviation of split frequencies: 0.016248
255500 -- (-693.009) [-691.572] (-692.900) (-695.106) * (-694.395) [-692.115] (-694.561) (-694.267) -- 0:00:49
256000 -- (-691.198) [-692.437] (-691.805) (-695.115) * [-692.457] (-693.281) (-695.177) (-694.025) -- 0:00:49
256500 -- [-691.007] (-693.906) (-692.458) (-695.407) * (-695.020) [-693.999] (-691.912) (-691.068) -- 0:00:49
257000 -- (-692.095) (-695.916) (-695.408) [-694.383] * (-695.765) (-691.980) [-695.962] (-698.094) -- 0:00:49
257500 -- (-693.359) [-698.005] (-692.595) (-696.477) * [-691.902] (-695.699) (-694.613) (-696.637) -- 0:00:49
258000 -- (-692.694) [-695.872] (-693.399) (-694.550) * (-695.207) (-693.978) (-694.158) [-694.289] -- 0:00:48
258500 -- [-692.831] (-697.280) (-694.662) (-695.505) * [-694.091] (-692.161) (-698.085) (-693.856) -- 0:00:48
259000 -- [-693.835] (-698.568) (-693.077) (-691.892) * (-697.287) (-692.972) (-708.415) [-694.925] -- 0:00:48
259500 -- [-696.011] (-698.050) (-693.054) (-697.708) * (-696.537) [-690.989] (-699.754) (-693.953) -- 0:00:48
260000 -- (-695.021) (-693.187) [-693.284] (-694.269) * (-695.089) [-692.231] (-693.183) (-691.797) -- 0:00:48
Average standard deviation of split frequencies: 0.016063
260500 -- [-691.210] (-694.356) (-694.685) (-693.703) * (-695.746) (-696.106) [-696.137] (-691.411) -- 0:00:48
261000 -- (-695.199) (-695.555) [-695.141] (-693.509) * (-697.255) (-693.387) [-696.421] (-691.434) -- 0:00:48
261500 -- (-695.161) (-697.599) (-694.180) [-695.866] * (-699.564) (-693.956) [-691.950] (-693.023) -- 0:00:48
262000 -- (-697.785) (-693.287) (-692.657) [-692.140] * (-694.727) [-693.562] (-693.416) (-694.174) -- 0:00:47
262500 -- [-691.809] (-694.370) (-693.761) (-693.288) * (-705.054) (-694.351) [-693.583] (-694.567) -- 0:00:47
263000 -- (-691.949) (-695.338) (-695.496) [-697.642] * (-697.755) (-693.439) (-693.856) [-694.239] -- 0:00:47
263500 -- (-694.862) (-700.009) (-696.033) [-693.177] * (-695.217) [-694.445] (-696.657) (-693.197) -- 0:00:47
264000 -- [-692.096] (-693.061) (-692.601) (-693.728) * (-693.663) (-691.386) (-693.371) [-696.496] -- 0:00:47
264500 -- (-690.675) (-698.733) (-694.703) [-693.943] * (-691.916) (-695.031) [-693.126] (-693.891) -- 0:00:47
265000 -- (-692.374) [-692.293] (-694.393) (-694.440) * (-694.514) (-694.776) (-695.957) [-693.892] -- 0:00:47
Average standard deviation of split frequencies: 0.016263
265500 -- (-695.977) [-697.785] (-692.922) (-695.857) * (-695.530) (-692.870) (-691.646) [-694.625] -- 0:00:47
266000 -- (-695.295) (-693.742) (-695.301) [-693.648] * (-694.030) (-693.159) (-695.268) [-694.715] -- 0:00:46
266500 -- (-693.019) (-697.497) (-696.003) [-692.797] * (-691.902) [-696.010] (-695.071) (-695.573) -- 0:00:49
267000 -- (-692.041) (-693.563) [-692.273] (-692.818) * (-694.970) [-693.813] (-694.323) (-695.004) -- 0:00:49
267500 -- (-689.691) [-694.657] (-694.929) (-693.753) * (-696.312) [-694.335] (-694.961) (-692.807) -- 0:00:49
268000 -- [-692.906] (-694.793) (-693.805) (-690.936) * (-694.624) (-695.947) (-694.449) [-693.973] -- 0:00:49
268500 -- (-695.412) [-693.755] (-694.637) (-695.400) * (-695.852) (-693.489) (-695.885) [-693.047] -- 0:00:49
269000 -- [-692.511] (-694.939) (-694.470) (-695.089) * (-695.317) (-697.203) [-693.046] (-694.697) -- 0:00:48
269500 -- (-694.200) (-695.506) (-696.255) [-691.984] * (-693.487) (-695.678) [-692.474] (-693.485) -- 0:00:48
270000 -- (-691.181) (-695.723) (-694.667) [-691.290] * [-692.543] (-694.922) (-692.889) (-694.319) -- 0:00:48
Average standard deviation of split frequencies: 0.016654
270500 -- (-691.386) (-695.587) [-696.942] (-692.853) * (-699.230) (-695.018) [-696.038] (-692.579) -- 0:00:48
271000 -- [-691.960] (-697.013) (-695.305) (-695.393) * (-697.038) (-692.067) (-693.285) [-694.069] -- 0:00:48
271500 -- (-693.715) (-694.220) (-698.687) [-695.814] * (-696.868) [-693.462] (-695.705) (-691.353) -- 0:00:48
272000 -- (-692.224) (-696.722) [-694.170] (-693.430) * [-690.958] (-695.723) (-694.752) (-692.356) -- 0:00:48
272500 -- [-693.567] (-696.190) (-691.629) (-698.101) * [-696.711] (-695.811) (-698.965) (-695.846) -- 0:00:48
273000 -- (-693.601) (-694.352) (-694.963) [-691.797] * [-697.916] (-698.531) (-699.257) (-695.160) -- 0:00:47
273500 -- (-690.461) (-696.937) (-694.452) [-697.765] * (-696.807) (-697.926) (-690.829) [-691.495] -- 0:00:47
274000 -- (-692.185) (-696.214) [-691.302] (-693.752) * (-699.515) (-695.552) (-693.479) [-690.957] -- 0:00:47
274500 -- [-692.062] (-696.937) (-694.029) (-692.444) * (-696.883) (-694.849) [-694.538] (-695.026) -- 0:00:47
275000 -- (-692.796) (-700.794) (-693.436) [-693.636] * (-696.275) (-695.181) (-693.958) [-692.474] -- 0:00:47
Average standard deviation of split frequencies: 0.017381
275500 -- [-693.187] (-698.795) (-692.372) (-693.352) * (-696.045) (-695.410) [-693.920] (-693.731) -- 0:00:47
276000 -- (-692.522) (-696.711) [-692.011] (-692.625) * (-692.650) (-694.241) (-694.562) [-694.311] -- 0:00:47
276500 -- (-695.214) (-695.017) (-695.427) [-690.865] * (-694.065) [-693.846] (-694.142) (-690.820) -- 0:00:47
277000 -- [-691.794] (-695.676) (-692.197) (-694.449) * (-698.486) (-692.325) [-696.428] (-690.895) -- 0:00:46
277500 -- (-692.798) (-699.577) [-691.274] (-695.599) * (-697.091) [-691.229] (-694.381) (-695.192) -- 0:00:46
278000 -- (-694.506) [-697.028] (-695.790) (-700.514) * (-696.084) (-699.823) (-696.721) [-694.925] -- 0:00:46
278500 -- (-694.075) (-696.618) [-692.131] (-695.589) * (-696.526) (-696.829) [-693.910] (-692.875) -- 0:00:46
279000 -- (-699.516) (-696.987) [-694.172] (-697.208) * (-698.180) [-693.561] (-695.334) (-697.724) -- 0:00:46
279500 -- [-693.399] (-693.387) (-693.468) (-695.693) * [-693.643] (-695.608) (-695.722) (-695.368) -- 0:00:46
280000 -- (-691.634) (-693.825) (-691.189) [-695.307] * [-691.898] (-697.475) (-694.531) (-693.146) -- 0:00:46
Average standard deviation of split frequencies: 0.017883
280500 -- [-691.737] (-696.999) (-692.838) (-694.558) * (-692.451) [-695.127] (-692.822) (-700.188) -- 0:00:46
281000 -- (-693.297) (-694.363) [-693.668] (-692.420) * (-696.145) (-699.539) (-693.130) [-693.971] -- 0:00:46
281500 -- [-696.645] (-695.359) (-694.772) (-693.701) * (-694.986) [-695.327] (-695.328) (-692.211) -- 0:00:45
282000 -- (-698.012) [-695.977] (-695.143) (-694.419) * (-694.510) (-695.419) (-693.094) [-693.038] -- 0:00:48
282500 -- [-697.005] (-696.379) (-695.769) (-691.218) * (-694.327) (-693.910) [-694.411] (-694.585) -- 0:00:48
283000 -- (-693.356) (-696.601) [-695.507] (-691.081) * (-698.289) (-695.688) [-694.227] (-693.540) -- 0:00:48
283500 -- [-692.347] (-693.975) (-696.218) (-694.618) * (-703.294) (-692.810) (-695.411) [-694.689] -- 0:00:48
284000 -- (-692.832) (-693.863) [-693.548] (-692.575) * [-696.978] (-692.993) (-695.397) (-693.613) -- 0:00:47
284500 -- [-693.989] (-692.335) (-690.383) (-691.517) * (-695.930) (-692.424) (-697.004) [-690.822] -- 0:00:47
285000 -- (-692.989) (-692.755) (-693.656) [-690.597] * (-695.171) [-693.371] (-697.506) (-693.025) -- 0:00:47
Average standard deviation of split frequencies: 0.018228
285500 -- (-691.897) [-692.761] (-693.909) (-693.840) * (-694.709) (-696.851) (-695.367) [-694.067] -- 0:00:47
286000 -- [-694.567] (-692.010) (-696.294) (-695.823) * (-694.810) [-693.721] (-694.368) (-695.084) -- 0:00:47
286500 -- (-691.183) (-699.043) [-696.634] (-694.275) * (-696.039) [-695.129] (-698.638) (-694.167) -- 0:00:47
287000 -- [-694.770] (-693.878) (-692.848) (-694.191) * (-693.590) (-694.769) (-696.017) [-692.349] -- 0:00:47
287500 -- (-692.650) [-691.664] (-696.877) (-696.262) * (-694.390) (-695.836) (-694.849) [-694.345] -- 0:00:47
288000 -- (-692.612) (-696.174) (-696.081) [-690.056] * [-693.810] (-692.968) (-695.498) (-693.932) -- 0:00:46
288500 -- [-691.937] (-693.124) (-698.986) (-694.161) * (-692.214) (-698.415) (-696.068) [-692.241] -- 0:00:46
289000 -- (-693.910) (-691.545) (-696.103) [-693.109] * [-694.267] (-691.244) (-702.290) (-696.029) -- 0:00:46
289500 -- (-692.546) [-693.148] (-695.087) (-693.845) * (-697.186) (-695.045) (-698.777) [-695.634] -- 0:00:46
290000 -- (-693.770) (-697.437) (-693.508) [-693.003] * (-693.356) [-695.722] (-698.405) (-698.614) -- 0:00:46
Average standard deviation of split frequencies: 0.017077
290500 -- (-698.018) (-697.493) (-691.560) [-692.745] * (-694.031) (-694.652) [-694.243] (-696.621) -- 0:00:46
291000 -- (-696.657) (-694.329) [-693.537] (-696.129) * [-694.138] (-694.684) (-698.277) (-694.380) -- 0:00:46
291500 -- (-692.783) (-697.502) (-699.131) [-693.248] * (-692.932) (-696.145) (-694.993) [-693.981] -- 0:00:46
292000 -- (-693.794) [-694.670] (-702.075) (-694.522) * (-695.453) (-692.837) (-694.899) [-694.950] -- 0:00:46
292500 -- (-693.842) [-692.001] (-692.324) (-693.919) * (-691.345) (-696.622) (-695.134) [-694.831] -- 0:00:45
293000 -- [-695.608] (-695.883) (-693.355) (-691.968) * (-691.394) [-693.690] (-697.032) (-697.509) -- 0:00:45
293500 -- (-695.108) (-691.598) [-699.631] (-695.645) * (-694.183) (-696.332) (-699.135) [-693.824] -- 0:00:45
294000 -- [-697.451] (-695.029) (-696.078) (-692.862) * (-694.212) [-692.464] (-696.252) (-692.839) -- 0:00:45
294500 -- (-698.878) (-694.254) (-697.247) [-691.241] * (-693.963) [-692.456] (-692.128) (-698.292) -- 0:00:45
295000 -- (-694.422) (-693.133) [-700.256] (-694.937) * (-692.276) [-694.084] (-699.461) (-694.756) -- 0:00:45
Average standard deviation of split frequencies: 0.016488
295500 -- [-694.103] (-694.080) (-698.177) (-693.730) * [-693.470] (-693.127) (-705.650) (-701.264) -- 0:00:45
296000 -- (-697.220) (-693.347) (-691.551) [-691.347] * (-696.076) (-693.962) [-696.772] (-696.768) -- 0:00:45
296500 -- (-695.290) [-695.982] (-692.685) (-693.414) * [-692.446] (-692.962) (-694.643) (-698.813) -- 0:00:45
297000 -- (-699.045) [-695.880] (-692.203) (-695.020) * (-693.160) (-697.279) [-694.444] (-694.271) -- 0:00:44
297500 -- (-696.349) [-695.557] (-692.329) (-694.895) * (-692.895) [-695.481] (-694.037) (-695.653) -- 0:00:47
298000 -- (-698.474) (-696.060) (-694.088) [-694.500] * (-695.629) (-690.805) (-694.169) [-693.913] -- 0:00:47
298500 -- (-694.976) [-695.986] (-694.405) (-694.551) * [-690.383] (-693.840) (-695.601) (-695.084) -- 0:00:47
299000 -- (-698.514) (-694.795) (-693.141) [-690.865] * [-694.116] (-694.961) (-696.506) (-695.483) -- 0:00:46
299500 -- [-693.919] (-694.937) (-696.376) (-695.756) * [-692.740] (-693.067) (-694.522) (-694.631) -- 0:00:46
300000 -- (-693.318) (-705.267) [-692.268] (-693.155) * (-691.795) (-694.504) (-690.917) [-695.688] -- 0:00:46
Average standard deviation of split frequencies: 0.015955
300500 -- (-693.213) (-702.556) [-692.879] (-692.505) * [-694.330] (-694.905) (-694.324) (-695.595) -- 0:00:46
301000 -- (-693.774) (-701.996) (-692.128) [-695.228] * [-695.377] (-690.436) (-695.148) (-696.267) -- 0:00:46
301500 -- (-693.513) (-695.428) [-696.539] (-691.353) * (-693.537) (-693.313) (-693.304) [-691.874] -- 0:00:46
302000 -- (-700.438) [-693.563] (-694.729) (-693.345) * [-693.744] (-694.130) (-694.404) (-695.498) -- 0:00:46
302500 -- (-693.294) [-692.574] (-694.161) (-692.991) * (-695.872) [-692.400] (-697.503) (-692.310) -- 0:00:46
303000 -- [-691.947] (-692.733) (-697.018) (-696.561) * (-697.615) [-693.646] (-696.744) (-692.181) -- 0:00:46
303500 -- [-698.953] (-692.553) (-696.100) (-693.236) * (-693.824) (-692.345) [-697.079] (-692.428) -- 0:00:45
304000 -- (-695.393) (-691.755) (-700.425) [-695.226] * (-692.905) (-692.104) (-691.956) [-693.280] -- 0:00:45
304500 -- (-695.156) (-696.139) [-694.353] (-692.364) * (-693.801) (-695.160) [-693.881] (-696.096) -- 0:00:45
305000 -- (-693.748) (-693.640) [-693.434] (-693.666) * (-695.030) (-696.224) [-692.271] (-691.226) -- 0:00:45
Average standard deviation of split frequencies: 0.015949
305500 -- (-693.491) (-696.547) (-694.094) [-691.068] * (-694.640) (-700.843) [-692.479] (-693.376) -- 0:00:45
306000 -- [-696.707] (-691.717) (-692.543) (-692.314) * (-692.971) (-699.946) [-691.469] (-699.851) -- 0:00:45
306500 -- (-694.212) [-694.231] (-694.163) (-693.808) * (-695.054) (-697.454) [-695.343] (-692.881) -- 0:00:45
307000 -- (-692.752) (-700.813) [-695.284] (-693.641) * (-695.285) (-691.457) [-693.135] (-694.603) -- 0:00:45
307500 -- (-694.175) (-696.043) [-694.676] (-695.554) * (-694.963) [-694.108] (-692.500) (-691.970) -- 0:00:45
308000 -- (-692.078) [-697.560] (-695.174) (-693.213) * (-693.539) [-696.129] (-698.291) (-692.529) -- 0:00:44
308500 -- [-694.231] (-694.307) (-692.829) (-696.758) * (-694.056) (-694.682) [-694.338] (-693.778) -- 0:00:44
309000 -- (-694.789) [-690.651] (-692.239) (-692.442) * [-693.669] (-692.174) (-692.894) (-696.361) -- 0:00:44
309500 -- (-694.996) [-692.590] (-694.175) (-695.555) * (-693.762) (-695.590) [-693.245] (-691.407) -- 0:00:44
310000 -- (-696.872) (-694.455) [-692.240] (-696.368) * (-694.937) (-698.613) (-694.749) [-691.996] -- 0:00:44
Average standard deviation of split frequencies: 0.015531
310500 -- [-692.342] (-700.285) (-692.331) (-692.543) * (-696.355) (-696.606) [-693.399] (-691.408) -- 0:00:44
311000 -- [-692.592] (-692.736) (-693.997) (-695.195) * [-695.802] (-692.910) (-693.410) (-693.119) -- 0:00:44
311500 -- [-695.253] (-698.666) (-698.083) (-695.610) * (-695.165) [-693.610] (-690.610) (-692.660) -- 0:00:44
312000 -- (-695.477) (-691.927) (-695.815) [-693.679] * (-694.907) (-696.263) [-692.848] (-692.610) -- 0:00:44
312500 -- (-694.719) [-693.184] (-695.626) (-696.411) * (-694.767) (-692.825) [-690.774] (-692.714) -- 0:00:46
313000 -- (-692.124) [-691.057] (-699.009) (-694.304) * (-694.192) (-698.525) (-693.933) [-693.194] -- 0:00:46
313500 -- [-693.273] (-694.640) (-694.932) (-696.487) * (-703.302) (-692.255) [-693.026] (-693.903) -- 0:00:45
314000 -- (-695.130) (-696.358) [-691.479] (-694.811) * (-699.159) (-692.741) [-692.232] (-695.270) -- 0:00:45
314500 -- [-692.966] (-692.501) (-693.325) (-695.201) * (-692.396) (-695.128) [-693.662] (-694.900) -- 0:00:45
315000 -- (-696.561) [-691.014] (-697.269) (-695.090) * [-695.112] (-691.618) (-690.742) (-693.347) -- 0:00:45
Average standard deviation of split frequencies: 0.015001
315500 -- (-695.011) [-691.131] (-694.228) (-694.619) * (-693.655) (-693.116) [-691.132] (-692.706) -- 0:00:45
316000 -- (-691.120) [-691.962] (-696.032) (-692.494) * (-696.145) (-695.492) (-696.425) [-690.880] -- 0:00:45
316500 -- (-691.121) [-692.923] (-698.071) (-693.678) * (-697.708) (-692.857) (-696.166) [-692.571] -- 0:00:45
317000 -- [-696.086] (-694.447) (-699.367) (-693.952) * [-692.297] (-692.817) (-696.128) (-694.703) -- 0:00:45
317500 -- (-694.471) (-691.258) (-691.787) [-694.620] * [-693.093] (-691.572) (-692.509) (-693.828) -- 0:00:45
318000 -- (-695.583) (-694.319) (-693.301) [-694.247] * (-693.900) (-691.605) [-693.412] (-690.454) -- 0:00:45
318500 -- (-693.947) [-692.410] (-698.450) (-695.115) * [-693.893] (-693.621) (-693.912) (-695.999) -- 0:00:44
319000 -- (-698.553) [-692.949] (-692.819) (-694.676) * [-693.730] (-691.329) (-691.569) (-693.594) -- 0:00:44
319500 -- (-695.442) (-692.060) (-696.752) [-695.988] * (-693.653) (-694.246) (-693.642) [-691.590] -- 0:00:44
320000 -- (-692.004) [-692.955] (-692.943) (-695.926) * [-691.692] (-691.794) (-692.198) (-697.006) -- 0:00:44
Average standard deviation of split frequencies: 0.014182
320500 -- (-692.681) (-692.477) [-693.714] (-695.959) * (-696.480) [-693.118] (-691.710) (-696.930) -- 0:00:44
321000 -- [-692.891] (-692.221) (-694.786) (-695.231) * [-696.880] (-693.577) (-692.642) (-695.067) -- 0:00:44
321500 -- [-694.981] (-697.907) (-697.183) (-693.275) * (-691.436) (-693.160) [-691.813] (-693.203) -- 0:00:44
322000 -- (-695.126) (-692.349) (-694.447) [-697.544] * [-691.514] (-696.582) (-691.599) (-693.586) -- 0:00:44
322500 -- (-692.340) (-695.565) (-699.147) [-693.110] * [-693.085] (-693.349) (-696.172) (-693.985) -- 0:00:44
323000 -- [-693.669] (-694.024) (-695.925) (-692.151) * (-693.101) (-694.898) (-692.222) [-693.982] -- 0:00:44
323500 -- (-697.278) (-695.347) (-693.392) [-695.194] * (-694.013) (-698.105) [-691.478] (-692.396) -- 0:00:43
324000 -- (-695.033) (-697.275) (-695.734) [-695.362] * [-692.618] (-691.930) (-692.766) (-693.457) -- 0:00:43
324500 -- (-695.287) (-694.819) (-694.913) [-693.085] * [-690.975] (-692.722) (-692.623) (-692.062) -- 0:00:43
325000 -- (-692.842) (-698.066) [-691.629] (-693.911) * [-694.370] (-698.512) (-697.761) (-693.469) -- 0:00:43
Average standard deviation of split frequencies: 0.013737
325500 -- (-692.745) (-694.923) (-692.099) [-693.931] * (-693.090) (-697.344) (-692.763) [-691.147] -- 0:00:43
326000 -- (-693.987) (-695.960) [-693.975] (-692.144) * [-693.989] (-694.164) (-695.890) (-701.175) -- 0:00:43
326500 -- (-694.746) (-698.336) [-695.195] (-692.261) * (-690.765) [-693.377] (-692.243) (-693.225) -- 0:00:43
327000 -- (-695.342) (-691.093) (-695.174) [-693.129] * [-692.114] (-692.571) (-697.989) (-692.358) -- 0:00:43
327500 -- (-694.259) (-692.397) (-695.225) [-695.810] * (-692.121) [-691.614] (-696.477) (-692.710) -- 0:00:43
328000 -- [-694.346] (-691.570) (-694.374) (-692.488) * (-694.776) (-692.720) (-696.213) [-692.153] -- 0:00:45
328500 -- (-698.061) [-697.680] (-696.667) (-694.638) * (-692.772) (-695.169) (-694.858) [-693.226] -- 0:00:44
329000 -- (-696.091) (-692.875) (-695.323) [-693.869] * [-692.718] (-696.683) (-691.921) (-693.433) -- 0:00:44
329500 -- (-693.153) [-692.774] (-693.292) (-703.316) * (-692.229) (-694.875) (-691.838) [-693.228] -- 0:00:44
330000 -- (-691.890) (-693.272) [-696.831] (-694.524) * [-690.323] (-694.455) (-697.386) (-702.503) -- 0:00:44
Average standard deviation of split frequencies: 0.014088
330500 -- (-694.061) (-692.752) [-696.455] (-691.777) * (-692.926) (-695.091) (-700.632) [-696.289] -- 0:00:44
331000 -- (-694.082) (-694.486) (-694.579) [-696.657] * (-692.016) (-693.558) [-696.906] (-690.689) -- 0:00:44
331500 -- (-694.711) (-691.820) [-693.297] (-694.811) * [-692.342] (-695.187) (-693.578) (-694.126) -- 0:00:44
332000 -- (-695.840) (-691.856) [-693.324] (-693.980) * (-691.223) [-693.246] (-693.442) (-694.875) -- 0:00:44
332500 -- (-691.521) (-692.900) [-698.080] (-693.890) * (-691.806) [-692.878] (-692.807) (-690.759) -- 0:00:44
333000 -- [-693.822] (-692.984) (-696.758) (-692.239) * [-696.694] (-694.418) (-696.493) (-697.098) -- 0:00:44
333500 -- (-692.177) (-693.525) (-694.994) [-694.007] * [-692.933] (-693.627) (-695.826) (-696.435) -- 0:00:43
334000 -- [-693.381] (-690.938) (-696.528) (-692.922) * [-693.966] (-703.735) (-690.435) (-697.955) -- 0:00:43
334500 -- (-694.776) (-691.576) [-694.595] (-694.128) * [-693.330] (-691.036) (-692.640) (-695.938) -- 0:00:43
335000 -- (-693.526) [-694.021] (-695.294) (-695.417) * [-693.128] (-698.447) (-696.718) (-697.795) -- 0:00:43
Average standard deviation of split frequencies: 0.014030
335500 -- (-693.057) (-691.786) (-691.853) [-693.344] * [-697.764] (-692.314) (-692.360) (-692.441) -- 0:00:43
336000 -- (-691.403) [-693.417] (-692.959) (-691.745) * (-697.114) (-697.230) (-693.713) [-694.788] -- 0:00:43
336500 -- (-691.590) (-693.529) (-692.347) [-693.107] * (-694.354) [-693.749] (-693.278) (-699.100) -- 0:00:43
337000 -- (-696.941) (-692.561) [-692.144] (-697.603) * (-690.625) (-697.564) (-692.322) [-695.594] -- 0:00:43
337500 -- (-698.324) [-693.775] (-698.674) (-698.100) * (-696.179) [-696.207] (-693.737) (-695.720) -- 0:00:43
338000 -- (-693.413) [-691.052] (-696.554) (-695.364) * (-692.299) (-692.122) (-696.397) [-692.684] -- 0:00:43
338500 -- (-692.966) [-692.204] (-696.383) (-694.811) * (-692.985) (-696.047) [-696.196] (-694.786) -- 0:00:42
339000 -- [-693.622] (-696.469) (-696.495) (-695.384) * (-695.442) (-693.054) (-694.912) [-693.933] -- 0:00:42
339500 -- [-695.902] (-693.909) (-695.663) (-696.859) * (-691.174) (-695.530) (-691.425) [-694.039] -- 0:00:42
340000 -- (-693.042) (-694.951) (-693.121) [-695.519] * (-694.789) [-694.432] (-693.341) (-694.363) -- 0:00:42
Average standard deviation of split frequencies: 0.014376
340500 -- (-694.268) (-694.169) (-690.791) [-698.211] * (-695.345) [-694.665] (-691.855) (-694.042) -- 0:00:42
341000 -- (-693.787) (-696.658) (-697.638) [-693.870] * (-695.295) [-692.133] (-692.759) (-699.825) -- 0:00:42
341500 -- (-694.015) (-691.165) (-693.869) [-694.324] * [-694.327] (-694.350) (-695.509) (-698.274) -- 0:00:42
342000 -- (-696.548) (-692.568) [-691.808] (-697.408) * [-693.068] (-693.440) (-698.477) (-695.208) -- 0:00:42
342500 -- [-694.772] (-693.642) (-692.589) (-704.145) * (-693.064) [-693.027] (-691.344) (-691.251) -- 0:00:42
343000 -- (-694.912) (-693.091) [-694.047] (-705.209) * (-693.017) (-694.033) [-691.147] (-694.596) -- 0:00:44
343500 -- [-697.104] (-692.227) (-698.890) (-696.990) * (-691.337) (-693.654) (-692.660) [-693.618] -- 0:00:43
344000 -- (-692.823) [-692.453] (-694.156) (-697.518) * (-691.798) (-694.784) (-697.575) [-696.207] -- 0:00:43
344500 -- (-695.506) (-694.203) [-692.552] (-695.359) * (-692.492) [-697.527] (-694.167) (-691.698) -- 0:00:43
345000 -- (-698.347) (-691.424) [-691.538] (-696.118) * (-693.425) (-692.794) (-693.368) [-692.394] -- 0:00:43
Average standard deviation of split frequencies: 0.014760
345500 -- [-695.463] (-695.230) (-692.972) (-696.831) * (-693.541) (-692.245) (-693.241) [-690.467] -- 0:00:43
346000 -- (-694.262) [-693.949] (-694.664) (-694.227) * (-693.391) (-695.433) (-694.370) [-692.464] -- 0:00:43
346500 -- (-704.302) [-693.138] (-696.472) (-693.055) * (-696.034) (-693.458) [-691.937] (-694.862) -- 0:00:43
347000 -- (-704.740) [-695.690] (-693.308) (-697.477) * (-697.150) (-693.981) [-691.664] (-693.618) -- 0:00:43
347500 -- (-700.539) [-695.209] (-696.486) (-694.060) * (-693.405) [-696.241] (-691.973) (-695.437) -- 0:00:43
348000 -- (-698.139) (-698.247) (-698.278) [-695.376] * [-692.843] (-693.421) (-692.693) (-695.177) -- 0:00:43
348500 -- [-693.895] (-693.801) (-698.378) (-696.402) * (-689.362) (-695.711) (-694.093) [-690.297] -- 0:00:42
349000 -- (-695.147) (-695.471) (-698.426) [-696.050] * (-697.614) (-693.945) (-693.858) [-691.250] -- 0:00:42
349500 -- (-694.580) [-694.666] (-693.526) (-694.435) * (-697.447) [-694.155] (-692.155) (-694.297) -- 0:00:42
350000 -- [-691.821] (-693.089) (-694.189) (-691.634) * [-697.742] (-692.394) (-692.751) (-694.709) -- 0:00:42
Average standard deviation of split frequencies: 0.014787
350500 -- (-693.050) (-693.810) (-691.892) [-694.519] * [-693.508] (-694.507) (-691.527) (-696.752) -- 0:00:42
351000 -- (-692.903) (-691.706) (-692.211) [-696.138] * (-692.858) (-692.470) (-694.730) [-697.260] -- 0:00:42
351500 -- (-695.291) (-691.629) (-692.619) [-694.695] * [-693.478] (-692.476) (-694.131) (-693.117) -- 0:00:42
352000 -- (-698.068) [-694.105] (-696.047) (-693.711) * (-691.763) [-695.541] (-691.756) (-695.086) -- 0:00:42
352500 -- (-697.343) [-694.661] (-693.450) (-694.787) * (-695.618) (-694.438) [-692.441] (-693.312) -- 0:00:42
353000 -- (-693.631) (-693.487) (-692.886) [-691.649] * [-693.225] (-693.105) (-692.327) (-691.157) -- 0:00:42
353500 -- (-695.487) (-695.057) (-694.466) [-692.975] * (-692.516) (-695.594) (-691.598) [-692.271] -- 0:00:42
354000 -- (-700.807) (-693.676) [-695.393] (-693.259) * (-696.371) [-693.093] (-692.557) (-692.894) -- 0:00:41
354500 -- [-693.256] (-694.325) (-697.954) (-694.588) * (-692.262) (-693.768) (-692.693) [-690.312] -- 0:00:41
355000 -- (-694.747) [-699.326] (-698.876) (-693.716) * (-691.434) (-695.149) (-692.055) [-696.951] -- 0:00:41
Average standard deviation of split frequencies: 0.015154
355500 -- [-695.206] (-693.973) (-697.019) (-694.753) * (-692.060) [-695.645] (-693.906) (-694.496) -- 0:00:41
356000 -- (-695.628) (-692.645) (-694.586) [-695.787] * (-696.973) (-693.776) [-692.346] (-696.152) -- 0:00:41
356500 -- [-695.375] (-695.021) (-697.909) (-693.965) * (-698.831) (-692.729) [-693.682] (-693.050) -- 0:00:41
357000 -- [-696.120] (-691.883) (-694.362) (-694.596) * (-694.725) (-691.205) [-691.607] (-698.379) -- 0:00:41
357500 -- (-691.863) [-692.639] (-695.001) (-694.967) * (-693.422) (-690.771) (-695.709) [-695.017] -- 0:00:41
358000 -- (-694.071) [-693.742] (-697.185) (-693.858) * (-693.212) [-695.031] (-691.197) (-693.366) -- 0:00:43
358500 -- (-694.368) [-691.960] (-692.317) (-700.807) * (-696.914) [-694.768] (-693.738) (-694.715) -- 0:00:42
359000 -- (-701.013) [-691.985] (-691.931) (-693.937) * (-695.934) (-695.925) (-696.372) [-696.065] -- 0:00:42
359500 -- (-693.097) (-692.248) (-696.454) [-692.940] * (-695.907) [-691.990] (-691.041) (-697.324) -- 0:00:42
360000 -- (-699.103) (-692.943) [-694.803] (-693.774) * (-696.685) (-695.804) [-692.153] (-693.742) -- 0:00:42
Average standard deviation of split frequencies: 0.014147
360500 -- (-695.002) [-696.819] (-694.709) (-694.790) * (-693.856) (-694.360) [-693.193] (-695.794) -- 0:00:42
361000 -- (-696.515) (-695.480) (-694.101) [-693.679] * (-693.658) [-693.791] (-699.213) (-691.189) -- 0:00:42
361500 -- (-697.068) (-696.616) (-692.230) [-696.843] * (-692.525) (-694.831) [-690.034] (-692.184) -- 0:00:42
362000 -- (-699.566) (-692.188) [-690.371] (-693.518) * (-693.213) [-693.983] (-697.330) (-701.128) -- 0:00:42
362500 -- [-698.621] (-697.446) (-694.912) (-691.612) * (-694.435) [-692.867] (-690.680) (-698.901) -- 0:00:42
363000 -- [-695.207] (-694.758) (-694.973) (-694.570) * [-691.276] (-693.367) (-696.638) (-697.857) -- 0:00:42
363500 -- [-692.130] (-691.291) (-694.292) (-693.671) * [-695.027] (-692.252) (-696.283) (-696.188) -- 0:00:42
364000 -- (-696.581) (-691.296) (-694.910) [-692.916] * (-693.714) (-694.635) [-692.546] (-695.774) -- 0:00:41
364500 -- (-696.076) [-692.958] (-694.806) (-695.197) * [-698.035] (-695.678) (-695.354) (-694.502) -- 0:00:41
365000 -- (-695.626) [-693.766] (-695.125) (-692.354) * [-692.949] (-692.796) (-697.926) (-696.322) -- 0:00:41
Average standard deviation of split frequencies: 0.013941
365500 -- (-693.621) [-693.243] (-695.550) (-697.952) * (-695.768) (-693.102) [-693.743] (-695.412) -- 0:00:41
366000 -- [-693.002] (-697.301) (-694.052) (-693.414) * (-699.451) [-690.872] (-691.998) (-695.454) -- 0:00:41
366500 -- (-693.809) (-693.184) (-694.778) [-693.203] * (-694.272) (-692.937) [-694.674] (-695.922) -- 0:00:41
367000 -- [-692.155] (-694.176) (-692.684) (-694.154) * (-691.999) (-692.936) (-693.700) [-693.375] -- 0:00:41
367500 -- [-693.892] (-695.014) (-695.448) (-694.518) * (-695.828) [-692.354] (-693.436) (-705.561) -- 0:00:41
368000 -- [-692.634] (-695.390) (-695.608) (-693.127) * (-692.823) (-694.997) (-694.651) [-694.673] -- 0:00:41
368500 -- (-695.410) (-691.717) (-693.900) [-694.594] * (-692.264) (-698.104) (-691.316) [-696.713] -- 0:00:41
369000 -- [-696.053] (-691.800) (-694.254) (-695.570) * (-693.273) [-695.484] (-693.861) (-692.464) -- 0:00:41
369500 -- (-692.982) (-691.580) [-695.262] (-695.609) * (-694.618) (-697.994) [-692.761] (-697.353) -- 0:00:40
370000 -- (-692.172) (-693.742) [-693.168] (-692.046) * [-694.714] (-694.226) (-694.917) (-693.996) -- 0:00:40
Average standard deviation of split frequencies: 0.013466
370500 -- [-691.669] (-694.800) (-692.070) (-694.188) * [-692.453] (-693.938) (-696.263) (-694.001) -- 0:00:40
371000 -- (-692.625) (-694.516) (-693.532) [-693.450] * (-693.124) (-690.824) [-692.397] (-696.441) -- 0:00:40
371500 -- (-691.502) [-691.235] (-697.347) (-696.472) * (-695.568) [-693.371] (-692.358) (-697.984) -- 0:00:40
372000 -- [-691.626] (-695.763) (-696.088) (-696.148) * (-692.957) (-694.368) (-693.331) [-696.024] -- 0:00:40
372500 -- (-696.085) (-693.467) (-697.181) [-694.464] * (-693.535) (-693.883) [-690.894] (-693.558) -- 0:00:40
373000 -- [-697.208] (-696.232) (-694.258) (-693.590) * [-691.476] (-691.774) (-691.892) (-695.337) -- 0:00:40
373500 -- (-693.021) (-693.428) (-697.831) [-692.347] * (-694.190) (-694.260) [-692.534] (-697.456) -- 0:00:41
374000 -- [-693.548] (-690.975) (-694.962) (-694.534) * [-695.248] (-695.899) (-691.833) (-691.859) -- 0:00:41
374500 -- (-694.256) (-694.405) [-695.815] (-693.226) * (-694.143) [-692.158] (-695.535) (-695.802) -- 0:00:41
375000 -- (-696.520) [-691.868] (-702.074) (-692.814) * (-692.145) [-693.549] (-693.377) (-693.841) -- 0:00:41
Average standard deviation of split frequencies: 0.013865
375500 -- (-692.387) [-691.962] (-697.909) (-692.399) * (-694.835) (-695.557) [-693.454] (-694.474) -- 0:00:41
376000 -- [-698.356] (-693.871) (-697.854) (-691.256) * [-692.969] (-692.857) (-692.961) (-693.791) -- 0:00:41
376500 -- [-694.730] (-691.995) (-695.525) (-691.961) * (-694.225) [-698.423] (-693.887) (-699.250) -- 0:00:41
377000 -- [-692.580] (-690.956) (-695.196) (-694.504) * (-694.237) (-692.333) (-692.116) [-692.049] -- 0:00:41
377500 -- (-694.557) (-693.002) [-695.210] (-694.707) * [-695.875] (-694.787) (-694.730) (-695.322) -- 0:00:41
378000 -- (-694.294) [-690.785] (-693.607) (-696.764) * [-695.824] (-692.529) (-692.606) (-691.566) -- 0:00:41
378500 -- (-693.571) (-691.191) (-697.621) [-694.577] * (-692.070) (-695.148) (-695.748) [-690.761] -- 0:00:41
379000 -- (-692.957) (-692.958) [-693.406] (-696.730) * (-693.557) (-693.324) [-693.619] (-696.600) -- 0:00:40
379500 -- (-696.965) (-694.883) (-694.727) [-693.547] * [-690.547] (-696.159) (-693.320) (-693.478) -- 0:00:40
380000 -- (-694.789) (-692.856) [-693.778] (-694.772) * (-692.502) [-697.722] (-696.307) (-696.489) -- 0:00:40
Average standard deviation of split frequencies: 0.013403
380500 -- [-692.150] (-696.888) (-695.291) (-693.446) * (-698.618) (-695.967) (-693.471) [-689.941] -- 0:00:40
381000 -- [-692.762] (-695.615) (-695.089) (-694.223) * [-693.315] (-698.306) (-692.806) (-695.083) -- 0:00:40
381500 -- (-691.835) (-697.002) [-692.713] (-702.617) * (-695.276) (-700.221) [-695.364] (-693.273) -- 0:00:40
382000 -- (-692.883) (-691.061) (-695.407) [-697.748] * [-696.606] (-698.172) (-691.784) (-696.521) -- 0:00:40
382500 -- (-697.947) [-695.240] (-698.237) (-694.249) * (-694.838) (-693.493) [-693.815] (-693.767) -- 0:00:40
383000 -- [-694.794] (-696.750) (-693.248) (-697.118) * [-691.281] (-698.062) (-693.243) (-695.758) -- 0:00:40
383500 -- (-692.408) [-692.336] (-692.790) (-695.571) * [-692.065] (-693.067) (-699.233) (-695.818) -- 0:00:40
384000 -- (-695.772) [-693.183] (-700.207) (-696.874) * [-693.840] (-691.674) (-697.826) (-692.918) -- 0:00:40
384500 -- [-695.534] (-691.598) (-698.189) (-692.768) * (-693.299) [-695.354] (-696.388) (-693.838) -- 0:00:40
385000 -- (-695.061) (-696.011) (-693.080) [-690.904] * (-692.390) [-693.760] (-698.542) (-694.550) -- 0:00:39
Average standard deviation of split frequencies: 0.013506
385500 -- (-692.433) (-692.693) [-693.025] (-693.873) * (-692.043) (-691.982) [-696.109] (-696.499) -- 0:00:39
386000 -- (-691.114) (-697.014) (-691.706) [-695.341] * (-695.426) (-694.146) (-693.742) [-693.396] -- 0:00:39
386500 -- (-695.236) (-696.456) [-694.716] (-696.645) * (-693.893) (-695.199) [-696.331] (-693.874) -- 0:00:39
387000 -- [-692.012] (-693.053) (-696.912) (-693.265) * (-692.289) [-696.055] (-694.034) (-696.267) -- 0:00:39
387500 -- (-695.808) (-693.418) [-690.912] (-699.609) * (-690.992) (-696.247) (-693.745) [-691.146] -- 0:00:39
388000 -- (-692.209) (-697.928) (-694.431) [-695.364] * [-693.103] (-694.216) (-694.216) (-693.427) -- 0:00:39
388500 -- (-694.855) (-689.903) (-696.560) [-695.306] * (-691.910) [-691.551] (-692.558) (-693.059) -- 0:00:39
389000 -- (-696.448) (-692.633) (-691.893) [-692.721] * [-692.219] (-695.502) (-692.910) (-695.410) -- 0:00:40
389500 -- (-695.741) (-698.423) (-692.159) [-690.941] * (-694.210) [-691.348] (-693.082) (-695.459) -- 0:00:40
390000 -- (-698.654) (-693.701) (-695.393) [-692.242] * (-691.569) [-692.423] (-692.172) (-695.711) -- 0:00:40
Average standard deviation of split frequencies: 0.013060
390500 -- (-700.046) (-691.983) [-695.187] (-695.186) * (-691.375) [-694.928] (-696.364) (-693.651) -- 0:00:40
391000 -- (-693.593) (-694.014) [-692.682] (-692.915) * [-692.843] (-698.228) (-691.896) (-696.169) -- 0:00:40
391500 -- (-693.827) (-696.194) [-691.065] (-694.303) * (-692.656) (-693.910) [-692.536] (-694.125) -- 0:00:40
392000 -- (-692.890) (-695.328) (-693.756) [-694.795] * [-692.854] (-693.909) (-692.994) (-698.760) -- 0:00:40
392500 -- (-691.288) [-693.885] (-698.181) (-695.821) * [-692.583] (-692.815) (-697.336) (-692.376) -- 0:00:40
393000 -- [-692.434] (-695.644) (-697.314) (-693.256) * (-693.336) (-695.628) [-699.607] (-693.314) -- 0:00:40
393500 -- (-692.224) [-692.863] (-694.470) (-694.586) * (-693.717) [-694.574] (-691.873) (-696.211) -- 0:00:40
394000 -- (-695.876) (-695.937) (-692.372) [-692.801] * [-694.820] (-696.082) (-693.014) (-695.022) -- 0:00:39
394500 -- (-692.050) (-695.441) [-696.103] (-692.195) * (-696.398) (-698.665) [-691.871] (-692.388) -- 0:00:39
395000 -- (-693.580) [-697.642] (-695.944) (-693.425) * (-692.668) (-698.098) [-691.932] (-692.351) -- 0:00:39
Average standard deviation of split frequencies: 0.013025
395500 -- (-693.024) (-695.599) [-691.881] (-695.557) * [-691.888] (-695.865) (-698.117) (-692.235) -- 0:00:39
396000 -- (-691.079) [-695.210] (-694.803) (-697.180) * [-692.365] (-696.572) (-695.047) (-695.459) -- 0:00:39
396500 -- (-695.171) [-695.754] (-691.606) (-693.055) * (-690.981) (-694.572) (-696.279) [-692.625] -- 0:00:39
397000 -- (-693.017) [-694.945] (-692.560) (-693.387) * (-692.712) (-695.732) (-693.822) [-693.969] -- 0:00:39
397500 -- (-695.782) (-695.779) [-692.914] (-692.147) * [-692.342] (-695.829) (-697.825) (-695.119) -- 0:00:39
398000 -- [-695.197] (-695.359) (-690.988) (-695.811) * (-693.284) (-694.797) (-693.338) [-693.165] -- 0:00:39
398500 -- (-692.759) (-697.026) (-692.040) [-694.649] * (-694.247) (-691.821) (-692.267) [-692.834] -- 0:00:39
399000 -- (-692.618) (-696.652) [-695.051] (-698.368) * (-692.358) (-691.776) (-697.204) [-691.421] -- 0:00:39
399500 -- (-693.872) [-695.166] (-694.878) (-695.014) * (-692.800) [-692.372] (-693.182) (-694.861) -- 0:00:39
400000 -- (-692.699) (-694.414) [-691.519] (-693.712) * (-691.752) [-693.193] (-693.634) (-693.163) -- 0:00:39
Average standard deviation of split frequencies: 0.012665
400500 -- (-693.084) (-695.930) (-694.666) [-694.050] * (-692.399) [-692.308] (-693.866) (-692.618) -- 0:00:38
401000 -- [-693.573] (-695.201) (-694.653) (-693.780) * (-695.603) [-694.909] (-690.825) (-691.165) -- 0:00:38
401500 -- (-698.669) (-694.809) [-694.404] (-691.689) * (-694.296) (-692.687) (-693.253) [-691.034] -- 0:00:38
402000 -- [-691.449] (-693.644) (-694.727) (-698.236) * (-693.411) [-691.571] (-690.895) (-697.856) -- 0:00:38
402500 -- [-695.056] (-692.543) (-697.769) (-693.104) * (-693.200) [-691.334] (-695.372) (-693.470) -- 0:00:38
403000 -- (-692.042) (-691.713) [-696.548] (-696.330) * (-695.563) [-696.036] (-693.049) (-690.582) -- 0:00:38
403500 -- [-691.736] (-695.795) (-693.748) (-693.992) * (-695.665) (-692.782) (-692.186) [-690.377] -- 0:00:38
404000 -- [-695.578] (-692.516) (-695.251) (-693.640) * (-696.561) (-692.034) [-693.283] (-698.235) -- 0:00:38
404500 -- (-692.403) [-693.130] (-693.077) (-691.751) * (-694.624) [-690.986] (-693.027) (-694.516) -- 0:00:38
405000 -- [-692.696] (-691.272) (-692.749) (-690.857) * (-695.755) (-691.722) [-693.298] (-694.810) -- 0:00:39
Average standard deviation of split frequencies: 0.011816
405500 -- [-691.573] (-692.999) (-692.068) (-693.408) * [-693.298] (-694.961) (-694.240) (-694.658) -- 0:00:39
406000 -- (-696.887) (-693.831) (-694.510) [-694.175] * (-693.077) (-694.525) [-692.924] (-696.585) -- 0:00:39
406500 -- [-691.777] (-692.886) (-692.829) (-693.853) * (-697.051) (-693.952) [-694.564] (-691.605) -- 0:00:39
407000 -- (-694.567) (-694.403) [-694.317] (-699.605) * [-694.005] (-692.371) (-692.834) (-692.015) -- 0:00:39
407500 -- (-693.169) (-700.895) [-692.089] (-694.136) * (-696.435) (-693.188) (-691.900) [-693.560] -- 0:00:39
408000 -- (-693.740) (-693.496) [-691.883] (-692.644) * (-697.456) (-694.371) [-692.686] (-692.948) -- 0:00:39
408500 -- [-694.597] (-694.059) (-692.931) (-692.562) * [-696.716] (-692.974) (-691.455) (-691.744) -- 0:00:39
409000 -- (-694.989) [-693.376] (-694.978) (-692.314) * (-698.741) [-695.509] (-693.659) (-693.365) -- 0:00:39
409500 -- [-698.012] (-690.879) (-693.124) (-693.763) * (-693.982) (-697.291) (-692.912) [-695.474] -- 0:00:38
410000 -- [-694.143] (-692.268) (-692.950) (-695.301) * [-693.404] (-700.644) (-694.842) (-694.188) -- 0:00:38
Average standard deviation of split frequencies: 0.011817
410500 -- [-694.453] (-694.880) (-698.714) (-695.441) * (-699.756) (-692.965) (-696.744) [-692.424] -- 0:00:38
411000 -- (-691.817) [-692.724] (-695.923) (-693.553) * [-696.283] (-696.874) (-694.349) (-697.902) -- 0:00:38
411500 -- (-697.077) (-692.887) [-692.976] (-691.382) * [-696.581] (-696.152) (-691.227) (-694.212) -- 0:00:38
412000 -- (-693.139) (-691.738) [-691.921] (-693.443) * (-693.656) (-691.864) (-692.904) [-691.591] -- 0:00:38
412500 -- (-693.801) [-691.905] (-692.123) (-694.053) * [-695.993] (-694.850) (-691.797) (-692.053) -- 0:00:38
413000 -- (-693.047) [-692.016] (-694.164) (-692.786) * (-696.705) (-692.363) [-691.696] (-693.588) -- 0:00:38
413500 -- (-696.157) (-697.072) [-694.785] (-693.940) * (-698.005) (-694.146) [-691.853] (-696.464) -- 0:00:38
414000 -- (-691.249) [-696.424] (-697.515) (-694.425) * (-693.066) [-695.429] (-689.135) (-694.480) -- 0:00:38
414500 -- [-691.739] (-694.076) (-695.733) (-696.058) * (-696.447) (-699.937) [-690.994] (-699.415) -- 0:00:38
415000 -- [-694.300] (-693.071) (-696.589) (-694.970) * (-697.628) [-691.980] (-693.429) (-691.275) -- 0:00:38
Average standard deviation of split frequencies: 0.011199
415500 -- (-696.978) [-694.752] (-695.844) (-701.756) * (-694.829) (-691.629) [-693.663] (-693.325) -- 0:00:37
416000 -- [-692.110] (-693.547) (-695.726) (-703.520) * (-693.135) (-698.343) (-691.779) [-692.584] -- 0:00:37
416500 -- (-693.585) (-694.326) (-697.388) [-695.895] * (-695.204) [-692.102] (-693.691) (-692.616) -- 0:00:37
417000 -- (-694.940) (-701.200) (-695.234) [-690.965] * (-699.344) (-694.683) [-693.428] (-693.740) -- 0:00:37
417500 -- (-691.994) [-692.772] (-696.281) (-694.849) * (-699.021) [-691.811] (-692.083) (-694.821) -- 0:00:37
418000 -- [-691.327] (-693.289) (-698.558) (-695.873) * (-697.133) (-692.161) [-693.293] (-698.184) -- 0:00:37
418500 -- (-695.160) [-695.076] (-698.940) (-691.845) * (-704.951) [-692.106] (-693.564) (-696.468) -- 0:00:37
419000 -- (-695.109) (-695.534) [-693.922] (-697.925) * (-694.405) (-692.928) [-697.926] (-695.462) -- 0:00:37
419500 -- [-691.092] (-692.913) (-694.834) (-699.489) * (-703.902) [-694.927] (-700.957) (-689.936) -- 0:00:37
420000 -- (-692.544) (-691.280) [-694.635] (-694.179) * (-693.494) (-696.891) [-695.583] (-694.238) -- 0:00:37
Average standard deviation of split frequencies: 0.010349
420500 -- (-691.995) [-691.420] (-697.455) (-693.411) * (-694.197) (-694.202) [-692.058] (-696.570) -- 0:00:38
421000 -- (-694.576) [-691.015] (-698.627) (-692.822) * (-695.244) (-695.659) [-695.770] (-692.121) -- 0:00:38
421500 -- (-700.074) (-691.162) (-692.081) [-696.709] * (-695.695) [-693.095] (-692.176) (-694.118) -- 0:00:38
422000 -- (-695.113) [-690.870] (-695.790) (-698.662) * (-691.327) [-693.105] (-693.114) (-693.131) -- 0:00:38
422500 -- [-694.922] (-694.308) (-691.783) (-691.557) * (-691.265) (-694.050) (-692.193) [-692.846] -- 0:00:38
423000 -- (-693.194) [-695.731] (-696.596) (-691.114) * (-694.255) (-695.735) (-695.443) [-692.391] -- 0:00:38
423500 -- (-693.688) (-693.532) [-693.659] (-694.200) * (-693.823) [-695.730] (-691.821) (-695.061) -- 0:00:38
424000 -- (-696.958) [-692.635] (-695.187) (-696.992) * (-693.155) (-695.686) (-697.777) [-697.516] -- 0:00:38
424500 -- [-691.002] (-694.407) (-699.774) (-697.485) * (-691.926) (-692.551) (-695.234) [-696.853] -- 0:00:37
425000 -- [-691.755] (-693.675) (-693.795) (-694.701) * (-694.422) (-692.561) [-692.349] (-697.031) -- 0:00:37
Average standard deviation of split frequencies: 0.010480
425500 -- (-694.781) (-691.179) [-691.279] (-693.547) * (-696.320) (-694.864) [-693.133] (-693.529) -- 0:00:37
426000 -- (-692.834) (-690.898) (-693.410) [-694.761] * (-695.367) (-694.203) (-695.127) [-692.855] -- 0:00:37
426500 -- (-695.453) (-692.228) (-692.926) [-693.761] * [-692.878] (-694.137) (-692.818) (-694.064) -- 0:00:37
427000 -- (-696.740) (-697.419) [-694.639] (-692.237) * (-693.169) (-696.794) (-695.404) [-692.031] -- 0:00:37
427500 -- [-693.033] (-697.708) (-693.071) (-693.137) * (-694.637) [-693.572] (-696.216) (-696.370) -- 0:00:37
428000 -- (-693.754) (-695.190) (-691.227) [-694.055] * [-695.329] (-695.382) (-697.133) (-697.523) -- 0:00:37
428500 -- (-696.798) (-693.133) (-696.647) [-692.647] * (-692.105) (-695.716) [-691.441] (-698.284) -- 0:00:37
429000 -- [-693.202] (-693.792) (-695.313) (-692.660) * (-694.833) (-695.759) [-692.980] (-692.184) -- 0:00:37
429500 -- (-694.987) (-694.160) [-692.190] (-695.882) * (-694.032) (-694.153) [-693.128] (-694.791) -- 0:00:37
430000 -- (-691.512) (-695.445) (-691.395) [-692.267] * (-693.898) (-696.844) (-694.171) [-692.825] -- 0:00:37
Average standard deviation of split frequencies: 0.010238
430500 -- (-696.782) (-693.450) (-693.108) [-692.008] * [-693.530] (-696.387) (-697.701) (-691.721) -- 0:00:37
431000 -- (-695.875) [-690.702] (-694.799) (-692.525) * (-693.007) (-696.554) (-696.695) [-693.016] -- 0:00:36
431500 -- (-698.002) [-692.930] (-693.848) (-696.392) * (-694.478) (-691.624) [-691.379] (-695.838) -- 0:00:36
432000 -- (-694.132) (-691.818) (-698.595) [-692.617] * [-691.723] (-694.537) (-697.751) (-696.262) -- 0:00:36
432500 -- (-697.672) [-690.974] (-692.896) (-700.397) * (-691.652) [-692.702] (-694.792) (-693.767) -- 0:00:36
433000 -- (-691.357) (-692.517) (-691.183) [-698.945] * [-692.226] (-691.279) (-693.334) (-692.798) -- 0:00:36
433500 -- (-695.312) (-694.078) [-690.433] (-698.049) * (-697.920) (-691.730) (-696.885) [-695.369] -- 0:00:36
434000 -- [-690.833] (-692.546) (-694.663) (-692.864) * (-692.529) [-694.045] (-695.736) (-700.607) -- 0:00:36
434500 -- [-694.118] (-696.953) (-697.605) (-697.319) * (-692.478) [-691.621] (-696.230) (-695.986) -- 0:00:36
435000 -- (-691.254) (-692.031) [-695.497] (-695.173) * (-693.856) [-694.643] (-694.030) (-695.569) -- 0:00:36
Average standard deviation of split frequencies: 0.009985
435500 -- (-696.246) (-692.827) [-691.258] (-695.349) * (-695.633) (-693.250) [-693.332] (-695.515) -- 0:00:36
436000 -- (-697.658) [-691.414] (-693.030) (-697.650) * (-696.915) (-696.686) (-696.660) [-699.165] -- 0:00:37
436500 -- (-692.399) (-691.980) [-691.028] (-708.048) * (-694.076) [-692.915] (-697.764) (-697.955) -- 0:00:37
437000 -- (-694.605) (-695.434) [-693.812] (-695.103) * (-694.804) [-691.837] (-692.304) (-701.002) -- 0:00:37
437500 -- (-693.312) (-696.293) [-692.989] (-698.259) * [-693.838] (-694.555) (-693.965) (-695.872) -- 0:00:37
438000 -- (-695.400) (-691.698) (-695.307) [-695.003] * [-693.045] (-695.920) (-698.069) (-693.270) -- 0:00:37
438500 -- (-691.246) (-691.280) [-693.649] (-696.071) * [-692.543] (-695.524) (-696.603) (-692.599) -- 0:00:37
439000 -- (-693.487) (-691.628) [-694.469] (-695.297) * (-692.511) (-695.780) [-691.919] (-694.489) -- 0:00:37
439500 -- (-694.690) (-692.475) (-694.740) [-693.721] * [-693.778] (-694.052) (-693.211) (-693.679) -- 0:00:36
440000 -- (-694.864) (-691.280) (-690.885) [-695.230] * (-693.556) [-691.926] (-692.329) (-696.104) -- 0:00:36
Average standard deviation of split frequencies: 0.010131
440500 -- (-694.759) (-692.997) (-692.973) [-692.444] * (-694.277) [-692.101] (-693.502) (-693.302) -- 0:00:36
441000 -- (-695.028) [-691.153] (-698.906) (-696.546) * (-692.988) (-692.613) [-691.799] (-693.894) -- 0:00:36
441500 -- (-693.462) (-694.601) [-693.995] (-694.708) * [-692.147] (-693.937) (-690.390) (-692.289) -- 0:00:36
442000 -- (-695.139) (-694.047) [-694.612] (-695.660) * [-692.019] (-697.891) (-692.431) (-694.483) -- 0:00:36
442500 -- (-695.535) (-694.334) (-696.317) [-695.168] * (-693.269) [-693.990] (-691.701) (-694.643) -- 0:00:36
443000 -- (-696.946) [-694.166] (-692.915) (-691.399) * (-690.107) (-694.610) [-689.943] (-694.927) -- 0:00:36
443500 -- (-695.217) (-691.993) [-692.040] (-694.864) * (-695.609) (-693.227) (-695.018) [-693.905] -- 0:00:36
444000 -- (-697.655) (-693.568) [-693.016] (-698.711) * (-695.585) (-695.977) [-697.591] (-691.415) -- 0:00:36
444500 -- (-699.589) [-690.791] (-694.656) (-696.784) * (-690.138) (-693.757) (-691.928) [-691.769] -- 0:00:36
445000 -- [-696.162] (-694.880) (-696.380) (-698.668) * (-690.259) (-694.894) (-692.224) [-693.271] -- 0:00:36
Average standard deviation of split frequencies: 0.009824
445500 -- [-695.890] (-695.684) (-693.609) (-695.973) * (-694.892) (-695.572) [-692.567] (-691.828) -- 0:00:36
446000 -- (-695.709) (-694.433) (-692.088) [-694.661] * (-696.245) (-694.127) [-692.186] (-693.208) -- 0:00:36
446500 -- (-693.978) (-695.331) (-697.735) [-691.855] * (-696.778) (-693.072) (-697.127) [-692.894] -- 0:00:35
447000 -- (-693.658) (-692.955) [-698.174] (-692.859) * (-700.404) (-695.258) [-692.822] (-693.450) -- 0:00:35
447500 -- [-695.232] (-692.941) (-691.201) (-696.291) * (-691.614) (-694.882) (-695.727) [-692.125] -- 0:00:35
448000 -- (-693.694) (-697.426) (-693.504) [-693.742] * (-691.020) [-696.659] (-692.794) (-694.773) -- 0:00:35
448500 -- (-692.704) (-693.727) (-697.838) [-694.701] * (-691.459) (-697.725) (-692.531) [-692.171] -- 0:00:35
449000 -- (-695.594) (-691.818) (-700.177) [-692.556] * [-694.673] (-692.241) (-692.557) (-694.286) -- 0:00:35
449500 -- (-696.919) (-691.058) [-697.225] (-695.349) * (-694.907) (-691.213) [-695.231] (-695.638) -- 0:00:35
450000 -- (-696.270) (-697.196) (-697.493) [-695.918] * (-692.892) (-695.498) (-693.365) [-698.005] -- 0:00:35
Average standard deviation of split frequencies: 0.009783
450500 -- (-693.988) [-695.875] (-692.718) (-695.807) * (-691.268) (-691.277) (-692.392) [-694.654] -- 0:00:35
451000 -- (-695.856) (-692.274) [-692.117] (-696.134) * (-693.026) [-691.846] (-694.169) (-695.721) -- 0:00:35
451500 -- (-695.223) [-692.817] (-693.367) (-696.300) * (-691.782) (-696.048) (-693.725) [-696.136] -- 0:00:36
452000 -- [-692.668] (-693.259) (-693.286) (-695.889) * (-693.313) (-696.776) (-695.139) [-695.290] -- 0:00:36
452500 -- (-700.216) (-694.130) [-695.211] (-696.900) * (-692.410) (-699.069) [-691.297] (-697.401) -- 0:00:36
453000 -- (-691.676) (-695.857) (-697.018) [-692.283] * [-693.420] (-697.830) (-694.027) (-697.929) -- 0:00:36
453500 -- (-693.553) (-694.834) (-695.489) [-693.469] * (-693.559) (-697.125) [-692.575] (-695.438) -- 0:00:36
454000 -- (-693.742) [-696.241] (-694.429) (-695.389) * (-697.179) (-692.564) (-691.081) [-694.033] -- 0:00:36
454500 -- (-693.380) [-692.365] (-697.494) (-693.590) * (-691.968) [-694.700] (-696.578) (-692.322) -- 0:00:36
455000 -- [-692.042] (-695.576) (-693.409) (-692.108) * (-689.691) [-693.409] (-695.108) (-695.361) -- 0:00:35
Average standard deviation of split frequencies: 0.009547
455500 -- (-692.176) (-693.924) [-691.504] (-693.601) * (-695.517) [-691.448] (-693.226) (-696.072) -- 0:00:35
456000 -- (-691.337) [-694.604] (-702.532) (-695.011) * [-695.220] (-694.540) (-692.679) (-695.415) -- 0:00:35
456500 -- [-694.786] (-691.982) (-693.708) (-694.143) * [-691.389] (-694.832) (-693.354) (-694.902) -- 0:00:35
457000 -- (-694.335) (-694.682) (-692.596) [-691.777] * [-693.103] (-696.597) (-697.619) (-695.491) -- 0:00:35
457500 -- (-694.329) (-693.350) [-691.254] (-697.028) * [-691.206] (-693.873) (-693.462) (-696.104) -- 0:00:35
458000 -- (-694.678) [-692.837] (-691.120) (-691.793) * (-696.495) (-693.678) [-690.792] (-695.714) -- 0:00:35
458500 -- (-695.566) (-693.683) (-695.470) [-692.898] * (-696.313) (-694.767) (-694.557) [-697.403] -- 0:00:35
459000 -- (-692.470) [-693.321] (-693.337) (-694.212) * (-695.354) (-694.971) [-689.495] (-701.285) -- 0:00:35
459500 -- [-692.646] (-696.227) (-693.852) (-692.927) * (-692.611) (-694.586) [-697.361] (-695.034) -- 0:00:35
460000 -- (-694.545) (-695.172) (-691.942) [-693.573] * (-698.255) (-694.189) (-697.187) [-694.779] -- 0:00:35
Average standard deviation of split frequencies: 0.009571
460500 -- [-694.077] (-695.093) (-692.541) (-692.732) * (-692.441) [-693.467] (-696.944) (-695.488) -- 0:00:35
461000 -- (-692.687) (-692.251) [-691.589] (-694.084) * [-692.607] (-699.298) (-693.020) (-693.248) -- 0:00:35
461500 -- (-696.569) (-691.293) (-691.259) [-689.684] * (-696.542) (-692.646) [-692.363] (-692.329) -- 0:00:35
462000 -- (-696.496) (-696.294) [-692.131] (-691.598) * [-691.438] (-693.693) (-693.805) (-694.933) -- 0:00:34
462500 -- (-692.037) (-697.630) (-692.700) [-690.960] * [-698.479] (-696.726) (-696.223) (-694.744) -- 0:00:34
463000 -- (-691.362) [-693.014] (-695.233) (-691.799) * (-692.827) (-691.321) (-694.737) [-693.326] -- 0:00:34
463500 -- (-695.422) [-695.876] (-693.886) (-691.480) * (-694.196) [-691.667] (-698.511) (-694.816) -- 0:00:34
464000 -- (-696.215) [-693.056] (-694.911) (-694.828) * [-694.175] (-692.297) (-694.220) (-695.684) -- 0:00:34
464500 -- (-693.476) (-695.899) (-697.326) [-690.352] * (-695.391) [-693.061] (-692.001) (-692.584) -- 0:00:34
465000 -- (-693.754) [-693.822] (-698.871) (-696.132) * (-696.271) (-695.233) (-691.988) [-694.829] -- 0:00:34
Average standard deviation of split frequencies: 0.010116
465500 -- (-693.842) (-695.806) [-690.629] (-693.152) * (-692.708) [-695.850] (-697.633) (-694.825) -- 0:00:34
466000 -- (-696.177) (-693.153) (-693.088) [-693.061] * (-692.113) (-694.292) [-694.952] (-695.353) -- 0:00:34
466500 -- (-694.628) (-690.598) (-691.317) [-693.438] * (-694.298) (-692.031) (-694.008) [-692.172] -- 0:00:34
467000 -- (-695.909) (-693.031) [-689.836] (-694.228) * (-695.466) [-691.991] (-696.573) (-695.581) -- 0:00:35
467500 -- (-692.049) [-693.249] (-692.268) (-692.087) * [-695.747] (-692.060) (-694.207) (-695.712) -- 0:00:35
468000 -- (-692.310) (-692.642) [-692.373] (-695.699) * (-692.559) (-696.109) [-696.440] (-694.747) -- 0:00:35
468500 -- [-696.664] (-694.091) (-691.938) (-693.104) * (-692.609) (-694.504) (-695.864) [-696.248] -- 0:00:35
469000 -- (-694.323) [-694.715] (-691.007) (-693.878) * (-694.514) (-695.058) (-699.125) [-693.836] -- 0:00:35
469500 -- (-693.559) (-695.257) (-693.209) [-693.326] * [-694.300] (-697.218) (-692.604) (-699.295) -- 0:00:35
470000 -- (-693.632) (-692.556) [-692.249] (-692.657) * (-697.257) (-693.620) [-693.312] (-697.912) -- 0:00:34
Average standard deviation of split frequencies: 0.010310
470500 -- (-692.913) [-694.676] (-693.364) (-696.383) * (-692.408) (-692.313) [-693.669] (-693.503) -- 0:00:34
471000 -- (-696.549) (-693.879) [-690.832] (-692.292) * (-692.797) (-694.521) (-693.777) [-692.055] -- 0:00:34
471500 -- [-699.761] (-692.210) (-693.045) (-696.595) * (-695.043) (-693.102) [-691.447] (-696.015) -- 0:00:34
472000 -- (-693.671) (-693.018) (-692.963) [-692.584] * (-697.423) (-695.463) (-696.307) [-693.090] -- 0:00:34
472500 -- (-694.754) (-693.965) [-692.405] (-691.602) * (-692.483) (-696.858) [-693.608] (-695.429) -- 0:00:34
473000 -- [-692.910] (-694.804) (-694.204) (-691.801) * [-692.707] (-694.710) (-695.309) (-693.930) -- 0:00:34
473500 -- [-693.360] (-694.832) (-693.471) (-690.501) * (-693.306) (-696.232) (-695.352) [-693.065] -- 0:00:34
474000 -- (-691.917) (-695.201) (-692.913) [-695.351] * (-696.901) (-692.858) [-691.851] (-691.202) -- 0:00:34
474500 -- (-693.615) [-691.810] (-695.434) (-697.032) * [-691.904] (-698.506) (-693.586) (-692.860) -- 0:00:34
475000 -- (-695.992) [-693.203] (-694.332) (-696.224) * (-692.591) (-695.014) (-694.906) [-693.146] -- 0:00:34
Average standard deviation of split frequencies: 0.011010
475500 -- (-694.801) [-693.538] (-691.204) (-694.447) * (-692.863) (-693.117) [-691.996] (-691.348) -- 0:00:34
476000 -- (-697.577) (-692.237) [-695.146] (-695.036) * (-693.670) (-697.871) (-697.076) [-691.178] -- 0:00:34
476500 -- (-695.378) (-697.154) (-695.889) [-691.443] * (-692.574) (-697.954) (-695.551) [-692.654] -- 0:00:34
477000 -- (-694.241) [-692.878] (-693.475) (-693.179) * (-691.112) (-695.611) (-696.228) [-696.256] -- 0:00:33
477500 -- (-695.742) [-693.862] (-690.992) (-692.383) * (-695.286) (-694.044) [-692.667] (-694.014) -- 0:00:33
478000 -- (-693.074) (-696.799) (-693.078) [-691.080] * (-692.611) [-697.987] (-695.233) (-692.708) -- 0:00:33
478500 -- (-694.730) (-696.915) (-692.406) [-691.469] * (-691.516) [-695.641] (-690.049) (-691.467) -- 0:00:33
479000 -- (-697.128) (-700.307) (-700.429) [-690.941] * (-694.483) [-692.509] (-692.491) (-691.442) -- 0:00:33
479500 -- (-695.940) [-691.898] (-695.174) (-691.370) * (-692.157) (-694.643) (-692.929) [-692.018] -- 0:00:33
480000 -- (-696.154) (-695.481) [-699.263] (-693.113) * [-695.625] (-692.548) (-695.814) (-693.913) -- 0:00:33
Average standard deviation of split frequencies: 0.010673
480500 -- (-695.638) (-693.919) [-693.252] (-696.286) * [-693.768] (-692.981) (-693.870) (-693.278) -- 0:00:33
481000 -- [-693.430] (-702.017) (-699.015) (-692.118) * (-692.022) (-695.149) (-693.433) [-692.753] -- 0:00:33
481500 -- (-693.134) (-693.265) [-693.592] (-696.168) * (-698.621) (-695.009) (-694.126) [-694.874] -- 0:00:33
482000 -- [-693.641] (-692.919) (-694.754) (-695.227) * (-694.912) (-691.620) (-691.834) [-693.304] -- 0:00:33
482500 -- (-694.620) [-695.036] (-694.712) (-696.753) * (-692.422) (-696.596) [-694.627] (-694.540) -- 0:00:34
483000 -- (-693.085) [-693.431] (-695.307) (-692.085) * (-693.289) (-694.355) [-694.397] (-690.163) -- 0:00:34
483500 -- (-698.273) [-693.796] (-693.910) (-693.358) * (-694.565) [-702.114] (-694.590) (-694.202) -- 0:00:34
484000 -- (-697.897) (-695.744) [-695.743] (-694.270) * [-692.282] (-692.954) (-695.410) (-693.216) -- 0:00:34
484500 -- (-694.833) (-694.486) (-690.674) [-692.491] * (-693.164) [-694.985] (-692.028) (-693.314) -- 0:00:34
485000 -- (-692.214) (-693.936) [-690.635] (-691.601) * (-697.018) [-693.973] (-693.342) (-694.902) -- 0:00:33
Average standard deviation of split frequencies: 0.010898
485500 -- [-694.227] (-694.219) (-695.544) (-693.430) * (-692.749) (-692.120) (-693.834) [-693.493] -- 0:00:33
486000 -- (-694.913) [-693.231] (-693.631) (-694.697) * [-692.522] (-698.302) (-695.078) (-693.227) -- 0:00:33
486500 -- (-696.270) (-692.648) (-697.930) [-692.919] * (-692.193) (-693.063) [-692.499] (-691.961) -- 0:00:33
487000 -- [-692.632] (-697.799) (-690.835) (-694.598) * (-690.318) [-692.752] (-695.005) (-693.416) -- 0:00:33
487500 -- (-692.033) (-694.474) [-690.609] (-691.817) * (-693.365) (-694.951) [-693.907] (-691.913) -- 0:00:33
488000 -- (-696.594) [-692.577] (-693.282) (-690.757) * [-691.288] (-691.188) (-691.710) (-696.146) -- 0:00:33
488500 -- [-695.612] (-693.416) (-693.052) (-695.496) * (-692.034) [-693.956] (-691.597) (-693.578) -- 0:00:33
489000 -- [-695.549] (-695.109) (-697.474) (-696.096) * [-691.531] (-699.172) (-691.440) (-694.156) -- 0:00:33
489500 -- (-693.891) [-692.401] (-697.219) (-700.736) * (-694.384) (-692.987) [-692.378] (-695.723) -- 0:00:33
490000 -- (-696.842) (-693.722) [-693.520] (-694.561) * [-695.818] (-694.469) (-694.162) (-696.512) -- 0:00:33
Average standard deviation of split frequencies: 0.010286
490500 -- (-697.702) (-692.785) [-694.113] (-691.784) * [-696.288] (-693.422) (-694.260) (-695.761) -- 0:00:33
491000 -- (-694.233) (-693.259) (-690.542) [-693.495] * (-697.085) (-692.144) [-696.304] (-696.494) -- 0:00:33
491500 -- (-697.097) (-692.758) [-692.346] (-693.558) * (-698.596) (-695.532) [-692.740] (-698.589) -- 0:00:33
492000 -- (-694.655) (-692.224) (-698.007) [-696.338] * (-696.758) [-692.864] (-693.690) (-695.787) -- 0:00:33
492500 -- (-693.208) [-692.521] (-694.809) (-692.476) * [-690.965] (-694.710) (-694.624) (-692.965) -- 0:00:32
493000 -- [-695.926] (-692.601) (-691.212) (-693.801) * (-692.402) (-693.458) (-695.175) [-692.812] -- 0:00:32
493500 -- (-695.854) (-694.783) (-693.281) [-692.912] * (-692.810) (-698.296) [-693.567] (-694.903) -- 0:00:32
494000 -- (-695.802) (-694.770) (-693.717) [-694.170] * (-693.518) [-691.806] (-693.473) (-693.296) -- 0:00:32
494500 -- (-696.628) (-693.897) (-693.711) [-690.526] * [-693.110] (-692.507) (-693.204) (-693.648) -- 0:00:32
495000 -- [-695.748] (-692.718) (-694.574) (-696.131) * (-692.072) (-698.804) (-698.303) [-690.798] -- 0:00:32
Average standard deviation of split frequencies: 0.010510
495500 -- (-693.610) [-695.382] (-692.725) (-692.570) * (-692.465) (-691.129) [-692.567] (-695.230) -- 0:00:32
496000 -- (-692.491) (-693.482) (-691.861) [-690.885] * (-697.717) [-693.731] (-691.551) (-694.006) -- 0:00:32
496500 -- (-693.716) (-696.852) [-694.223] (-690.447) * (-696.605) (-693.846) (-692.385) [-695.065] -- 0:00:32
497000 -- [-695.303] (-698.616) (-695.452) (-691.421) * (-692.236) [-690.449] (-694.590) (-695.520) -- 0:00:32
497500 -- (-695.002) (-693.495) (-693.153) [-691.737] * (-694.663) (-694.701) (-696.126) [-692.439] -- 0:00:32
498000 -- (-691.976) [-692.744] (-693.860) (-695.826) * (-696.075) (-696.463) (-691.660) [-692.163] -- 0:00:33
498500 -- (-690.742) (-693.509) (-694.636) [-691.671] * (-694.359) (-693.214) [-692.823] (-694.856) -- 0:00:33
499000 -- [-690.920] (-691.764) (-690.944) (-696.220) * [-693.156] (-694.236) (-692.477) (-695.636) -- 0:00:33
499500 -- [-694.997] (-690.892) (-693.300) (-691.621) * (-694.160) (-697.238) (-693.312) [-693.563] -- 0:00:33
500000 -- (-693.413) (-691.211) (-693.509) [-694.146] * (-696.833) (-696.700) (-693.027) [-693.074] -- 0:00:33
Average standard deviation of split frequencies: 0.010856
500500 -- (-694.999) [-697.535] (-692.469) (-693.856) * (-693.637) (-691.761) (-690.991) [-692.615] -- 0:00:32
501000 -- (-690.370) (-692.214) (-695.689) [-695.482] * (-693.536) (-696.704) (-694.818) [-693.721] -- 0:00:32
501500 -- (-694.161) (-692.616) (-693.255) [-693.128] * [-698.741] (-694.053) (-695.583) (-692.210) -- 0:00:32
502000 -- [-692.972] (-692.470) (-694.516) (-693.071) * (-697.636) [-693.732] (-693.708) (-691.572) -- 0:00:32
502500 -- (-692.992) (-696.485) (-691.209) [-691.780] * [-696.777] (-692.528) (-694.906) (-696.718) -- 0:00:32
503000 -- (-694.375) (-694.690) (-694.855) [-694.334] * (-692.418) (-696.593) [-690.539] (-693.428) -- 0:00:32
503500 -- (-691.697) (-695.575) (-691.356) [-690.711] * (-694.832) (-692.325) (-690.415) [-692.720] -- 0:00:32
504000 -- (-693.484) [-693.592] (-691.624) (-691.621) * (-693.207) [-693.531] (-692.353) (-692.360) -- 0:00:32
504500 -- [-693.174] (-692.165) (-691.332) (-690.277) * (-692.879) (-697.518) [-692.428] (-692.203) -- 0:00:32
505000 -- [-694.995] (-694.091) (-690.834) (-696.245) * (-695.393) [-692.182] (-695.000) (-693.427) -- 0:00:32
Average standard deviation of split frequencies: 0.011344
505500 -- (-694.552) (-699.115) [-692.520] (-692.478) * (-694.025) (-691.223) (-692.312) [-697.949] -- 0:00:32
506000 -- (-693.237) [-693.136] (-694.179) (-691.205) * (-694.275) (-692.546) [-691.792] (-692.006) -- 0:00:32
506500 -- [-691.397] (-692.399) (-690.041) (-691.478) * (-692.640) [-692.668] (-693.925) (-692.605) -- 0:00:32
507000 -- (-696.193) (-692.519) (-690.760) [-691.718] * (-694.276) (-690.662) (-693.088) [-697.002] -- 0:00:32
507500 -- (-694.963) (-695.008) [-694.395] (-691.283) * [-693.696] (-695.357) (-693.832) (-695.789) -- 0:00:32
508000 -- (-694.175) (-692.843) (-701.508) [-693.718] * [-695.916] (-692.173) (-697.561) (-696.601) -- 0:00:31
508500 -- [-694.065] (-698.537) (-693.573) (-692.615) * (-695.163) (-694.383) [-695.182] (-702.157) -- 0:00:31
509000 -- [-694.066] (-695.174) (-695.372) (-693.795) * (-694.555) [-689.723] (-692.758) (-695.483) -- 0:00:31
509500 -- (-692.680) [-694.468] (-695.994) (-692.683) * (-696.414) [-690.792] (-695.456) (-693.371) -- 0:00:31
510000 -- (-693.261) (-694.080) [-696.404] (-694.186) * (-696.061) [-692.197] (-691.628) (-694.046) -- 0:00:31
Average standard deviation of split frequencies: 0.011512
510500 -- (-694.973) (-693.838) [-692.408] (-691.196) * (-696.245) [-690.806] (-695.150) (-693.005) -- 0:00:31
511000 -- [-693.816] (-694.626) (-693.036) (-696.755) * (-694.864) (-696.644) (-694.788) [-694.812] -- 0:00:31
511500 -- [-692.817] (-697.634) (-696.302) (-694.926) * [-692.727] (-697.395) (-695.727) (-698.302) -- 0:00:31
512000 -- (-695.879) (-696.068) [-689.906] (-695.683) * [-691.553] (-698.342) (-698.224) (-693.177) -- 0:00:31
512500 -- (-693.466) [-694.667] (-691.832) (-693.389) * (-695.717) [-695.414] (-696.978) (-697.620) -- 0:00:31
513000 -- (-693.791) (-693.742) (-692.530) [-691.276] * (-697.596) (-691.874) (-691.130) [-694.037] -- 0:00:31
513500 -- [-693.148] (-691.018) (-694.210) (-692.025) * (-695.759) (-693.427) [-692.088] (-690.324) -- 0:00:32
514000 -- (-699.085) (-691.124) (-696.961) [-691.236] * (-691.323) (-695.599) (-696.690) [-691.977] -- 0:00:32
514500 -- (-697.003) (-691.653) (-697.400) [-693.659] * [-693.687] (-698.005) (-694.539) (-696.844) -- 0:00:32
515000 -- (-695.000) (-693.669) (-695.356) [-692.493] * [-693.871] (-691.970) (-693.061) (-694.456) -- 0:00:32
Average standard deviation of split frequencies: 0.011876
515500 -- (-692.403) [-692.048] (-694.409) (-692.431) * (-692.872) (-691.426) [-693.062] (-693.937) -- 0:00:31
516000 -- (-694.351) (-693.497) [-690.309] (-694.957) * [-692.378] (-690.872) (-689.871) (-700.513) -- 0:00:31
516500 -- (-695.449) (-695.521) [-693.516] (-693.330) * [-692.498] (-691.828) (-694.980) (-693.015) -- 0:00:31
517000 -- (-695.088) (-692.652) [-692.310] (-693.307) * (-693.557) [-691.071] (-691.754) (-692.603) -- 0:00:31
517500 -- [-694.467] (-692.490) (-691.603) (-691.713) * (-694.011) (-692.310) (-693.114) [-692.414] -- 0:00:31
518000 -- [-690.619] (-694.515) (-692.487) (-696.631) * [-693.825] (-693.301) (-692.479) (-692.181) -- 0:00:31
518500 -- (-692.028) (-695.717) [-696.733] (-696.353) * (-691.247) (-695.177) [-693.129] (-698.249) -- 0:00:31
519000 -- [-692.078] (-695.619) (-692.528) (-694.245) * (-693.434) (-693.282) [-695.624] (-692.923) -- 0:00:31
519500 -- (-693.276) (-692.098) (-696.152) [-692.005] * (-694.136) [-693.606] (-691.150) (-694.982) -- 0:00:31
520000 -- [-690.425] (-696.696) (-691.203) (-703.386) * (-694.937) [-697.307] (-695.012) (-691.366) -- 0:00:31
Average standard deviation of split frequencies: 0.012356
520500 -- (-692.230) (-693.331) [-692.448] (-695.568) * [-692.979] (-693.248) (-694.270) (-694.142) -- 0:00:31
521000 -- (-692.662) (-693.402) (-694.422) [-692.988] * (-695.387) (-692.348) (-701.116) [-691.762] -- 0:00:31
521500 -- (-692.577) (-693.973) (-692.952) [-694.055] * (-694.105) (-694.423) (-695.390) [-694.090] -- 0:00:31
522000 -- (-692.455) (-700.557) [-692.449] (-693.800) * (-692.098) (-696.303) (-693.861) [-691.081] -- 0:00:31
522500 -- (-694.342) [-693.124] (-692.762) (-696.957) * (-693.568) (-693.285) [-695.331] (-694.352) -- 0:00:31
523000 -- (-692.873) (-695.027) [-692.615] (-695.736) * [-692.952] (-694.561) (-692.232) (-693.728) -- 0:00:31
523500 -- (-693.359) (-696.389) (-696.002) [-694.683] * (-693.771) (-696.434) (-692.984) [-692.412] -- 0:00:30
524000 -- (-690.251) [-693.678] (-697.252) (-695.858) * (-692.849) (-696.227) (-695.333) [-690.595] -- 0:00:30
524500 -- (-695.119) (-695.923) (-693.704) [-693.268] * (-693.602) (-694.262) (-693.637) [-695.116] -- 0:00:30
525000 -- (-690.440) (-697.534) [-691.974] (-694.089) * (-692.821) [-694.807] (-694.240) (-691.846) -- 0:00:30
Average standard deviation of split frequencies: 0.012231
525500 -- [-689.521] (-694.844) (-693.062) (-695.068) * (-694.583) [-693.958] (-692.366) (-694.834) -- 0:00:30
526000 -- (-691.047) (-694.954) [-692.164] (-693.662) * (-693.378) [-692.502] (-693.535) (-692.436) -- 0:00:30
526500 -- [-690.978] (-693.065) (-691.736) (-695.084) * (-695.007) (-698.808) (-693.202) [-691.602] -- 0:00:30
527000 -- (-691.219) (-695.435) [-692.568] (-693.176) * (-693.834) [-693.734] (-695.031) (-693.950) -- 0:00:30
527500 -- (-690.743) [-691.240] (-692.241) (-695.450) * (-700.258) (-692.086) [-694.542] (-692.564) -- 0:00:30
528000 -- [-693.270] (-693.811) (-694.478) (-692.643) * [-695.433] (-693.646) (-692.625) (-694.375) -- 0:00:30
528500 -- [-691.569] (-691.808) (-695.817) (-691.187) * (-694.484) (-692.470) [-693.253] (-695.063) -- 0:00:30
529000 -- (-691.988) [-695.873] (-695.204) (-692.673) * [-695.850] (-694.697) (-690.656) (-693.623) -- 0:00:31
529500 -- [-693.560] (-695.679) (-692.358) (-695.432) * (-695.376) (-698.657) (-695.704) [-693.847] -- 0:00:31
530000 -- (-695.071) [-691.535] (-692.518) (-692.625) * (-695.435) [-692.475] (-694.331) (-696.071) -- 0:00:31
Average standard deviation of split frequencies: 0.011862
530500 -- (-692.174) (-692.192) [-693.772] (-694.979) * (-697.354) (-692.598) [-695.084] (-691.528) -- 0:00:30
531000 -- (-692.413) [-690.991] (-694.075) (-693.567) * [-695.002] (-694.504) (-694.583) (-694.985) -- 0:00:30
531500 -- (-692.533) (-692.712) (-692.265) [-693.812] * (-692.651) (-693.804) (-693.301) [-691.246] -- 0:00:30
532000 -- (-694.719) (-691.163) [-692.317] (-693.035) * (-693.237) (-694.112) (-696.610) [-693.786] -- 0:00:30
532500 -- (-692.555) (-692.352) [-690.952] (-698.684) * [-694.020] (-692.655) (-694.328) (-691.945) -- 0:00:30
533000 -- (-693.805) (-697.046) (-691.647) [-694.916] * [-691.700] (-694.287) (-694.752) (-692.786) -- 0:00:30
533500 -- [-693.887] (-692.909) (-692.406) (-691.497) * (-692.481) (-691.392) (-691.878) [-692.108] -- 0:00:30
534000 -- [-692.129] (-693.245) (-693.855) (-697.201) * (-693.136) (-694.713) (-695.766) [-694.884] -- 0:00:30
534500 -- [-693.161] (-692.890) (-695.552) (-692.506) * (-693.834) [-695.205] (-694.935) (-691.282) -- 0:00:30
535000 -- (-693.422) [-691.457] (-692.143) (-696.892) * (-692.203) (-693.740) (-695.170) [-691.499] -- 0:00:30
Average standard deviation of split frequencies: 0.011744
535500 -- (-697.521) (-694.260) [-694.871] (-693.732) * (-691.632) (-694.343) [-694.852] (-691.955) -- 0:00:30
536000 -- (-693.060) [-693.193] (-693.750) (-696.184) * (-691.952) (-692.588) (-695.692) [-695.906] -- 0:00:30
536500 -- (-695.880) [-693.928] (-698.712) (-692.491) * (-691.752) (-692.152) [-691.049] (-693.568) -- 0:00:30
537000 -- (-695.811) (-696.928) (-692.570) [-692.414] * [-691.437] (-692.491) (-691.020) (-694.446) -- 0:00:30
537500 -- (-693.712) [-690.959] (-694.307) (-695.174) * [-692.971] (-695.555) (-693.825) (-695.123) -- 0:00:30
538000 -- [-692.461] (-692.948) (-695.505) (-693.431) * [-692.711] (-692.885) (-695.875) (-692.374) -- 0:00:30
538500 -- [-692.792] (-692.118) (-695.063) (-694.020) * (-696.950) [-690.746] (-692.703) (-693.865) -- 0:00:29
539000 -- (-691.166) [-693.886] (-695.506) (-693.057) * [-694.113] (-694.109) (-692.038) (-696.577) -- 0:00:29
539500 -- [-695.831] (-697.322) (-692.918) (-693.306) * (-692.152) [-692.079] (-693.541) (-694.192) -- 0:00:29
540000 -- (-698.132) (-697.828) (-693.247) [-691.168] * (-693.176) (-695.652) [-692.885] (-695.968) -- 0:00:29
Average standard deviation of split frequencies: 0.011796
540500 -- [-696.200] (-694.749) (-692.206) (-694.372) * (-693.574) [-692.296] (-699.158) (-691.188) -- 0:00:29
541000 -- (-697.809) [-693.930] (-694.926) (-695.317) * (-694.207) (-692.454) [-690.626] (-695.187) -- 0:00:29
541500 -- (-696.397) (-691.312) (-698.563) [-691.974] * (-696.851) [-692.230] (-693.588) (-692.885) -- 0:00:29
542000 -- [-693.775] (-692.318) (-700.766) (-698.177) * [-691.383] (-695.014) (-696.183) (-691.474) -- 0:00:29
542500 -- (-695.074) (-694.198) (-697.757) [-692.431] * (-692.207) [-693.312] (-695.675) (-693.236) -- 0:00:29
543000 -- (-694.968) (-693.549) [-697.436] (-694.230) * [-698.138] (-696.653) (-695.744) (-694.838) -- 0:00:29
543500 -- (-692.117) (-693.535) (-694.307) [-692.786] * (-693.353) [-693.498] (-700.822) (-692.191) -- 0:00:29
544000 -- (-693.111) (-696.081) [-693.750] (-692.008) * (-691.912) [-693.064] (-693.753) (-692.424) -- 0:00:30
544500 -- [-692.875] (-697.043) (-695.933) (-697.429) * (-695.053) (-694.087) [-690.896] (-694.026) -- 0:00:30
545000 -- [-694.533] (-694.679) (-693.723) (-693.937) * (-693.152) (-692.497) [-693.660] (-694.141) -- 0:00:30
Average standard deviation of split frequencies: 0.012240
545500 -- (-693.842) (-692.548) [-692.362] (-693.225) * (-691.671) (-691.365) [-693.148] (-692.554) -- 0:00:29
546000 -- [-692.815] (-697.244) (-695.703) (-694.216) * (-692.696) (-692.153) (-696.138) [-693.571] -- 0:00:29
546500 -- (-701.889) [-691.541] (-692.885) (-694.666) * (-690.654) (-690.492) [-691.923] (-691.371) -- 0:00:29
547000 -- (-693.661) (-694.515) [-695.704] (-694.532) * (-691.719) (-691.624) [-697.414] (-692.785) -- 0:00:29
547500 -- (-692.009) (-693.595) (-694.593) [-690.884] * (-693.984) [-693.639] (-701.441) (-691.274) -- 0:00:29
548000 -- [-694.068] (-694.448) (-702.320) (-691.244) * [-694.558] (-693.567) (-692.137) (-694.698) -- 0:00:29
548500 -- [-694.931] (-697.660) (-704.424) (-697.241) * [-693.629] (-694.221) (-693.875) (-693.459) -- 0:00:29
549000 -- (-696.801) (-697.773) (-696.793) [-692.143] * [-693.814] (-697.234) (-690.256) (-691.964) -- 0:00:29
549500 -- [-698.130] (-698.071) (-698.061) (-694.624) * (-696.414) (-697.684) [-693.052] (-697.183) -- 0:00:29
550000 -- (-693.126) (-692.046) [-693.615] (-695.219) * (-697.060) (-695.807) (-690.703) [-693.721] -- 0:00:29
Average standard deviation of split frequencies: 0.012237
550500 -- [-696.122] (-695.042) (-696.244) (-694.985) * [-693.628] (-694.318) (-696.653) (-696.768) -- 0:00:29
551000 -- (-692.586) [-696.365] (-693.132) (-692.619) * (-694.656) [-692.753] (-695.256) (-693.805) -- 0:00:29
551500 -- (-694.557) (-692.093) (-694.835) [-691.716] * (-696.632) [-694.242] (-696.328) (-691.641) -- 0:00:29
552000 -- (-693.692) (-695.344) (-698.078) [-692.482] * [-692.854] (-694.432) (-693.309) (-694.787) -- 0:00:29
552500 -- (-692.423) [-694.563] (-697.650) (-692.066) * (-694.619) [-693.916] (-693.715) (-694.820) -- 0:00:29
553000 -- (-692.360) [-692.041] (-695.071) (-691.898) * (-695.102) [-693.401] (-694.006) (-694.790) -- 0:00:29
553500 -- (-691.700) [-696.168] (-696.741) (-694.694) * (-695.798) [-697.120] (-693.091) (-693.135) -- 0:00:29
554000 -- (-694.231) (-690.101) (-695.069) [-692.552] * [-692.259] (-693.976) (-694.881) (-692.309) -- 0:00:28
554500 -- (-693.773) [-692.373] (-695.494) (-694.433) * (-693.668) (-696.168) [-692.711] (-695.697) -- 0:00:28
555000 -- [-692.473] (-694.687) (-694.643) (-693.801) * (-691.739) [-693.922] (-693.400) (-693.333) -- 0:00:28
Average standard deviation of split frequencies: 0.011371
555500 -- (-695.724) [-690.854] (-699.821) (-696.035) * (-694.002) (-694.826) [-692.433] (-694.667) -- 0:00:28
556000 -- (-694.456) [-694.158] (-692.087) (-692.460) * (-693.371) (-693.713) (-691.321) [-691.754] -- 0:00:28
556500 -- (-693.572) [-695.084] (-696.531) (-696.202) * [-695.750] (-694.843) (-692.390) (-695.645) -- 0:00:28
557000 -- (-693.667) [-693.788] (-691.641) (-692.286) * (-695.147) (-694.185) [-691.110] (-691.934) -- 0:00:28
557500 -- (-695.192) [-693.396] (-695.378) (-690.544) * (-693.623) (-699.814) (-695.251) [-693.361] -- 0:00:28
558000 -- (-695.495) (-692.075) [-695.139] (-694.006) * (-692.328) (-696.639) [-691.096] (-693.018) -- 0:00:28
558500 -- (-694.097) (-692.798) (-696.777) [-692.391] * (-694.492) [-693.850] (-692.476) (-693.722) -- 0:00:28
559000 -- (-693.145) [-692.292] (-694.825) (-693.800) * (-691.462) (-694.928) (-692.968) [-692.853] -- 0:00:28
559500 -- (-696.404) (-691.934) [-690.672] (-693.169) * [-691.868] (-694.868) (-691.015) (-693.342) -- 0:00:29
560000 -- (-691.842) [-692.681] (-695.289) (-692.996) * [-691.957] (-696.952) (-694.799) (-691.444) -- 0:00:29
Average standard deviation of split frequencies: 0.011326
560500 -- (-696.129) (-694.018) (-691.579) [-692.609] * [-695.190] (-693.853) (-692.773) (-692.261) -- 0:00:29
561000 -- (-693.323) (-692.421) (-695.492) [-691.997] * (-695.797) (-693.290) [-691.610] (-694.312) -- 0:00:28
561500 -- (-693.751) (-692.712) (-694.730) [-693.067] * [-691.383] (-693.467) (-694.221) (-691.206) -- 0:00:28
562000 -- (-699.111) (-693.238) (-690.482) [-694.559] * (-690.297) (-696.912) [-693.056] (-692.464) -- 0:00:28
562500 -- (-695.862) [-693.690] (-695.388) (-694.531) * [-694.890] (-693.846) (-690.173) (-691.918) -- 0:00:28
563000 -- [-694.714] (-694.059) (-695.667) (-694.420) * (-691.496) (-692.813) (-691.887) [-692.823] -- 0:00:28
563500 -- (-691.880) [-696.581] (-691.429) (-692.960) * (-695.455) (-692.942) [-691.858] (-692.607) -- 0:00:28
564000 -- (-692.818) [-695.605] (-691.775) (-693.146) * (-696.049) [-692.535] (-697.432) (-695.761) -- 0:00:28
564500 -- (-695.586) (-694.328) (-693.148) [-692.780] * [-693.687] (-691.740) (-692.871) (-695.136) -- 0:00:28
565000 -- (-695.281) (-693.505) (-696.572) [-689.906] * (-698.352) (-693.538) [-692.556] (-692.449) -- 0:00:28
Average standard deviation of split frequencies: 0.011415
565500 -- (-692.458) (-695.892) (-693.465) [-692.342] * (-696.091) [-692.169] (-692.357) (-691.076) -- 0:00:28
566000 -- (-691.401) (-694.316) [-692.718] (-691.985) * [-692.165] (-694.384) (-694.345) (-695.422) -- 0:00:28
566500 -- (-696.632) (-695.544) (-695.034) [-693.509] * (-694.384) (-693.910) [-693.385] (-695.482) -- 0:00:28
567000 -- (-692.644) (-695.923) (-691.588) [-691.804] * [-692.691] (-694.737) (-697.412) (-692.804) -- 0:00:28
567500 -- (-696.211) [-691.821] (-692.571) (-692.051) * (-691.536) (-691.346) [-691.746] (-693.175) -- 0:00:28
568000 -- (-694.770) (-694.848) [-693.569] (-692.772) * [-692.052] (-692.268) (-695.310) (-694.312) -- 0:00:28
568500 -- (-694.492) (-691.417) (-692.587) [-697.748] * (-693.844) (-692.747) [-694.634] (-691.682) -- 0:00:28
569000 -- (-696.518) (-693.884) (-695.612) [-693.734] * [-691.614] (-693.586) (-695.584) (-692.996) -- 0:00:28
569500 -- [-691.854] (-694.245) (-695.716) (-691.124) * [-691.141] (-693.341) (-692.358) (-693.378) -- 0:00:27
570000 -- (-690.675) (-692.658) (-693.045) [-693.274] * (-698.935) [-698.487] (-695.938) (-694.873) -- 0:00:27
Average standard deviation of split frequencies: 0.011225
570500 -- (-691.826) (-692.941) (-691.575) [-695.861] * (-689.990) (-691.550) [-692.541] (-698.771) -- 0:00:27
571000 -- (-694.139) [-692.956] (-696.199) (-693.186) * (-693.055) [-693.901] (-695.955) (-695.088) -- 0:00:27
571500 -- (-695.626) [-692.760] (-695.911) (-693.646) * (-693.388) [-694.517] (-695.466) (-696.238) -- 0:00:27
572000 -- (-692.828) (-692.824) (-693.061) [-692.852] * (-694.093) [-693.796] (-695.342) (-691.978) -- 0:00:27
572500 -- (-691.544) [-691.070] (-695.963) (-690.691) * (-692.531) (-697.142) (-697.427) [-692.862] -- 0:00:27
573000 -- [-692.311] (-691.478) (-697.070) (-700.140) * [-692.262] (-690.730) (-691.306) (-694.523) -- 0:00:27
573500 -- (-693.641) [-692.802] (-699.482) (-691.688) * (-691.915) (-697.930) (-696.757) [-693.757] -- 0:00:27
574000 -- (-698.995) (-692.866) [-695.184] (-692.829) * (-692.331) [-691.330] (-692.406) (-692.401) -- 0:00:27
574500 -- (-692.565) (-692.972) [-694.000] (-692.764) * (-691.577) (-696.514) (-691.836) [-691.951] -- 0:00:27
575000 -- (-692.342) (-694.817) (-696.638) [-692.168] * (-692.954) [-692.489] (-697.311) (-695.730) -- 0:00:28
Average standard deviation of split frequencies: 0.011410
575500 -- [-692.930] (-696.679) (-696.331) (-696.030) * (-692.318) [-690.895] (-695.685) (-694.779) -- 0:00:28
576000 -- [-690.909] (-691.500) (-692.297) (-693.526) * [-691.846] (-694.611) (-697.830) (-694.176) -- 0:00:27
576500 -- (-694.878) (-696.245) [-696.130] (-693.168) * (-692.844) [-696.903] (-699.294) (-695.831) -- 0:00:27
577000 -- (-691.969) (-695.435) (-701.220) [-696.064] * [-696.879] (-692.044) (-697.707) (-695.074) -- 0:00:27
577500 -- (-696.668) [-693.216] (-694.391) (-691.093) * (-697.729) [-694.428] (-693.815) (-695.414) -- 0:00:27
578000 -- (-693.081) (-692.249) [-692.929] (-691.878) * (-703.110) (-695.088) [-690.620] (-692.965) -- 0:00:27
578500 -- (-698.558) (-695.220) (-692.472) [-691.683] * (-695.539) (-692.459) (-691.300) [-693.407] -- 0:00:27
579000 -- (-697.456) (-696.808) [-693.444] (-693.738) * [-693.753] (-694.243) (-691.312) (-696.526) -- 0:00:27
579500 -- (-697.758) (-696.620) (-693.542) [-692.078] * (-693.968) (-697.047) [-692.692] (-693.953) -- 0:00:27
580000 -- (-694.387) [-691.161] (-690.619) (-690.056) * (-696.386) (-692.513) [-691.655] (-696.376) -- 0:00:27
Average standard deviation of split frequencies: 0.011461
580500 -- (-694.606) (-694.774) (-692.782) [-693.905] * (-698.195) (-692.116) (-693.701) [-692.743] -- 0:00:27
581000 -- (-693.845) [-692.076] (-695.332) (-697.376) * [-696.493] (-695.390) (-696.094) (-693.095) -- 0:00:27
581500 -- (-696.713) [-692.757] (-693.224) (-693.201) * (-698.663) (-695.014) [-692.575] (-698.607) -- 0:00:27
582000 -- (-690.774) [-694.021] (-692.321) (-694.348) * (-695.009) (-694.227) (-692.180) [-692.401] -- 0:00:27
582500 -- [-692.031] (-694.660) (-695.132) (-691.505) * [-692.220] (-694.710) (-692.125) (-693.158) -- 0:00:27
583000 -- (-692.695) (-695.748) [-691.720] (-691.665) * (-696.276) (-692.596) (-695.935) [-692.085] -- 0:00:27
583500 -- (-695.715) (-695.322) (-694.643) [-697.731] * (-696.237) (-699.390) (-697.385) [-693.092] -- 0:00:27
584000 -- (-693.664) [-694.252] (-693.204) (-691.966) * (-695.833) (-697.708) [-693.391] (-693.467) -- 0:00:27
584500 -- [-690.580] (-696.367) (-701.279) (-696.080) * (-694.019) (-696.745) [-692.760] (-691.582) -- 0:00:27
585000 -- [-694.028] (-696.171) (-694.087) (-693.756) * (-694.733) (-695.470) [-692.738] (-695.428) -- 0:00:26
Average standard deviation of split frequencies: 0.011128
585500 -- (-693.569) [-692.300] (-692.924) (-692.872) * (-695.945) [-693.101] (-694.146) (-696.351) -- 0:00:26
586000 -- (-692.760) [-691.982] (-695.206) (-693.710) * (-695.114) [-692.315] (-696.094) (-696.116) -- 0:00:26
586500 -- [-693.854] (-692.456) (-697.460) (-694.425) * (-697.437) (-695.266) (-696.659) [-695.660] -- 0:00:26
587000 -- (-692.918) (-693.863) [-696.702] (-695.154) * [-691.343] (-693.834) (-698.747) (-695.507) -- 0:00:26
587500 -- (-697.513) (-700.518) [-692.557] (-698.664) * (-691.922) [-695.142] (-693.570) (-693.966) -- 0:00:26
588000 -- (-696.489) [-696.046] (-690.107) (-696.181) * (-693.387) (-691.790) (-693.316) [-693.577] -- 0:00:26
588500 -- (-697.151) [-695.343] (-691.721) (-693.117) * (-692.377) [-690.971] (-692.495) (-693.359) -- 0:00:26
589000 -- (-691.972) (-693.329) (-691.358) [-695.832] * [-693.093] (-691.053) (-691.773) (-695.232) -- 0:00:26
589500 -- (-694.937) (-695.439) [-692.908] (-701.172) * (-691.418) (-696.196) [-692.800] (-695.754) -- 0:00:26
590000 -- (-692.717) (-694.199) (-694.677) [-694.896] * (-698.854) [-690.707] (-693.803) (-694.968) -- 0:00:27
Average standard deviation of split frequencies: 0.011314
590500 -- (-692.750) (-694.901) (-700.760) [-693.966] * (-697.169) [-693.309] (-692.834) (-694.545) -- 0:00:27
591000 -- [-696.209] (-697.851) (-698.454) (-694.359) * [-694.222] (-691.954) (-693.296) (-694.462) -- 0:00:26
591500 -- [-698.687] (-692.715) (-694.277) (-697.284) * (-691.196) (-693.076) [-695.227] (-694.425) -- 0:00:26
592000 -- (-691.274) (-692.211) [-692.332] (-692.598) * (-693.022) (-705.502) [-693.611] (-696.719) -- 0:00:26
592500 -- [-692.547] (-696.016) (-693.479) (-692.179) * (-694.839) [-691.800] (-694.363) (-697.227) -- 0:00:26
593000 -- (-694.190) [-693.292] (-693.492) (-690.126) * (-693.883) (-692.241) (-694.542) [-700.617] -- 0:00:26
593500 -- (-693.164) (-691.980) (-693.108) [-692.117] * (-693.890) [-690.885] (-696.957) (-694.196) -- 0:00:26
594000 -- (-693.106) [-692.461] (-698.691) (-689.952) * [-694.171] (-694.423) (-697.896) (-693.578) -- 0:00:26
594500 -- [-692.087] (-699.931) (-693.273) (-692.253) * (-694.655) (-696.091) [-691.231] (-693.395) -- 0:00:26
595000 -- (-693.335) (-693.984) (-692.577) [-691.352] * [-691.706] (-693.055) (-693.719) (-695.396) -- 0:00:26
Average standard deviation of split frequencies: 0.011117
595500 -- (-695.113) [-693.186] (-693.388) (-695.498) * (-693.075) (-697.198) [-692.415] (-693.807) -- 0:00:26
596000 -- [-697.403] (-693.118) (-694.387) (-694.125) * (-691.912) (-696.964) [-693.719] (-693.383) -- 0:00:26
596500 -- (-692.202) (-692.102) [-692.735] (-696.942) * [-694.532] (-698.062) (-692.455) (-695.123) -- 0:00:26
597000 -- [-696.508] (-690.817) (-691.222) (-692.399) * (-693.709) (-697.181) (-692.518) [-693.948] -- 0:00:26
597500 -- [-692.792] (-693.571) (-695.781) (-693.660) * (-694.932) [-694.123] (-693.684) (-693.641) -- 0:00:26
598000 -- (-696.270) [-691.412] (-692.500) (-696.010) * (-694.502) (-695.275) [-691.891] (-695.023) -- 0:00:26
598500 -- (-693.496) [-693.446] (-696.315) (-691.297) * (-693.329) [-692.527] (-695.556) (-697.989) -- 0:00:26
599000 -- (-697.244) (-694.047) (-693.327) [-695.824] * [-692.684] (-691.833) (-696.826) (-691.795) -- 0:00:26
599500 -- (-692.847) (-697.535) (-691.132) [-690.199] * [-691.637] (-693.420) (-694.670) (-695.764) -- 0:00:26
600000 -- [-692.855] (-694.810) (-696.774) (-694.771) * (-694.046) (-691.827) [-692.030] (-693.796) -- 0:00:25
Average standard deviation of split frequencies: 0.011554
600500 -- [-697.239] (-692.322) (-694.834) (-693.754) * [-692.438] (-695.397) (-692.496) (-696.104) -- 0:00:25
601000 -- (-693.386) (-692.124) [-689.558] (-692.941) * (-695.207) (-696.049) (-691.406) [-694.498] -- 0:00:25
601500 -- (-696.540) (-693.401) (-693.901) [-697.262] * [-694.488] (-692.839) (-693.817) (-694.085) -- 0:00:25
602000 -- [-695.956] (-700.356) (-694.082) (-697.592) * (-694.284) (-693.064) (-693.085) [-691.629] -- 0:00:25
602500 -- (-695.744) (-694.284) [-694.120] (-694.329) * [-693.128] (-694.519) (-693.560) (-696.392) -- 0:00:25
603000 -- (-690.722) (-694.698) (-695.659) [-692.684] * (-691.689) [-695.221] (-694.244) (-692.864) -- 0:00:25
603500 -- (-693.112) (-704.821) [-692.385] (-695.791) * (-695.492) [-690.944] (-700.296) (-694.492) -- 0:00:25
604000 -- (-693.500) (-691.561) (-692.528) [-693.967] * (-693.498) [-696.199] (-694.999) (-697.347) -- 0:00:25
604500 -- (-694.680) [-692.397] (-697.764) (-695.310) * [-696.883] (-694.183) (-694.812) (-694.552) -- 0:00:26
605000 -- [-694.736] (-691.098) (-693.672) (-695.363) * (-693.143) (-692.421) (-693.954) [-694.494] -- 0:00:26
Average standard deviation of split frequencies: 0.012187
605500 -- (-696.810) (-692.018) (-692.050) [-695.259] * (-692.390) [-693.376] (-693.595) (-694.429) -- 0:00:26
606000 -- (-692.867) (-692.887) (-695.806) [-693.987] * [-692.973] (-693.671) (-693.198) (-695.289) -- 0:00:26
606500 -- (-691.453) (-696.593) (-695.221) [-695.143] * [-694.875] (-694.828) (-697.729) (-695.652) -- 0:00:25
607000 -- (-694.078) (-692.246) [-693.065] (-694.906) * [-695.815] (-694.066) (-692.891) (-696.616) -- 0:00:25
607500 -- (-696.891) [-692.649] (-696.217) (-692.339) * [-696.737] (-693.024) (-693.421) (-691.802) -- 0:00:25
608000 -- [-694.917] (-694.556) (-694.329) (-696.197) * (-699.656) [-693.469] (-693.269) (-691.969) -- 0:00:25
608500 -- (-691.376) (-693.428) (-693.900) [-692.997] * (-694.794) [-692.693] (-692.348) (-693.308) -- 0:00:25
609000 -- (-692.582) (-696.774) (-690.555) [-695.137] * (-697.745) [-694.205] (-694.556) (-691.265) -- 0:00:25
609500 -- (-693.160) (-693.684) (-693.871) [-693.843] * (-695.376) [-693.325] (-694.501) (-697.616) -- 0:00:25
610000 -- [-692.594] (-694.903) (-693.777) (-692.842) * (-696.045) (-693.772) [-692.847] (-695.482) -- 0:00:25
Average standard deviation of split frequencies: 0.012094
610500 -- (-693.970) [-693.210] (-694.597) (-696.745) * (-690.383) (-693.579) (-691.386) [-691.166] -- 0:00:25
611000 -- (-696.146) [-693.069] (-689.532) (-694.210) * (-691.741) (-694.788) (-694.033) [-694.224] -- 0:00:25
611500 -- (-693.984) (-692.866) (-693.403) [-693.282] * (-693.003) (-692.079) [-691.545] (-696.555) -- 0:00:25
612000 -- (-693.985) (-696.333) [-692.217] (-693.736) * [-693.644] (-694.123) (-691.635) (-690.400) -- 0:00:25
612500 -- (-694.689) [-694.027] (-693.861) (-695.217) * (-692.050) (-699.311) [-695.693] (-692.859) -- 0:00:25
613000 -- (-694.186) (-693.304) (-694.302) [-692.273] * (-692.220) (-696.305) (-694.833) [-693.512] -- 0:00:25
613500 -- (-694.630) (-695.079) [-692.137] (-693.685) * [-695.705] (-691.753) (-693.648) (-693.673) -- 0:00:25
614000 -- [-693.135] (-696.267) (-694.355) (-695.315) * (-698.479) (-692.842) (-691.870) [-692.976] -- 0:00:25
614500 -- [-691.864] (-695.695) (-694.770) (-695.945) * (-693.190) (-695.628) [-694.104] (-695.822) -- 0:00:25
615000 -- (-694.486) (-697.612) [-696.240] (-696.603) * (-695.550) (-695.055) (-693.109) [-693.686] -- 0:00:25
Average standard deviation of split frequencies: 0.012499
615500 -- (-695.490) (-691.427) (-694.998) [-693.069] * [-693.085] (-693.661) (-692.064) (-700.911) -- 0:00:24
616000 -- (-694.734) (-696.120) (-696.117) [-694.715] * (-692.043) (-692.928) (-692.688) [-692.624] -- 0:00:24
616500 -- [-693.034] (-696.006) (-696.802) (-694.576) * (-693.974) (-690.463) [-692.677] (-693.455) -- 0:00:24
617000 -- (-693.881) (-697.152) [-691.467] (-695.455) * (-698.221) [-693.133] (-692.826) (-692.599) -- 0:00:24
617500 -- [-691.313] (-693.176) (-694.933) (-694.752) * (-697.017) (-692.371) [-690.500] (-694.577) -- 0:00:24
618000 -- [-692.196] (-696.260) (-695.274) (-697.793) * [-690.837] (-691.743) (-691.347) (-693.863) -- 0:00:24
618500 -- (-691.530) (-695.631) (-694.057) [-698.506] * [-692.278] (-693.516) (-692.480) (-694.097) -- 0:00:24
619000 -- (-693.840) [-693.710] (-694.116) (-694.368) * (-696.536) [-694.357] (-693.596) (-694.546) -- 0:00:24
619500 -- (-692.737) (-693.931) (-695.476) [-695.377] * [-695.580] (-693.650) (-692.836) (-694.126) -- 0:00:24
620000 -- (-698.879) (-695.918) [-693.804] (-694.431) * (-693.951) (-693.298) [-692.983] (-695.661) -- 0:00:25
Average standard deviation of split frequencies: 0.012405
620500 -- (-693.783) (-693.916) [-690.417] (-694.333) * (-694.207) (-693.970) [-696.426] (-692.840) -- 0:00:25
621000 -- (-692.430) (-694.796) [-692.023] (-695.005) * (-693.143) [-694.732] (-694.855) (-693.242) -- 0:00:25
621500 -- (-695.808) (-695.976) (-692.116) [-697.905] * (-693.777) [-693.110] (-694.406) (-693.720) -- 0:00:24
622000 -- [-693.363] (-696.192) (-693.454) (-695.397) * [-694.482] (-695.062) (-691.992) (-692.439) -- 0:00:24
622500 -- (-695.443) [-693.887] (-697.824) (-696.035) * (-694.051) [-693.594] (-693.161) (-696.476) -- 0:00:24
623000 -- [-690.817] (-692.789) (-697.326) (-696.415) * (-692.416) (-696.517) (-693.348) [-695.898] -- 0:00:24
623500 -- [-691.577] (-692.375) (-695.299) (-697.324) * (-694.317) (-694.469) (-698.620) [-691.689] -- 0:00:24
624000 -- (-692.094) [-696.524] (-698.431) (-694.842) * (-694.016) (-695.274) [-691.455] (-691.657) -- 0:00:24
624500 -- (-692.489) (-693.730) [-692.288] (-696.687) * [-694.867] (-695.799) (-689.923) (-694.569) -- 0:00:24
625000 -- [-691.967] (-695.433) (-694.494) (-694.411) * (-698.026) (-695.162) [-696.087] (-694.015) -- 0:00:24
Average standard deviation of split frequencies: 0.011798
625500 -- (-692.833) (-692.475) (-695.349) [-693.201] * (-691.950) (-693.478) (-692.496) [-694.202] -- 0:00:24
626000 -- [-693.819] (-695.769) (-695.645) (-693.265) * (-692.074) (-695.610) [-694.828] (-692.543) -- 0:00:24
626500 -- (-695.201) (-694.158) [-694.822] (-695.293) * (-693.550) [-697.075] (-694.584) (-694.216) -- 0:00:24
627000 -- [-697.804] (-695.892) (-696.257) (-693.316) * [-693.811] (-693.795) (-693.607) (-694.598) -- 0:00:24
627500 -- [-692.813] (-697.475) (-699.381) (-695.718) * (-693.593) [-696.069] (-694.939) (-693.642) -- 0:00:24
628000 -- (-692.759) (-697.372) (-692.376) [-697.289] * (-697.768) (-691.110) (-695.376) [-695.166] -- 0:00:24
628500 -- [-693.060] (-694.305) (-694.029) (-691.531) * [-696.031] (-696.813) (-695.666) (-691.718) -- 0:00:24
629000 -- [-693.356] (-692.504) (-695.849) (-692.917) * (-698.387) (-694.362) (-698.083) [-691.351] -- 0:00:24
629500 -- (-694.206) (-691.326) [-693.045] (-700.963) * (-694.732) (-697.071) (-692.897) [-691.926] -- 0:00:24
630000 -- [-695.723] (-693.716) (-695.223) (-694.090) * (-693.589) (-695.160) (-694.555) [-698.066] -- 0:00:24
Average standard deviation of split frequencies: 0.012399
630500 -- (-692.564) [-693.942] (-693.868) (-692.673) * (-692.842) [-696.744] (-695.368) (-693.538) -- 0:00:24
631000 -- (-693.995) (-693.485) (-694.146) [-694.265] * (-691.737) (-695.433) (-694.761) [-693.018] -- 0:00:23
631500 -- (-693.045) [-694.702] (-698.915) (-695.398) * (-695.030) (-694.232) [-693.473] (-692.962) -- 0:00:23
632000 -- (-692.542) (-695.113) (-695.518) [-693.001] * [-691.744] (-694.893) (-693.461) (-693.003) -- 0:00:23
632500 -- (-690.633) (-692.820) (-693.764) [-693.659] * (-694.111) (-693.281) [-695.750] (-693.331) -- 0:00:23
633000 -- [-694.186] (-691.980) (-697.043) (-694.286) * (-695.911) (-693.986) (-691.657) [-695.392] -- 0:00:23
633500 -- (-692.243) (-692.869) [-694.476] (-692.448) * [-693.602] (-694.483) (-691.812) (-707.784) -- 0:00:23
634000 -- (-699.506) (-693.179) (-692.627) [-695.486] * (-696.210) [-693.069] (-693.896) (-697.240) -- 0:00:23
634500 -- [-689.922] (-692.549) (-692.955) (-694.524) * (-693.423) [-696.064] (-695.044) (-693.415) -- 0:00:23
635000 -- (-691.712) (-693.679) [-692.139] (-694.826) * (-691.572) [-695.784] (-692.896) (-692.289) -- 0:00:23
Average standard deviation of split frequencies: 0.011859
635500 -- (-694.891) [-690.905] (-691.615) (-691.105) * (-695.886) (-696.667) (-695.770) [-695.971] -- 0:00:24
636000 -- (-696.193) (-692.090) (-693.936) [-692.534] * [-693.670] (-697.222) (-691.970) (-696.402) -- 0:00:24
636500 -- [-694.424] (-693.043) (-692.474) (-693.998) * (-692.974) (-697.909) [-693.610] (-694.188) -- 0:00:23
637000 -- (-692.766) (-692.820) [-690.614] (-696.011) * (-692.601) [-695.866] (-695.983) (-695.549) -- 0:00:23
637500 -- [-695.246] (-693.049) (-694.475) (-693.236) * (-696.339) [-692.167] (-693.337) (-696.113) -- 0:00:23
638000 -- (-694.603) [-690.557] (-693.340) (-692.933) * (-694.706) [-693.844] (-691.985) (-695.323) -- 0:00:23
638500 -- [-692.987] (-691.677) (-691.936) (-691.208) * (-692.675) (-696.401) [-691.134] (-695.444) -- 0:00:23
639000 -- (-694.812) (-694.004) (-694.482) [-692.787] * (-695.068) (-694.358) [-692.149] (-695.727) -- 0:00:23
639500 -- (-692.594) (-693.938) (-691.634) [-693.177] * (-697.877) (-695.826) [-693.468] (-696.671) -- 0:00:23
640000 -- (-691.994) [-694.722] (-693.340) (-692.164) * [-694.393] (-696.325) (-693.590) (-696.868) -- 0:00:23
Average standard deviation of split frequencies: 0.012509
640500 -- [-696.220] (-693.569) (-697.345) (-691.472) * [-693.644] (-698.850) (-694.535) (-703.754) -- 0:00:23
641000 -- [-695.822] (-695.803) (-692.035) (-693.653) * (-693.079) (-694.463) [-690.633] (-700.012) -- 0:00:23
641500 -- (-694.471) (-694.285) [-693.632] (-690.726) * (-691.876) (-695.277) [-690.791] (-693.806) -- 0:00:23
642000 -- (-694.774) (-693.587) (-692.227) [-695.436] * (-693.170) (-694.083) [-692.219] (-697.035) -- 0:00:23
642500 -- (-694.336) (-690.964) [-691.440] (-691.581) * (-693.142) [-693.065] (-692.571) (-693.071) -- 0:00:23
643000 -- (-691.999) (-694.525) (-692.059) [-691.070] * [-692.406] (-697.446) (-691.991) (-694.340) -- 0:00:23
643500 -- (-691.892) (-699.184) [-691.058] (-693.873) * [-690.673] (-696.118) (-697.285) (-692.838) -- 0:00:23
644000 -- [-694.746] (-692.794) (-693.961) (-693.381) * (-691.406) (-696.905) (-703.979) [-693.274] -- 0:00:23
644500 -- (-695.128) (-693.855) [-691.883] (-698.547) * (-693.056) (-696.822) [-695.204] (-691.456) -- 0:00:23
645000 -- (-693.915) (-695.798) (-691.517) [-691.898] * (-695.928) (-695.453) (-695.256) [-693.389] -- 0:00:23
Average standard deviation of split frequencies: 0.011919
645500 -- (-693.890) (-695.208) [-690.464] (-696.196) * (-692.845) [-694.776] (-693.955) (-696.869) -- 0:00:23
646000 -- (-692.799) (-693.382) (-695.783) [-691.257] * (-692.489) (-697.640) [-694.410] (-695.612) -- 0:00:23
646500 -- [-691.953] (-691.615) (-692.910) (-694.521) * [-692.236] (-699.675) (-693.324) (-692.933) -- 0:00:22
647000 -- (-693.714) (-694.680) [-696.803] (-691.796) * [-692.345] (-696.435) (-694.447) (-695.174) -- 0:00:22
647500 -- (-691.812) (-692.414) (-694.954) [-691.181] * (-692.869) [-692.982] (-695.554) (-693.221) -- 0:00:22
648000 -- (-692.859) (-692.208) [-693.844] (-698.555) * (-691.457) [-694.769] (-693.573) (-692.033) -- 0:00:22
648500 -- [-693.916] (-689.917) (-697.291) (-696.171) * (-693.191) [-694.477] (-694.189) (-695.940) -- 0:00:22
649000 -- (-695.449) (-690.358) [-695.224] (-691.610) * (-692.739) (-692.506) (-699.484) [-691.878] -- 0:00:22
649500 -- [-695.803] (-693.724) (-696.114) (-690.183) * (-694.387) [-695.308] (-695.311) (-692.305) -- 0:00:22
650000 -- [-692.945] (-693.907) (-695.417) (-697.102) * [-692.339] (-694.748) (-694.096) (-691.446) -- 0:00:22
Average standard deviation of split frequencies: 0.012231
650500 -- (-695.078) (-697.405) (-694.875) [-691.434] * (-693.455) (-693.989) [-691.629] (-693.327) -- 0:00:22
651000 -- [-693.424] (-696.117) (-693.558) (-691.788) * [-692.469] (-694.802) (-695.040) (-695.350) -- 0:00:23
651500 -- (-693.948) (-691.165) (-692.663) [-696.186] * (-693.234) (-692.762) (-690.809) [-693.554] -- 0:00:23
652000 -- (-696.143) (-693.717) [-691.894] (-694.897) * (-697.455) (-693.290) [-690.770] (-692.633) -- 0:00:22
652500 -- (-692.802) [-691.411] (-693.731) (-693.674) * [-693.322] (-697.724) (-694.432) (-699.324) -- 0:00:22
653000 -- [-694.965] (-694.463) (-695.325) (-693.314) * (-696.530) (-696.317) [-692.387] (-692.031) -- 0:00:22
653500 -- [-693.765] (-692.941) (-695.848) (-692.703) * [-694.918] (-693.343) (-695.474) (-692.554) -- 0:00:22
654000 -- (-694.288) (-696.257) (-696.892) [-692.267] * (-697.468) (-697.527) (-696.258) [-690.704] -- 0:00:22
654500 -- [-696.595] (-697.661) (-698.571) (-695.032) * (-693.090) (-695.656) (-692.108) [-691.470] -- 0:00:22
655000 -- (-694.891) [-694.822] (-694.487) (-694.708) * (-693.299) (-694.106) [-692.362] (-691.901) -- 0:00:22
Average standard deviation of split frequencies: 0.012216
655500 -- (-695.470) [-693.742] (-693.477) (-693.382) * (-694.607) (-692.901) (-696.851) [-693.262] -- 0:00:22
656000 -- (-692.442) [-692.595] (-694.709) (-695.338) * [-692.798] (-696.801) (-695.706) (-697.654) -- 0:00:22
656500 -- [-693.859] (-694.049) (-694.437) (-692.470) * (-693.291) (-692.084) [-692.596] (-698.723) -- 0:00:22
657000 -- (-693.207) (-694.114) [-691.634] (-692.816) * [-693.688] (-695.738) (-693.766) (-693.431) -- 0:00:22
657500 -- (-693.936) [-695.047] (-691.133) (-691.719) * (-694.585) (-692.674) [-690.368] (-693.916) -- 0:00:22
658000 -- (-694.177) (-693.948) (-694.524) [-692.889] * (-696.136) (-693.649) [-695.555] (-696.182) -- 0:00:22
658500 -- (-692.692) (-693.597) [-696.315] (-691.205) * (-696.920) (-694.277) (-694.015) [-692.446] -- 0:00:22
659000 -- (-693.902) (-695.134) [-692.178] (-695.531) * (-694.727) [-693.537] (-693.495) (-696.101) -- 0:00:22
659500 -- (-692.639) (-694.139) (-694.608) [-693.656] * (-696.386) (-693.106) (-691.289) [-693.681] -- 0:00:22
660000 -- (-692.330) (-696.152) [-693.119] (-696.218) * (-693.542) (-691.889) [-693.040] (-693.465) -- 0:00:22
Average standard deviation of split frequencies: 0.011878
660500 -- [-697.574] (-694.372) (-695.752) (-691.125) * (-695.666) [-693.802] (-692.688) (-694.378) -- 0:00:22
661000 -- (-705.791) [-695.113] (-693.919) (-692.793) * (-692.597) (-695.146) (-692.192) [-693.390] -- 0:00:22
661500 -- (-695.519) (-696.408) [-692.068] (-694.631) * (-694.184) [-693.042] (-692.320) (-697.616) -- 0:00:22
662000 -- (-697.657) [-692.680] (-694.699) (-697.707) * (-696.747) [-692.589] (-693.568) (-696.007) -- 0:00:21
662500 -- (-695.756) [-691.408] (-696.090) (-700.747) * (-696.540) [-693.156] (-692.849) (-697.060) -- 0:00:21
663000 -- (-695.148) (-692.941) [-694.602] (-694.980) * (-695.254) (-694.427) [-691.275] (-696.227) -- 0:00:21
663500 -- [-698.969] (-694.699) (-694.852) (-695.133) * (-696.363) (-691.679) [-693.880] (-696.691) -- 0:00:21
664000 -- (-695.850) (-693.020) [-693.916] (-698.562) * [-695.816] (-690.626) (-691.427) (-695.856) -- 0:00:21
664500 -- (-694.170) [-689.525] (-696.928) (-693.419) * (-694.699) (-691.888) [-695.461] (-693.856) -- 0:00:21
665000 -- [-693.515] (-691.816) (-700.153) (-692.218) * (-699.824) (-691.083) [-698.100] (-697.321) -- 0:00:21
Average standard deviation of split frequencies: 0.011866
665500 -- (-693.242) [-692.239] (-690.634) (-689.952) * (-691.695) [-695.590] (-694.823) (-692.055) -- 0:00:21
666000 -- (-695.634) (-693.965) (-695.126) [-693.690] * [-693.384] (-696.293) (-694.165) (-692.878) -- 0:00:21
666500 -- (-692.837) (-694.050) [-694.502] (-695.392) * (-694.123) (-691.955) [-697.312] (-696.411) -- 0:00:22
667000 -- (-696.803) (-695.048) (-694.323) [-692.188] * (-696.295) (-696.202) (-697.591) [-695.024] -- 0:00:21
667500 -- (-695.780) (-693.462) [-691.351] (-694.783) * (-694.294) (-693.810) (-696.844) [-690.540] -- 0:00:21
668000 -- (-697.035) (-695.925) [-693.001] (-694.317) * (-692.944) [-692.060] (-695.549) (-692.782) -- 0:00:21
668500 -- (-691.705) (-693.916) (-691.621) [-692.072] * (-692.569) (-695.200) [-694.976] (-694.360) -- 0:00:21
669000 -- (-695.069) [-697.076] (-698.591) (-695.796) * (-695.684) (-697.494) (-691.606) [-693.902] -- 0:00:21
669500 -- (-695.117) (-694.691) (-691.028) [-694.279] * (-694.595) (-694.912) [-691.809] (-695.211) -- 0:00:21
670000 -- (-695.097) (-693.939) [-692.222] (-693.616) * (-695.705) (-696.093) (-694.004) [-695.528] -- 0:00:21
Average standard deviation of split frequencies: 0.011027
670500 -- (-695.589) [-692.343] (-691.489) (-690.664) * (-696.816) (-694.697) [-694.658] (-694.336) -- 0:00:21
671000 -- (-695.067) (-697.139) (-697.471) [-699.961] * (-696.989) [-694.341] (-702.706) (-697.164) -- 0:00:21
671500 -- (-693.801) [-699.375] (-694.137) (-699.054) * (-691.514) (-696.557) [-698.697] (-701.830) -- 0:00:21
672000 -- (-693.157) [-692.039] (-695.371) (-697.404) * (-692.599) [-690.317] (-695.880) (-695.118) -- 0:00:21
672500 -- (-694.533) [-693.706] (-691.888) (-700.513) * [-697.000] (-694.716) (-692.849) (-695.499) -- 0:00:21
673000 -- [-692.647] (-693.412) (-691.545) (-694.548) * (-694.333) (-693.901) (-692.703) [-692.725] -- 0:00:21
673500 -- (-694.454) (-693.033) (-692.419) [-692.194] * [-693.030] (-691.010) (-699.269) (-696.188) -- 0:00:21
674000 -- (-692.831) [-691.846] (-695.010) (-692.660) * (-694.725) [-695.329] (-695.901) (-697.160) -- 0:00:21
674500 -- [-690.637] (-693.476) (-692.583) (-691.850) * [-693.070] (-698.296) (-696.043) (-696.478) -- 0:00:21
675000 -- (-691.581) (-694.316) [-695.090] (-693.072) * (-697.253) [-695.431] (-696.499) (-695.778) -- 0:00:21
Average standard deviation of split frequencies: 0.010765
675500 -- (-693.749) [-692.312] (-692.295) (-697.081) * [-691.915] (-694.359) (-698.872) (-694.243) -- 0:00:21
676000 -- (-697.657) (-696.712) (-692.723) [-693.668] * [-698.716] (-693.045) (-694.082) (-694.796) -- 0:00:21
676500 -- (-692.319) (-693.295) [-695.136] (-696.518) * (-693.583) (-692.738) (-693.877) [-694.271] -- 0:00:21
677000 -- [-692.139] (-697.295) (-694.235) (-692.390) * (-695.539) [-695.444] (-695.157) (-698.641) -- 0:00:20
677500 -- (-692.762) (-698.152) (-694.125) [-691.104] * (-695.971) (-700.385) [-693.310] (-698.904) -- 0:00:20
678000 -- (-693.721) (-691.391) (-695.231) [-692.739] * (-695.175) (-695.771) [-694.794] (-697.080) -- 0:00:20
678500 -- [-690.344] (-698.170) (-695.801) (-696.510) * (-695.440) (-691.537) [-693.316] (-698.854) -- 0:00:20
679000 -- (-695.176) [-696.716] (-700.155) (-695.850) * (-696.094) [-695.762] (-693.880) (-694.485) -- 0:00:20
679500 -- (-693.048) (-694.175) [-691.363] (-691.190) * (-695.538) (-692.830) (-693.709) [-692.675] -- 0:00:20
680000 -- [-689.799] (-693.100) (-695.630) (-701.912) * (-694.695) [-694.367] (-690.645) (-695.582) -- 0:00:20
Average standard deviation of split frequencies: 0.010908
680500 -- [-695.783] (-695.434) (-694.866) (-694.494) * (-692.526) (-696.088) (-696.763) [-694.286] -- 0:00:20
681000 -- (-698.220) (-692.860) (-693.741) [-692.213] * (-695.273) (-694.663) (-693.241) [-692.115] -- 0:00:20
681500 -- (-698.404) (-692.542) [-693.197] (-692.706) * (-695.314) (-690.728) [-691.936] (-694.515) -- 0:00:21
682000 -- (-694.524) [-694.955] (-700.674) (-695.426) * (-695.137) (-691.318) [-693.264] (-695.139) -- 0:00:20
682500 -- (-694.877) (-693.230) [-691.461] (-691.809) * [-692.354] (-692.546) (-695.469) (-692.565) -- 0:00:20
683000 -- (-691.793) (-694.264) [-696.992] (-693.230) * (-694.624) (-692.987) (-694.731) [-693.435] -- 0:00:20
683500 -- [-691.823] (-696.868) (-693.516) (-692.800) * (-694.824) (-693.304) (-692.697) [-693.054] -- 0:00:20
684000 -- (-693.207) (-694.395) [-693.336] (-695.220) * (-694.580) (-693.014) [-694.197] (-692.246) -- 0:00:20
684500 -- [-693.262] (-693.122) (-692.481) (-693.375) * [-694.753] (-692.595) (-693.597) (-691.788) -- 0:00:20
685000 -- [-692.077] (-697.364) (-695.722) (-696.075) * [-692.228] (-694.584) (-693.422) (-695.285) -- 0:00:20
Average standard deviation of split frequencies: 0.010752
685500 -- (-697.003) (-695.329) [-694.555] (-695.970) * [-693.488] (-696.171) (-693.260) (-695.800) -- 0:00:20
686000 -- (-691.882) [-696.484] (-693.636) (-692.473) * (-697.354) (-694.619) [-696.944] (-694.682) -- 0:00:20
686500 -- (-691.590) [-694.374] (-698.744) (-696.829) * (-694.948) (-693.252) (-695.698) [-694.226] -- 0:00:20
687000 -- (-694.581) (-696.080) [-692.617] (-696.558) * (-694.564) (-695.821) [-692.369] (-695.728) -- 0:00:20
687500 -- (-696.798) (-699.837) [-694.413] (-697.753) * (-696.768) (-693.185) (-694.086) [-693.162] -- 0:00:20
688000 -- (-692.719) (-697.738) [-692.891] (-695.392) * (-695.083) [-691.495] (-694.858) (-696.368) -- 0:00:20
688500 -- (-693.765) [-692.773] (-691.722) (-698.996) * (-694.133) (-693.921) (-693.575) [-692.895] -- 0:00:20
689000 -- [-691.094] (-694.341) (-692.448) (-692.129) * [-692.518] (-696.389) (-694.410) (-692.478) -- 0:00:20
689500 -- (-695.745) (-694.715) [-695.419] (-693.177) * (-695.257) [-695.632] (-696.644) (-691.080) -- 0:00:20
690000 -- (-694.683) (-692.851) [-693.133] (-696.260) * (-692.037) [-699.729] (-692.203) (-692.911) -- 0:00:20
Average standard deviation of split frequencies: 0.010622
690500 -- (-695.026) (-694.087) [-693.770] (-696.271) * (-693.208) [-692.338] (-694.076) (-693.267) -- 0:00:20
691000 -- (-693.516) (-695.649) (-694.420) [-695.544] * [-692.553] (-692.178) (-694.662) (-694.945) -- 0:00:20
691500 -- (-691.732) (-694.125) [-693.408] (-696.629) * [-692.779] (-692.890) (-699.630) (-698.627) -- 0:00:20
692000 -- (-692.430) (-696.989) [-691.091] (-697.015) * (-694.538) (-694.371) (-695.570) [-694.067] -- 0:00:20
692500 -- (-696.303) (-699.686) [-691.632] (-696.890) * (-698.297) [-696.466] (-697.971) (-692.626) -- 0:00:19
693000 -- (-691.916) (-695.396) (-693.368) [-695.598] * (-694.413) [-702.662] (-697.484) (-693.199) -- 0:00:19
693500 -- (-692.194) (-698.906) [-697.445] (-694.548) * [-697.080] (-694.789) (-692.689) (-693.998) -- 0:00:19
694000 -- (-694.333) (-693.950) [-695.668] (-692.146) * [-692.454] (-695.380) (-693.414) (-697.486) -- 0:00:19
694500 -- (-693.099) [-695.123] (-691.709) (-691.942) * (-694.536) [-696.620] (-693.499) (-695.554) -- 0:00:19
695000 -- (-691.982) (-699.244) (-696.505) [-690.935] * [-693.474] (-692.211) (-694.413) (-700.585) -- 0:00:19
Average standard deviation of split frequencies: 0.010792
695500 -- (-696.652) (-693.570) (-691.693) [-690.162] * (-692.899) (-693.685) (-693.078) [-693.431] -- 0:00:19
696000 -- (-699.498) (-693.792) [-696.720] (-696.110) * (-691.289) (-692.378) [-693.037] (-697.081) -- 0:00:19
696500 -- [-693.736] (-696.168) (-692.825) (-700.725) * (-692.512) (-693.291) [-691.164] (-698.002) -- 0:00:19
697000 -- (-694.098) (-693.833) [-695.103] (-695.750) * (-692.646) (-692.812) [-691.427] (-696.028) -- 0:00:19
697500 -- (-694.653) [-693.758] (-697.734) (-692.567) * (-692.502) (-691.520) (-691.121) [-696.249] -- 0:00:19
698000 -- [-694.289] (-693.666) (-693.882) (-695.528) * (-693.583) (-695.267) (-693.423) [-694.692] -- 0:00:19
698500 -- [-693.822] (-690.667) (-694.385) (-695.650) * (-695.877) (-695.241) [-692.315] (-693.231) -- 0:00:19
699000 -- (-691.164) [-693.740] (-692.394) (-695.301) * (-691.345) (-695.104) [-690.918] (-691.883) -- 0:00:19
699500 -- (-692.379) (-696.023) (-696.628) [-695.638] * (-694.331) (-693.424) [-692.256] (-693.701) -- 0:00:19
700000 -- (-692.860) (-694.321) (-694.306) [-691.596] * [-695.325] (-694.721) (-691.855) (-691.547) -- 0:00:19
Average standard deviation of split frequencies: 0.010810
700500 -- [-691.079] (-696.160) (-699.142) (-694.498) * (-694.345) (-698.503) (-693.967) [-690.895] -- 0:00:19
701000 -- (-697.474) (-693.435) (-692.381) [-695.653] * [-697.269] (-702.531) (-694.585) (-696.076) -- 0:00:19
701500 -- (-692.494) (-698.315) (-691.485) [-696.406] * (-695.247) [-700.969] (-699.748) (-693.887) -- 0:00:19
702000 -- (-693.106) [-693.143] (-695.299) (-697.368) * (-696.758) (-706.329) [-691.773] (-693.166) -- 0:00:19
702500 -- [-691.561] (-698.099) (-693.752) (-696.278) * (-697.121) (-697.783) [-694.290] (-693.713) -- 0:00:19
703000 -- (-692.645) (-697.478) [-693.770] (-694.412) * [-693.828] (-695.155) (-691.959) (-694.882) -- 0:00:19
703500 -- (-693.021) (-694.959) [-693.034] (-691.920) * (-693.549) [-695.495] (-692.220) (-696.809) -- 0:00:19
704000 -- (-694.509) (-694.943) [-692.769] (-699.558) * (-691.887) [-694.510] (-693.011) (-695.139) -- 0:00:19
704500 -- [-692.384] (-695.176) (-696.953) (-694.821) * (-692.601) [-690.204] (-692.012) (-696.932) -- 0:00:19
705000 -- (-691.065) (-698.125) [-691.953] (-693.331) * (-691.555) (-695.081) [-691.413] (-695.686) -- 0:00:19
Average standard deviation of split frequencies: 0.010683
705500 -- (-692.417) [-693.842] (-692.262) (-697.569) * (-692.206) (-693.226) (-692.463) [-691.233] -- 0:00:19
706000 -- (-692.036) (-692.210) [-695.221] (-694.755) * (-694.947) (-690.921) (-690.984) [-690.398] -- 0:00:19
706500 -- (-693.442) (-693.667) (-694.981) [-694.092] * (-690.867) (-695.908) [-690.530] (-694.989) -- 0:00:19
707000 -- (-693.815) (-692.348) (-696.278) [-691.708] * (-695.562) (-694.212) [-690.830] (-691.892) -- 0:00:19
707500 -- (-691.257) (-697.277) [-695.549] (-696.094) * [-693.761] (-696.270) (-693.268) (-692.263) -- 0:00:19
708000 -- (-694.353) (-693.546) (-690.340) [-692.437] * (-692.231) [-694.732] (-696.682) (-695.483) -- 0:00:18
708500 -- (-691.830) [-691.909] (-692.724) (-694.339) * (-695.603) [-693.554] (-692.930) (-693.969) -- 0:00:18
709000 -- (-690.527) (-695.200) [-693.707] (-694.022) * (-693.674) (-694.303) [-692.305] (-694.015) -- 0:00:18
709500 -- (-690.085) [-692.501] (-693.851) (-699.150) * [-692.755] (-693.776) (-689.953) (-695.221) -- 0:00:18
710000 -- (-691.660) (-692.363) (-697.697) [-691.727] * (-696.986) [-693.740] (-694.369) (-702.892) -- 0:00:18
Average standard deviation of split frequencies: 0.010481
710500 -- (-693.649) [-692.273] (-695.436) (-697.178) * (-694.892) [-692.996] (-692.266) (-697.498) -- 0:00:18
711000 -- (-698.355) (-693.004) (-693.028) [-693.631] * (-697.361) (-694.735) (-693.462) [-700.178] -- 0:00:18
711500 -- (-692.527) [-693.904] (-694.079) (-695.962) * (-693.946) (-693.219) [-690.216] (-698.479) -- 0:00:18
712000 -- (-695.841) [-694.613] (-694.187) (-695.298) * [-691.981] (-695.016) (-692.552) (-695.684) -- 0:00:18
712500 -- [-690.753] (-691.687) (-691.712) (-699.437) * (-695.824) (-693.313) [-691.867] (-702.428) -- 0:00:18
713000 -- (-695.402) (-697.229) (-694.526) [-692.958] * (-693.393) [-690.895] (-695.658) (-694.943) -- 0:00:18
713500 -- (-693.244) (-694.081) (-697.887) [-694.190] * (-692.414) [-692.390] (-693.072) (-696.349) -- 0:00:18
714000 -- (-691.841) [-693.899] (-694.279) (-691.356) * (-694.888) (-691.522) [-692.605] (-695.828) -- 0:00:18
714500 -- (-693.963) [-692.087] (-700.595) (-694.543) * [-693.283] (-695.808) (-700.545) (-693.171) -- 0:00:18
715000 -- (-693.918) (-690.574) [-694.065] (-694.406) * (-694.367) (-694.005) [-693.401] (-697.849) -- 0:00:18
Average standard deviation of split frequencies: 0.009744
715500 -- [-690.480] (-693.478) (-696.178) (-695.259) * [-696.014] (-693.812) (-692.635) (-694.986) -- 0:00:18
716000 -- (-694.041) [-693.270] (-691.081) (-697.173) * (-692.989) [-691.783] (-693.029) (-691.024) -- 0:00:18
716500 -- (-690.787) (-692.491) (-694.700) [-690.353] * [-691.957] (-694.396) (-692.876) (-696.511) -- 0:00:18
717000 -- (-697.145) (-697.437) (-694.621) [-693.913] * (-691.515) (-695.255) [-690.338] (-692.535) -- 0:00:18
717500 -- (-693.203) (-695.493) (-693.692) [-692.364] * (-693.284) (-693.306) [-690.495] (-695.712) -- 0:00:18
718000 -- [-693.058] (-695.673) (-695.378) (-695.396) * (-693.751) [-691.441] (-694.128) (-694.499) -- 0:00:18
718500 -- (-693.922) (-693.334) [-697.436] (-694.272) * (-692.824) (-694.329) (-692.557) [-692.651] -- 0:00:18
719000 -- (-693.307) (-690.485) (-694.052) [-696.232] * (-695.397) (-691.246) [-693.134] (-692.977) -- 0:00:18
719500 -- (-692.868) (-694.611) [-694.575] (-695.407) * [-694.137] (-691.511) (-693.905) (-699.425) -- 0:00:18
720000 -- [-694.232] (-692.143) (-693.659) (-698.500) * (-695.827) [-692.137] (-697.345) (-696.566) -- 0:00:18
Average standard deviation of split frequencies: 0.009725
720500 -- (-696.061) (-693.993) [-694.120] (-695.561) * (-693.183) [-693.613] (-692.265) (-694.392) -- 0:00:18
721000 -- (-695.233) (-693.762) (-692.213) [-695.175] * (-693.723) [-690.481] (-692.713) (-694.636) -- 0:00:18
721500 -- (-692.056) (-693.648) [-695.895] (-693.665) * (-693.022) (-695.275) [-695.489] (-693.340) -- 0:00:18
722000 -- [-690.993] (-694.230) (-698.214) (-700.013) * (-695.952) [-692.278] (-693.429) (-696.836) -- 0:00:18
722500 -- (-698.211) (-695.228) (-695.282) [-694.363] * (-699.840) (-694.223) [-693.891] (-694.409) -- 0:00:18
723000 -- (-694.685) (-695.084) [-692.889] (-692.219) * (-693.704) (-693.868) [-691.528] (-693.068) -- 0:00:18
723500 -- [-694.753] (-693.223) (-693.539) (-691.547) * (-693.020) (-693.785) [-692.087] (-691.529) -- 0:00:17
724000 -- (-698.948) [-696.608] (-692.795) (-693.224) * (-693.563) (-692.556) [-690.762] (-693.542) -- 0:00:17
724500 -- (-694.646) (-694.465) [-692.999] (-694.771) * (-696.849) (-695.036) (-695.487) [-695.749] -- 0:00:17
725000 -- (-692.702) [-694.436] (-696.386) (-697.012) * (-698.612) (-694.500) [-692.216] (-692.750) -- 0:00:17
Average standard deviation of split frequencies: 0.009618
725500 -- (-695.777) (-693.734) (-692.069) [-694.750] * (-693.257) (-691.163) [-694.926] (-696.503) -- 0:00:17
726000 -- (-694.312) (-692.833) [-693.996] (-696.692) * (-693.484) (-693.823) (-691.744) [-691.977] -- 0:00:17
726500 -- (-692.725) [-693.121] (-693.780) (-694.448) * [-694.232] (-692.234) (-693.855) (-693.605) -- 0:00:17
727000 -- (-692.593) [-692.697] (-694.541) (-692.342) * (-692.804) (-693.910) [-694.989] (-692.710) -- 0:00:17
727500 -- (-695.208) [-696.596] (-692.052) (-691.898) * (-696.529) (-695.819) [-691.989] (-694.806) -- 0:00:17
728000 -- (-692.373) (-692.461) [-695.951] (-692.025) * (-693.146) (-692.276) (-693.108) [-692.325] -- 0:00:17
728500 -- (-694.735) [-694.017] (-691.829) (-695.999) * (-695.440) (-699.141) [-695.877] (-694.540) -- 0:00:17
729000 -- (-697.313) (-690.859) [-691.458] (-698.212) * [-692.528] (-698.432) (-692.226) (-693.054) -- 0:00:17
729500 -- (-698.355) (-692.952) [-694.760] (-695.993) * (-693.644) [-692.293] (-695.810) (-691.573) -- 0:00:17
730000 -- [-690.931] (-698.069) (-693.634) (-693.463) * [-691.288] (-691.592) (-696.351) (-691.300) -- 0:00:17
Average standard deviation of split frequencies: 0.009879
730500 -- (-692.762) (-694.117) (-692.198) [-692.901] * (-692.465) [-694.509] (-697.797) (-691.116) -- 0:00:17
731000 -- (-693.857) (-692.215) [-693.066] (-698.547) * (-701.249) [-692.797] (-692.123) (-695.255) -- 0:00:17
731500 -- (-695.534) (-694.267) (-693.721) [-694.617] * (-694.645) (-694.064) [-694.894] (-693.409) -- 0:00:17
732000 -- [-692.675] (-693.913) (-702.092) (-696.541) * [-691.751] (-694.635) (-694.660) (-691.333) -- 0:00:17
732500 -- [-693.083] (-691.889) (-704.094) (-703.448) * (-692.493) (-697.541) [-693.784] (-695.486) -- 0:00:17
733000 -- (-692.575) [-694.098] (-696.672) (-694.475) * (-693.172) (-692.000) (-693.641) [-693.292] -- 0:00:17
733500 -- [-694.812] (-693.512) (-693.071) (-698.492) * (-691.800) (-696.318) (-693.958) [-691.684] -- 0:00:17
734000 -- (-694.319) (-694.825) (-690.444) [-696.289] * (-693.934) (-697.722) [-693.651] (-691.998) -- 0:00:17
734500 -- [-693.728] (-695.727) (-692.073) (-693.952) * (-691.359) (-694.565) (-690.747) [-693.115] -- 0:00:17
735000 -- (-692.849) (-695.365) (-690.805) [-694.829] * (-693.274) (-693.595) [-699.076] (-693.242) -- 0:00:17
Average standard deviation of split frequencies: 0.009607
735500 -- (-692.010) (-693.810) [-691.160] (-694.535) * (-693.706) (-694.229) (-691.212) [-695.601] -- 0:00:17
736000 -- [-694.778] (-691.651) (-693.303) (-692.779) * (-692.586) [-692.064] (-694.721) (-699.438) -- 0:00:17
736500 -- [-692.696] (-691.291) (-696.109) (-693.259) * (-694.044) (-692.374) [-692.176] (-694.344) -- 0:00:17
737000 -- (-701.664) (-697.297) (-694.970) [-695.404] * (-691.830) [-697.266] (-693.398) (-693.144) -- 0:00:17
737500 -- (-695.160) (-693.210) (-693.332) [-691.948] * (-692.104) (-694.595) [-698.778] (-692.763) -- 0:00:17
738000 -- (-694.034) [-691.401] (-691.215) (-692.110) * [-692.858] (-696.463) (-698.183) (-694.388) -- 0:00:17
738500 -- [-692.323] (-694.240) (-695.921) (-692.876) * (-693.776) (-697.926) [-691.048] (-691.323) -- 0:00:16
739000 -- (-695.963) [-695.407] (-692.591) (-697.237) * (-695.514) (-694.245) (-690.402) [-690.575] -- 0:00:16
739500 -- [-695.868] (-693.399) (-691.387) (-692.553) * (-692.349) (-692.952) [-691.313] (-691.602) -- 0:00:16
740000 -- (-692.970) (-694.062) [-692.538] (-695.940) * [-692.297] (-696.492) (-693.616) (-691.598) -- 0:00:16
Average standard deviation of split frequencies: 0.009825
740500 -- (-701.387) [-692.335] (-691.177) (-692.831) * (-692.246) (-696.410) (-692.180) [-693.133] -- 0:00:16
741000 -- (-701.097) (-692.591) [-694.799] (-695.436) * (-694.068) (-698.348) (-693.854) [-691.714] -- 0:00:16
741500 -- [-692.889] (-693.837) (-695.838) (-695.910) * (-698.237) (-696.460) (-692.237) [-691.297] -- 0:00:16
742000 -- (-690.664) (-691.848) (-691.815) [-694.042] * (-694.819) (-695.051) (-691.377) [-691.653] -- 0:00:16
742500 -- [-695.663] (-694.989) (-691.867) (-695.880) * [-693.534] (-693.140) (-697.694) (-696.084) -- 0:00:16
743000 -- (-692.202) [-695.403] (-692.460) (-690.587) * (-695.666) (-693.025) [-692.407] (-695.978) -- 0:00:16
743500 -- (-700.467) [-691.984] (-698.294) (-692.887) * (-696.931) (-697.151) (-694.253) [-693.058] -- 0:00:16
744000 -- [-694.419] (-696.747) (-692.236) (-694.636) * [-694.739] (-694.371) (-691.790) (-697.021) -- 0:00:16
744500 -- [-694.284] (-695.723) (-694.598) (-695.044) * (-697.132) (-693.629) (-695.186) [-694.295] -- 0:00:16
745000 -- (-696.778) (-695.796) [-694.163] (-698.199) * (-693.636) [-696.957] (-694.949) (-694.866) -- 0:00:16
Average standard deviation of split frequencies: 0.009637
745500 -- (-695.586) (-692.502) (-700.478) [-692.735] * (-692.092) (-694.692) [-694.350] (-694.538) -- 0:00:16
746000 -- (-697.198) (-694.500) [-692.187] (-691.192) * (-694.172) (-698.284) (-696.628) [-691.864] -- 0:00:16
746500 -- (-693.971) (-692.864) [-693.020] (-692.065) * (-693.910) [-696.060] (-696.331) (-695.114) -- 0:00:16
747000 -- [-695.214] (-696.275) (-693.625) (-692.267) * (-695.153) (-700.075) (-693.929) [-691.886] -- 0:00:16
747500 -- (-694.374) (-693.089) (-692.031) [-695.969] * (-692.479) (-695.593) [-693.600] (-693.294) -- 0:00:16
748000 -- (-694.696) [-693.414] (-693.477) (-693.111) * (-699.201) [-692.979] (-694.431) (-694.096) -- 0:00:16
748500 -- (-697.029) (-691.708) (-694.960) [-691.434] * (-695.899) (-691.782) [-693.309] (-697.616) -- 0:00:16
749000 -- (-694.037) (-691.394) (-696.685) [-690.326] * (-693.862) (-691.810) (-694.400) [-691.643] -- 0:00:16
749500 -- [-691.442] (-691.272) (-692.585) (-694.730) * (-693.737) (-690.872) [-694.707] (-691.479) -- 0:00:16
750000 -- (-694.787) [-691.530] (-697.764) (-692.554) * (-692.715) (-696.328) [-697.652] (-697.975) -- 0:00:16
Average standard deviation of split frequencies: 0.009577
750500 -- (-699.664) (-693.003) (-694.556) [-692.328] * [-692.738] (-693.181) (-697.051) (-697.102) -- 0:00:16
751000 -- [-691.395] (-695.978) (-694.833) (-693.854) * (-691.939) (-695.683) (-695.548) [-693.061] -- 0:00:16
751500 -- (-691.290) (-709.472) [-693.123] (-690.052) * [-692.630] (-693.755) (-694.623) (-693.768) -- 0:00:16
752000 -- [-692.456] (-694.881) (-694.519) (-694.525) * (-695.140) (-698.922) (-691.566) [-693.856] -- 0:00:16
752500 -- (-692.960) (-699.161) [-692.108] (-695.055) * [-692.077] (-694.828) (-692.413) (-692.779) -- 0:00:16
753000 -- (-692.656) [-691.983] (-696.425) (-694.606) * (-691.835) (-694.645) [-692.372] (-700.129) -- 0:00:16
753500 -- (-694.204) (-691.143) [-694.449] (-693.791) * (-695.135) [-692.765] (-694.186) (-696.186) -- 0:00:16
754000 -- (-697.146) (-696.012) (-693.168) [-695.125] * (-697.995) (-697.673) [-692.758] (-693.933) -- 0:00:15
754500 -- (-698.321) [-694.694] (-691.914) (-696.688) * (-692.070) (-694.435) (-693.197) [-694.344] -- 0:00:15
755000 -- (-693.580) (-691.840) [-700.674] (-694.007) * [-691.700] (-694.851) (-693.012) (-695.049) -- 0:00:15
Average standard deviation of split frequencies: 0.010060
755500 -- (-691.125) (-694.385) (-695.221) [-695.336] * [-690.494] (-694.653) (-702.605) (-694.941) -- 0:00:15
756000 -- (-693.686) (-693.148) (-692.834) [-691.338] * [-694.818] (-700.131) (-694.751) (-693.351) -- 0:00:15
756500 -- (-693.878) (-696.279) (-697.360) [-694.806] * (-692.915) (-693.260) [-693.580] (-694.190) -- 0:00:15
757000 -- (-693.457) [-692.595] (-693.233) (-695.837) * (-692.803) (-693.112) (-698.320) [-692.065] -- 0:00:15
757500 -- (-692.223) [-696.847] (-695.694) (-694.141) * (-692.535) (-692.651) (-701.422) [-695.595] -- 0:00:15
758000 -- (-694.534) (-694.567) (-696.575) [-691.573] * (-693.357) (-691.967) [-696.736] (-695.266) -- 0:00:15
758500 -- (-694.731) (-692.764) [-692.479] (-691.391) * (-695.093) (-693.110) [-696.241] (-698.907) -- 0:00:15
759000 -- (-693.703) (-691.386) [-691.444] (-695.148) * (-692.731) [-694.015] (-699.332) (-695.588) -- 0:00:15
759500 -- (-695.859) (-695.590) [-692.683] (-693.532) * (-694.637) (-696.926) (-695.792) [-694.515] -- 0:00:15
760000 -- (-691.364) [-691.677] (-692.840) (-695.070) * (-691.853) (-694.101) [-692.179] (-698.050) -- 0:00:15
Average standard deviation of split frequencies: 0.009761
760500 -- (-694.299) (-693.911) [-692.445] (-694.089) * (-693.112) (-693.262) (-696.523) [-699.732] -- 0:00:15
761000 -- (-694.068) (-697.166) [-693.139] (-695.981) * [-692.440] (-695.234) (-698.118) (-695.552) -- 0:00:15
761500 -- (-695.104) (-694.499) (-695.278) [-695.379] * (-693.611) (-692.923) (-696.755) [-693.410] -- 0:00:15
762000 -- (-695.601) (-693.400) (-692.811) [-695.514] * (-693.703) [-693.562] (-697.438) (-696.826) -- 0:00:15
762500 -- [-695.466] (-692.269) (-694.138) (-696.580) * (-694.216) [-692.528] (-695.917) (-694.471) -- 0:00:15
763000 -- (-695.140) (-694.539) (-694.849) [-693.621] * (-693.471) [-691.712] (-695.889) (-693.460) -- 0:00:15
763500 -- (-693.716) [-693.019] (-693.296) (-694.426) * (-698.549) [-695.352] (-696.286) (-694.740) -- 0:00:15
764000 -- (-693.176) (-693.734) [-692.620] (-694.727) * [-691.739] (-693.101) (-695.270) (-695.284) -- 0:00:15
764500 -- (-693.318) (-698.505) [-692.484] (-693.120) * (-693.706) (-695.305) [-694.942] (-697.459) -- 0:00:15
765000 -- [-697.468] (-695.470) (-694.138) (-692.355) * (-694.493) [-692.883] (-693.006) (-692.575) -- 0:00:15
Average standard deviation of split frequencies: 0.009693
765500 -- (-692.892) [-693.434] (-695.136) (-691.364) * (-694.651) (-697.705) [-693.605] (-695.166) -- 0:00:15
766000 -- (-695.216) (-691.822) (-696.751) [-691.285] * [-693.421] (-691.430) (-695.856) (-706.638) -- 0:00:15
766500 -- (-694.665) (-694.408) [-691.733] (-692.736) * (-692.664) (-691.542) [-693.897] (-694.315) -- 0:00:15
767000 -- (-692.203) (-694.703) [-695.586] (-691.406) * (-693.314) (-691.301) [-697.353] (-696.515) -- 0:00:15
767500 -- (-693.174) [-692.424] (-693.025) (-694.287) * (-695.666) (-692.027) (-695.750) [-693.585] -- 0:00:15
768000 -- [-699.065] (-697.282) (-694.719) (-694.914) * (-692.112) (-700.552) (-693.291) [-695.589] -- 0:00:15
768500 -- (-693.447) [-693.921] (-691.872) (-694.641) * (-696.456) [-698.158] (-692.084) (-691.670) -- 0:00:15
769000 -- [-692.515] (-692.060) (-691.730) (-695.510) * (-693.574) (-692.369) (-691.521) [-692.854] -- 0:00:15
769500 -- (-698.515) (-691.445) (-691.663) [-696.181] * [-690.485] (-693.710) (-690.821) (-694.686) -- 0:00:14
770000 -- [-693.992] (-692.560) (-691.708) (-698.066) * (-693.032) (-691.565) (-693.345) [-691.032] -- 0:00:14
Average standard deviation of split frequencies: 0.009991
770500 -- (-696.011) (-694.942) [-693.040] (-695.284) * (-692.587) (-692.416) (-691.670) [-691.248] -- 0:00:14
771000 -- (-696.610) (-690.940) (-691.903) [-693.088] * (-695.950) (-694.966) [-691.814] (-693.371) -- 0:00:14
771500 -- (-694.763) [-694.880] (-691.965) (-693.361) * (-696.388) [-694.638] (-693.856) (-692.879) -- 0:00:14
772000 -- (-701.571) (-692.670) (-692.659) [-692.642] * (-694.078) (-696.602) (-693.406) [-694.866] -- 0:00:14
772500 -- (-703.949) (-698.881) [-692.208] (-695.069) * (-693.947) (-692.296) (-697.598) [-694.847] -- 0:00:14
773000 -- (-698.662) (-696.752) (-693.403) [-693.969] * (-696.685) [-691.797] (-692.033) (-697.166) -- 0:00:14
773500 -- (-695.198) [-692.682] (-694.586) (-693.121) * (-694.066) [-692.280] (-692.686) (-694.331) -- 0:00:14
774000 -- (-697.912) (-692.377) (-700.312) [-692.609] * (-692.026) (-694.547) (-694.932) [-691.506] -- 0:00:14
774500 -- (-698.070) (-693.680) (-693.434) [-692.246] * (-693.505) [-691.960] (-695.153) (-695.569) -- 0:00:14
775000 -- [-691.292] (-694.819) (-690.319) (-696.848) * [-695.355] (-696.050) (-691.769) (-693.130) -- 0:00:14
Average standard deviation of split frequencies: 0.009801
775500 -- [-692.287] (-694.826) (-694.000) (-696.258) * (-693.801) [-692.779] (-690.328) (-693.814) -- 0:00:14
776000 -- (-691.502) (-696.231) (-691.611) [-692.179] * (-696.171) (-692.805) (-692.671) [-697.476] -- 0:00:14
776500 -- (-694.020) (-695.266) [-692.158] (-695.185) * [-692.611] (-694.484) (-692.838) (-692.664) -- 0:00:14
777000 -- (-691.589) (-692.738) (-693.588) [-691.958] * (-693.786) [-691.930] (-695.931) (-694.519) -- 0:00:14
777500 -- [-693.267] (-697.438) (-692.416) (-697.313) * (-695.547) (-694.827) (-692.550) [-690.898] -- 0:00:14
778000 -- (-694.701) [-690.736] (-693.739) (-691.912) * (-695.497) [-693.334] (-691.687) (-695.385) -- 0:00:14
778500 -- (-696.471) [-692.983] (-694.866) (-695.186) * (-697.532) (-692.830) [-690.821] (-696.556) -- 0:00:14
779000 -- [-694.819] (-693.073) (-694.317) (-693.048) * (-699.595) (-692.757) (-693.667) [-691.890] -- 0:00:14
779500 -- [-692.955] (-693.696) (-694.819) (-695.683) * (-694.801) (-692.382) [-690.504] (-694.378) -- 0:00:14
780000 -- [-694.592] (-692.636) (-692.183) (-693.796) * [-692.404] (-694.376) (-693.232) (-694.545) -- 0:00:14
Average standard deviation of split frequencies: 0.010708
780500 -- (-697.520) (-697.157) [-694.660] (-694.004) * (-693.830) (-692.274) [-689.556] (-694.317) -- 0:00:14
781000 -- [-690.739] (-691.156) (-693.968) (-692.789) * [-691.785] (-697.373) (-692.270) (-695.311) -- 0:00:14
781500 -- [-695.070] (-696.137) (-692.869) (-691.605) * (-695.187) [-695.207] (-700.601) (-693.126) -- 0:00:14
782000 -- [-691.472] (-695.528) (-692.696) (-695.905) * (-694.999) [-694.585] (-696.263) (-691.976) -- 0:00:14
782500 -- (-695.777) (-694.141) (-693.947) [-692.089] * (-697.550) (-695.933) (-692.620) [-693.071] -- 0:00:14
783000 -- [-694.474] (-693.581) (-692.594) (-692.428) * [-696.243] (-690.982) (-694.329) (-698.337) -- 0:00:14
783500 -- (-693.145) (-696.341) (-696.435) [-693.451] * (-696.749) [-694.898] (-698.087) (-696.272) -- 0:00:14
784000 -- (-696.751) (-695.524) (-694.702) [-695.659] * [-696.669] (-692.488) (-692.820) (-695.023) -- 0:00:14
784500 -- (-693.181) [-694.105] (-696.810) (-691.592) * (-694.129) [-693.901] (-698.970) (-699.571) -- 0:00:14
785000 -- (-692.374) [-693.983] (-692.518) (-691.150) * [-694.132] (-692.673) (-695.540) (-692.535) -- 0:00:13
Average standard deviation of split frequencies: 0.009636
785500 -- (-690.768) (-693.709) [-691.048] (-690.341) * (-693.420) (-691.917) [-694.060] (-696.319) -- 0:00:13
786000 -- (-692.388) [-695.538] (-695.621) (-693.198) * [-691.677] (-694.627) (-692.357) (-695.413) -- 0:00:13
786500 -- (-693.770) (-697.143) (-694.851) [-695.007] * (-695.568) [-693.939] (-690.852) (-694.435) -- 0:00:13
787000 -- (-695.666) (-693.247) [-691.662] (-694.622) * (-696.661) (-694.456) [-692.426] (-698.334) -- 0:00:13
787500 -- (-694.192) (-693.374) [-693.286] (-693.332) * (-694.180) (-693.791) (-692.145) [-690.372] -- 0:00:13
788000 -- [-693.034] (-692.873) (-692.841) (-693.952) * (-694.557) (-693.118) (-695.003) [-691.594] -- 0:00:13
788500 -- (-697.866) (-693.367) [-697.216] (-692.480) * (-692.263) (-694.301) [-692.478] (-693.689) -- 0:00:13
789000 -- (-694.972) [-695.555] (-697.030) (-695.324) * (-694.002) [-694.082] (-703.294) (-691.377) -- 0:00:13
789500 -- (-693.086) (-693.541) (-695.796) [-696.462] * (-694.303) (-691.420) (-692.338) [-692.673] -- 0:00:13
790000 -- [-693.556] (-692.003) (-693.916) (-696.650) * (-694.915) (-691.373) (-692.665) [-695.142] -- 0:00:13
Average standard deviation of split frequencies: 0.010295
790500 -- (-691.170) (-698.875) (-694.363) [-693.193] * (-695.048) (-694.985) [-692.929] (-691.923) -- 0:00:13
791000 -- (-695.194) (-696.117) [-693.413] (-695.526) * (-698.403) (-694.870) [-690.790] (-695.630) -- 0:00:13
791500 -- (-694.767) [-699.559] (-693.446) (-694.960) * (-697.461) (-693.039) (-690.945) [-696.165] -- 0:00:13
792000 -- [-693.740] (-698.172) (-701.080) (-694.231) * (-697.168) (-696.210) (-698.819) [-691.573] -- 0:00:13
792500 -- (-694.675) [-701.593] (-694.855) (-694.774) * [-696.358] (-695.525) (-693.285) (-697.898) -- 0:00:13
793000 -- [-693.494] (-696.426) (-698.015) (-694.904) * (-695.795) (-693.810) [-691.575] (-691.635) -- 0:00:13
793500 -- [-693.905] (-694.319) (-697.011) (-691.666) * (-695.320) (-692.148) (-692.338) [-695.344] -- 0:00:13
794000 -- (-695.100) (-699.088) [-696.215] (-693.613) * (-694.321) (-693.147) (-694.484) [-695.901] -- 0:00:13
794500 -- (-695.559) (-695.143) (-694.857) [-692.492] * [-699.142] (-693.978) (-691.347) (-701.015) -- 0:00:13
795000 -- (-693.761) [-691.939] (-694.813) (-699.614) * (-695.935) (-695.149) [-693.115] (-691.194) -- 0:00:13
Average standard deviation of split frequencies: 0.010502
795500 -- (-693.594) (-701.680) (-694.694) [-695.778] * (-702.111) (-692.244) [-691.421] (-692.533) -- 0:00:13
796000 -- [-695.452] (-698.951) (-696.133) (-701.171) * (-700.177) (-692.061) (-693.257) [-693.429] -- 0:00:13
796500 -- (-691.084) (-694.124) (-692.707) [-695.545] * (-697.083) (-696.977) [-693.472] (-697.331) -- 0:00:13
797000 -- [-692.911] (-700.042) (-694.551) (-696.190) * (-698.408) [-694.512] (-692.705) (-693.389) -- 0:00:13
797500 -- (-693.566) (-693.093) [-694.322] (-695.155) * (-697.475) (-692.968) (-692.355) [-691.791] -- 0:00:13
798000 -- (-693.081) (-693.037) (-694.119) [-692.202] * (-695.775) (-693.988) (-689.843) [-694.391] -- 0:00:13
798500 -- (-690.116) (-697.230) (-694.314) [-694.177] * (-695.828) (-692.463) [-690.903] (-691.295) -- 0:00:13
799000 -- (-690.977) (-692.053) [-693.113] (-693.367) * [-691.139] (-697.194) (-692.705) (-695.466) -- 0:00:13
799500 -- (-697.442) [-693.364] (-692.016) (-692.301) * (-691.767) [-694.337] (-690.271) (-698.139) -- 0:00:13
800000 -- (-692.973) (-694.218) (-696.501) [-693.545] * (-696.900) [-692.797] (-693.988) (-693.265) -- 0:00:12
Average standard deviation of split frequencies: 0.010205
800500 -- [-692.560] (-696.017) (-695.581) (-692.965) * [-696.066] (-692.456) (-691.405) (-693.449) -- 0:00:12
801000 -- [-690.268] (-692.731) (-698.437) (-691.108) * (-697.334) (-692.214) (-690.839) [-693.625] -- 0:00:12
801500 -- (-701.576) (-690.956) (-691.718) [-691.121] * [-697.928] (-696.776) (-692.841) (-693.417) -- 0:00:12
802000 -- [-691.593] (-692.869) (-693.941) (-698.414) * (-691.487) [-692.300] (-690.992) (-695.047) -- 0:00:12
802500 -- [-692.367] (-692.231) (-694.164) (-697.820) * (-697.840) [-692.450] (-691.479) (-693.404) -- 0:00:12
803000 -- (-691.969) (-692.595) (-694.774) [-694.101] * (-696.359) [-692.867] (-693.714) (-695.746) -- 0:00:12
803500 -- (-694.640) (-695.675) (-696.457) [-695.104] * (-694.871) (-690.656) (-693.526) [-695.269] -- 0:00:12
804000 -- (-692.516) [-694.079] (-693.304) (-694.706) * [-693.697] (-691.423) (-691.247) (-693.767) -- 0:00:12
804500 -- [-691.867] (-692.293) (-695.031) (-694.442) * (-702.201) (-699.183) (-694.536) [-693.891] -- 0:00:12
805000 -- (-694.987) (-691.469) (-691.545) [-692.649] * (-692.625) (-695.588) (-693.413) [-695.575] -- 0:00:12
Average standard deviation of split frequencies: 0.010255
805500 -- (-693.905) (-693.628) (-693.501) [-695.480] * (-691.970) [-692.260] (-693.498) (-695.469) -- 0:00:12
806000 -- (-694.629) [-695.304] (-692.905) (-694.644) * (-694.560) [-693.716] (-694.699) (-695.324) -- 0:00:12
806500 -- (-696.043) [-694.978] (-694.197) (-693.475) * [-692.925] (-695.100) (-696.883) (-697.079) -- 0:00:12
807000 -- (-692.623) (-694.593) [-693.467] (-692.068) * [-695.511] (-694.831) (-697.905) (-694.355) -- 0:00:12
807500 -- (-691.866) (-694.987) (-692.260) [-697.096] * (-694.073) (-692.698) (-693.425) [-694.449] -- 0:00:12
808000 -- (-695.285) [-692.803] (-693.255) (-698.729) * [-699.329] (-692.689) (-692.084) (-696.621) -- 0:00:12
808500 -- (-691.497) [-692.543] (-693.150) (-693.467) * [-697.761] (-691.903) (-695.150) (-695.556) -- 0:00:12
809000 -- (-697.974) (-695.551) (-692.588) [-691.326] * (-694.968) (-694.037) [-691.783] (-696.875) -- 0:00:12
809500 -- [-698.357] (-696.224) (-693.254) (-696.661) * (-692.079) (-693.490) [-692.096] (-691.387) -- 0:00:12
810000 -- (-695.377) (-694.318) (-698.117) [-694.311] * (-696.933) (-692.062) [-691.805] (-694.473) -- 0:00:12
Average standard deviation of split frequencies: 0.009195
810500 -- (-693.871) (-694.795) (-700.215) [-690.915] * (-692.671) [-692.797] (-694.788) (-691.857) -- 0:00:12
811000 -- [-693.003] (-696.483) (-700.611) (-694.586) * [-691.474] (-694.487) (-696.633) (-692.912) -- 0:00:12
811500 -- (-697.298) [-694.866] (-701.872) (-699.570) * (-692.241) [-694.099] (-700.376) (-692.960) -- 0:00:12
812000 -- (-693.344) (-693.403) (-694.464) [-692.714] * (-692.809) (-694.844) [-692.228] (-690.791) -- 0:00:12
812500 -- (-693.841) [-694.663] (-694.356) (-696.100) * (-696.748) (-695.673) [-694.948] (-693.702) -- 0:00:12
813000 -- (-694.079) (-694.823) (-692.086) [-693.998] * [-694.824] (-692.994) (-691.627) (-693.552) -- 0:00:12
813500 -- (-693.921) (-697.219) (-695.021) [-695.049] * (-697.215) [-692.174] (-691.646) (-694.644) -- 0:00:12
814000 -- (-693.640) (-696.181) (-694.862) [-691.831] * (-692.708) [-691.082] (-694.001) (-695.421) -- 0:00:12
814500 -- [-697.406] (-694.565) (-692.806) (-691.803) * (-692.936) (-691.428) (-690.644) [-691.632] -- 0:00:12
815000 -- (-697.133) [-693.281] (-691.981) (-691.971) * [-693.277] (-693.047) (-695.308) (-693.145) -- 0:00:12
Average standard deviation of split frequencies: 0.008918
815500 -- (-695.344) [-697.836] (-693.164) (-696.985) * (-692.948) (-691.415) [-697.249] (-694.977) -- 0:00:11
816000 -- (-696.087) (-695.276) (-696.224) [-690.599] * (-693.324) [-692.870] (-695.023) (-692.053) -- 0:00:11
816500 -- (-696.044) (-694.983) (-692.556) [-689.958] * (-696.843) (-691.158) [-692.295] (-693.676) -- 0:00:11
817000 -- (-694.574) (-694.250) (-693.243) [-690.623] * (-692.930) [-694.031] (-691.085) (-694.288) -- 0:00:11
817500 -- (-696.636) (-695.988) [-694.022] (-694.511) * [-693.621] (-690.535) (-691.248) (-694.724) -- 0:00:11
818000 -- (-691.710) (-692.197) (-696.936) [-690.947] * (-694.610) (-691.448) [-691.634] (-693.822) -- 0:00:11
818500 -- (-690.454) (-691.360) (-701.096) [-695.603] * (-695.318) (-693.603) (-689.974) [-696.020] -- 0:00:11
819000 -- (-692.887) (-697.819) (-692.708) [-696.721] * (-694.378) [-694.871] (-693.863) (-693.390) -- 0:00:11
819500 -- [-694.852] (-698.273) (-691.469) (-696.761) * (-693.779) [-690.949] (-693.005) (-692.345) -- 0:00:11
820000 -- (-696.244) [-695.585] (-691.958) (-691.390) * (-694.589) (-695.018) (-693.344) [-691.215] -- 0:00:11
Average standard deviation of split frequencies: 0.008796
820500 -- [-692.429] (-697.494) (-692.775) (-693.395) * (-694.703) (-694.763) [-693.059] (-692.255) -- 0:00:11
821000 -- [-693.253] (-694.238) (-696.408) (-695.606) * (-695.182) [-691.318] (-694.845) (-695.463) -- 0:00:11
821500 -- (-692.133) (-695.492) [-696.248] (-693.199) * [-694.432] (-695.730) (-697.454) (-696.088) -- 0:00:11
822000 -- (-696.042) (-697.894) [-692.887] (-693.392) * (-694.850) (-693.914) [-691.060] (-695.511) -- 0:00:11
822500 -- (-692.595) (-691.263) [-692.338] (-694.219) * (-694.472) (-693.410) (-695.063) [-694.149] -- 0:00:11
823000 -- (-693.656) [-691.112] (-692.789) (-696.056) * (-692.720) (-694.232) [-693.919] (-695.310) -- 0:00:11
823500 -- (-692.316) (-693.584) (-691.634) [-696.752] * (-690.492) [-690.669] (-696.720) (-690.525) -- 0:00:11
824000 -- (-692.657) (-694.550) [-692.125] (-697.257) * (-694.005) (-693.059) (-695.719) [-691.338] -- 0:00:11
824500 -- (-693.050) (-694.798) (-695.365) [-693.453] * (-694.361) (-693.907) [-696.534] (-691.804) -- 0:00:11
825000 -- (-696.428) (-693.417) [-692.449] (-693.081) * (-694.137) (-695.393) (-694.613) [-691.514] -- 0:00:11
Average standard deviation of split frequencies: 0.008953
825500 -- (-692.152) [-695.262] (-696.852) (-693.557) * (-695.018) (-692.467) [-692.320] (-694.263) -- 0:00:11
826000 -- [-695.189] (-697.347) (-693.113) (-693.012) * (-696.282) (-691.787) (-699.662) [-692.726] -- 0:00:11
826500 -- (-694.802) (-691.386) [-693.533] (-693.736) * (-694.366) (-696.366) (-695.555) [-690.140] -- 0:00:11
827000 -- [-692.851] (-692.045) (-693.033) (-697.291) * [-691.179] (-694.920) (-694.158) (-693.992) -- 0:00:11
827500 -- (-691.694) [-693.069] (-695.186) (-690.976) * (-695.400) [-692.852] (-693.023) (-694.362) -- 0:00:11
828000 -- (-693.727) [-697.522] (-693.350) (-691.607) * [-691.451] (-692.983) (-691.595) (-692.255) -- 0:00:11
828500 -- (-697.784) (-696.098) [-695.544] (-694.023) * (-690.978) (-693.953) (-693.707) [-692.505] -- 0:00:11
829000 -- (-693.556) [-689.293] (-697.489) (-694.480) * (-693.088) (-695.916) (-693.485) [-691.504] -- 0:00:11
829500 -- [-692.362] (-692.471) (-694.749) (-693.450) * (-695.577) (-693.355) (-694.278) [-693.329] -- 0:00:11
830000 -- (-695.179) [-694.874] (-694.406) (-691.859) * (-694.402) (-690.836) (-694.559) [-693.647] -- 0:00:11
Average standard deviation of split frequencies: 0.008725
830500 -- (-693.536) [-691.878] (-702.747) (-691.139) * (-695.036) (-690.518) (-694.789) [-691.052] -- 0:00:11
831000 -- (-693.076) (-696.443) (-694.867) [-693.957] * (-701.801) [-695.955] (-695.482) (-690.738) -- 0:00:10
831500 -- (-694.210) (-694.066) (-697.213) [-695.475] * (-695.763) (-690.867) (-697.321) [-690.822] -- 0:00:10
832000 -- (-697.983) [-692.469] (-692.419) (-695.269) * (-694.491) (-692.532) [-693.277] (-694.218) -- 0:00:10
832500 -- (-694.892) (-697.352) (-692.357) [-693.933] * (-694.510) (-693.866) (-693.154) [-689.692] -- 0:00:10
833000 -- (-693.995) (-694.571) [-692.060] (-692.229) * (-691.555) (-692.721) (-695.619) [-691.258] -- 0:00:10
833500 -- (-696.204) (-697.012) (-690.292) [-693.233] * (-695.268) [-694.179] (-694.720) (-690.298) -- 0:00:10
834000 -- (-694.854) (-697.967) [-691.852] (-694.971) * (-693.090) (-694.366) (-698.626) [-692.085] -- 0:00:10
834500 -- (-697.857) (-692.608) [-691.714] (-697.755) * (-691.418) (-696.766) (-700.550) [-692.000] -- 0:00:10
835000 -- (-699.293) [-692.681] (-694.108) (-690.841) * (-692.933) (-692.594) [-693.237] (-693.544) -- 0:00:10
Average standard deviation of split frequencies: 0.008987
835500 -- (-698.332) (-692.901) [-691.989] (-691.615) * (-698.193) [-694.360] (-697.680) (-690.284) -- 0:00:10
836000 -- [-692.519] (-693.227) (-694.589) (-691.457) * [-693.753] (-692.735) (-693.960) (-691.914) -- 0:00:10
836500 -- (-692.812) [-694.924] (-695.680) (-692.348) * (-695.932) (-692.344) (-697.506) [-691.262] -- 0:00:10
837000 -- (-694.484) (-692.798) (-694.189) [-692.124] * (-699.453) [-695.334] (-695.300) (-695.396) -- 0:00:10
837500 -- (-698.700) (-692.000) (-694.738) [-692.060] * (-696.461) (-696.632) [-694.250] (-695.913) -- 0:00:10
838000 -- (-692.614) (-693.825) [-696.002] (-692.466) * (-692.745) (-692.120) [-693.703] (-693.857) -- 0:00:10
838500 -- (-694.496) (-693.077) [-693.160] (-691.976) * (-693.857) (-691.977) [-696.406] (-693.091) -- 0:00:10
839000 -- [-695.735] (-693.843) (-693.126) (-694.028) * (-694.670) [-692.053] (-698.193) (-693.691) -- 0:00:10
839500 -- (-693.526) (-695.066) [-691.828] (-696.551) * [-691.149] (-693.102) (-693.046) (-692.142) -- 0:00:10
840000 -- (-693.804) (-692.753) [-694.209] (-696.595) * (-696.262) [-693.007] (-693.070) (-693.595) -- 0:00:10
Average standard deviation of split frequencies: 0.009042
840500 -- (-696.285) (-694.292) (-696.615) [-695.387] * [-692.146] (-693.144) (-691.982) (-690.802) -- 0:00:10
841000 -- (-696.123) [-691.129] (-695.294) (-692.250) * [-693.947] (-692.326) (-693.848) (-692.617) -- 0:00:10
841500 -- [-692.013] (-691.787) (-695.453) (-692.222) * (-695.455) (-696.526) [-691.918] (-694.723) -- 0:00:10
842000 -- (-697.569) (-696.097) (-699.197) [-698.072] * (-693.882) [-692.224] (-694.883) (-695.391) -- 0:00:10
842500 -- (-696.523) [-695.415] (-693.372) (-696.255) * (-697.974) (-695.185) (-693.673) [-696.419] -- 0:00:10
843000 -- [-693.541] (-695.929) (-692.796) (-693.365) * [-693.253] (-690.273) (-692.121) (-694.772) -- 0:00:10
843500 -- (-694.372) [-692.568] (-697.494) (-692.904) * (-698.439) (-692.031) [-691.194] (-694.881) -- 0:00:10
844000 -- [-691.972] (-692.705) (-693.481) (-693.404) * (-695.073) (-693.098) [-694.346] (-698.700) -- 0:00:10
844500 -- (-695.110) [-696.681] (-693.009) (-698.240) * (-695.651) (-697.540) [-691.276] (-693.813) -- 0:00:10
845000 -- (-693.155) (-691.666) (-692.650) [-699.529] * [-691.839] (-695.166) (-695.752) (-694.520) -- 0:00:10
Average standard deviation of split frequencies: 0.009090
845500 -- (-693.370) (-694.587) [-695.452] (-695.396) * [-692.148] (-695.186) (-692.287) (-694.972) -- 0:00:10
846000 -- (-694.416) (-692.632) [-693.193] (-691.831) * (-694.647) [-696.031] (-690.223) (-694.967) -- 0:00:10
846500 -- (-694.631) (-692.335) (-692.305) [-693.197] * (-692.268) (-694.576) [-695.808] (-692.235) -- 0:00:09
847000 -- [-693.760] (-691.671) (-692.555) (-692.953) * (-693.457) (-691.589) [-694.152] (-690.918) -- 0:00:09
847500 -- (-692.245) (-692.641) [-691.644] (-694.697) * (-692.244) (-693.799) [-694.329] (-693.726) -- 0:00:09
848000 -- (-692.577) (-695.622) (-697.875) [-691.450] * (-692.116) [-698.103] (-694.312) (-692.602) -- 0:00:09
848500 -- [-693.017] (-696.984) (-695.262) (-695.481) * [-693.620] (-694.179) (-694.680) (-692.242) -- 0:00:09
849000 -- (-695.054) [-693.765] (-692.920) (-695.006) * (-691.888) [-693.213] (-692.662) (-695.833) -- 0:00:09
849500 -- (-694.152) (-692.814) (-694.288) [-692.741] * [-692.436] (-693.145) (-695.852) (-692.680) -- 0:00:09
850000 -- (-696.208) (-692.735) (-693.938) [-694.160] * (-691.409) (-694.621) (-695.068) [-694.851] -- 0:00:09
Average standard deviation of split frequencies: 0.009213
850500 -- (-695.527) [-691.528] (-694.594) (-690.999) * (-690.720) [-692.587] (-693.387) (-694.399) -- 0:00:09
851000 -- (-694.066) [-693.217] (-694.838) (-694.691) * (-695.752) [-699.691] (-697.508) (-694.721) -- 0:00:09
851500 -- [-692.609] (-692.118) (-695.375) (-691.067) * (-693.429) (-694.965) (-696.715) [-693.786] -- 0:00:09
852000 -- (-691.598) [-694.889] (-693.621) (-694.251) * (-692.453) (-696.998) (-691.324) [-698.888] -- 0:00:09
852500 -- (-699.408) (-692.303) (-694.952) [-695.061] * (-692.607) [-693.483] (-695.794) (-692.592) -- 0:00:09
853000 -- (-697.011) [-692.045] (-692.510) (-692.610) * (-694.779) (-694.980) (-695.657) [-695.460] -- 0:00:09
853500 -- (-705.441) (-693.640) [-693.426] (-698.279) * (-695.085) [-695.358] (-695.238) (-696.737) -- 0:00:09
854000 -- (-697.023) (-694.346) (-696.007) [-691.207] * (-693.445) (-694.814) (-692.866) [-695.486] -- 0:00:09
854500 -- (-697.301) (-693.552) (-697.012) [-695.963] * (-691.725) (-691.677) (-691.522) [-695.222] -- 0:00:09
855000 -- (-697.919) (-692.022) (-692.042) [-693.959] * (-693.914) [-690.841] (-691.099) (-692.034) -- 0:00:09
Average standard deviation of split frequencies: 0.009121
855500 -- (-692.533) [-692.542] (-694.048) (-692.818) * [-690.881] (-694.718) (-690.223) (-694.093) -- 0:00:09
856000 -- (-693.146) (-692.711) [-695.190] (-694.519) * [-693.467] (-692.708) (-694.554) (-695.012) -- 0:00:09
856500 -- [-696.381] (-692.373) (-697.307) (-693.301) * (-693.268) (-692.810) (-694.007) [-693.203] -- 0:00:09
857000 -- (-694.002) (-696.013) (-693.729) [-694.723] * (-693.700) [-691.638] (-697.712) (-694.020) -- 0:00:09
857500 -- (-691.168) [-693.303] (-693.752) (-693.024) * [-693.205] (-694.671) (-696.940) (-697.049) -- 0:00:09
858000 -- (-694.720) (-696.598) (-694.415) [-693.021] * (-694.012) [-691.150] (-693.378) (-697.232) -- 0:00:09
858500 -- (-691.747) [-693.941] (-696.283) (-698.697) * (-692.925) [-691.453] (-692.833) (-695.041) -- 0:00:09
859000 -- (-690.898) (-693.789) (-694.089) [-694.156] * [-692.863] (-693.283) (-697.953) (-693.515) -- 0:00:09
859500 -- [-692.678] (-698.571) (-697.405) (-693.503) * (-691.303) [-693.116] (-695.359) (-696.572) -- 0:00:09
860000 -- (-690.290) (-698.418) (-704.020) [-694.120] * (-692.650) (-694.964) [-693.264] (-696.076) -- 0:00:09
Average standard deviation of split frequencies: 0.008900
860500 -- (-692.883) (-697.185) [-692.665] (-694.550) * (-691.182) (-693.135) [-691.456] (-694.279) -- 0:00:09
861000 -- (-695.305) (-696.121) (-695.351) [-694.113] * [-692.318] (-694.430) (-695.895) (-694.665) -- 0:00:09
861500 -- (-695.393) (-695.695) [-697.804] (-693.951) * (-693.314) [-692.663] (-694.983) (-696.808) -- 0:00:09
862000 -- [-692.246] (-694.550) (-695.608) (-693.094) * [-692.897] (-698.439) (-692.207) (-693.000) -- 0:00:08
862500 -- (-695.968) [-693.464] (-695.445) (-692.139) * [-691.235] (-693.661) (-693.508) (-695.267) -- 0:00:08
863000 -- [-698.415] (-695.567) (-696.386) (-696.065) * (-691.375) [-691.010] (-691.440) (-694.106) -- 0:00:08
863500 -- (-692.726) (-691.750) [-693.858] (-692.051) * (-692.856) [-691.954] (-696.078) (-698.719) -- 0:00:08
864000 -- [-693.215] (-696.904) (-698.004) (-694.264) * (-692.875) [-694.008] (-695.210) (-693.404) -- 0:00:08
864500 -- [-693.452] (-694.863) (-695.847) (-699.534) * [-694.587] (-693.322) (-694.210) (-698.132) -- 0:00:08
865000 -- (-696.555) (-693.607) (-694.611) [-693.702] * [-699.536] (-693.014) (-694.702) (-692.292) -- 0:00:08
Average standard deviation of split frequencies: 0.009016
865500 -- (-694.108) (-692.623) (-694.836) [-695.027] * (-701.773) (-693.359) [-695.579] (-693.033) -- 0:00:08
866000 -- (-697.466) [-691.751] (-693.296) (-693.431) * (-693.824) [-692.070] (-694.316) (-694.528) -- 0:00:08
866500 -- (-694.018) [-691.221] (-694.564) (-693.782) * (-691.918) (-692.119) (-694.798) [-693.321] -- 0:00:08
867000 -- (-695.601) (-694.846) (-698.886) [-695.188] * [-690.359] (-695.687) (-692.094) (-694.817) -- 0:00:08
867500 -- (-694.272) [-694.900] (-697.807) (-694.475) * [-691.301] (-693.092) (-694.400) (-694.763) -- 0:00:08
868000 -- (-698.426) (-696.301) [-695.575] (-693.630) * (-695.701) (-694.519) [-692.726] (-694.580) -- 0:00:08
868500 -- (-694.772) [-691.788] (-692.122) (-692.769) * (-695.897) (-697.719) [-694.877] (-693.314) -- 0:00:08
869000 -- (-692.047) (-696.232) [-692.193] (-698.883) * (-695.394) [-690.904] (-691.720) (-694.470) -- 0:00:08
869500 -- (-696.360) (-700.727) [-692.172] (-692.190) * (-699.334) (-697.492) [-692.388] (-697.595) -- 0:00:08
870000 -- (-695.216) (-699.763) (-695.142) [-693.235] * (-695.755) (-693.758) [-691.902] (-699.298) -- 0:00:08
Average standard deviation of split frequencies: 0.009035
870500 -- (-692.692) [-698.542] (-694.738) (-691.298) * (-694.518) (-690.278) [-691.644] (-699.843) -- 0:00:08
871000 -- [-691.077] (-695.303) (-697.333) (-695.870) * [-691.807] (-695.326) (-692.096) (-694.338) -- 0:00:08
871500 -- (-697.421) [-691.987] (-692.544) (-694.558) * (-697.106) [-693.925] (-693.238) (-700.015) -- 0:00:08
872000 -- (-698.063) [-693.308] (-694.090) (-691.320) * (-692.494) [-692.502] (-698.449) (-693.128) -- 0:00:08
872500 -- (-694.221) (-695.010) (-695.470) [-691.970] * (-691.990) (-693.061) (-693.378) [-693.678] -- 0:00:08
873000 -- [-694.093] (-700.725) (-694.617) (-690.839) * (-690.352) [-694.510] (-696.923) (-699.321) -- 0:00:08
873500 -- [-694.932] (-700.136) (-694.874) (-694.313) * (-692.868) (-695.419) (-693.181) [-694.679] -- 0:00:08
874000 -- (-697.804) (-698.290) (-693.457) [-691.482] * (-692.883) (-694.198) [-692.592] (-695.379) -- 0:00:08
874500 -- [-694.043] (-692.766) (-699.035) (-696.102) * (-693.980) (-702.530) (-693.166) [-696.484] -- 0:00:08
875000 -- (-694.546) [-694.099] (-695.435) (-694.875) * [-695.932] (-701.242) (-694.803) (-694.885) -- 0:00:08
Average standard deviation of split frequencies: 0.009081
875500 -- (-691.229) (-697.537) (-691.842) [-696.380] * [-693.456] (-690.585) (-694.533) (-694.223) -- 0:00:08
876000 -- (-692.140) (-692.157) [-691.040] (-693.841) * (-693.935) (-694.511) [-694.387] (-693.604) -- 0:00:08
876500 -- (-694.192) (-692.526) [-691.339] (-694.047) * (-695.136) (-694.624) (-692.378) [-695.945] -- 0:00:08
877000 -- (-691.930) (-695.205) (-691.417) [-697.771] * [-697.246] (-695.613) (-692.423) (-696.373) -- 0:00:07
877500 -- (-691.259) (-691.496) [-697.723] (-697.011) * (-692.236) (-696.020) [-691.891] (-694.517) -- 0:00:07
878000 -- (-692.357) [-692.343] (-695.398) (-693.831) * (-693.611) [-693.049] (-694.925) (-692.356) -- 0:00:07
878500 -- (-695.321) (-693.287) [-694.524] (-694.844) * (-691.966) (-695.265) (-692.806) [-692.519] -- 0:00:07
879000 -- [-696.353] (-694.791) (-691.948) (-693.342) * (-695.778) (-694.205) (-690.763) [-693.711] -- 0:00:07
879500 -- (-694.042) (-695.120) [-693.950] (-692.891) * (-694.790) [-696.801] (-693.628) (-694.162) -- 0:00:07
880000 -- [-691.834] (-691.437) (-691.278) (-690.707) * (-697.281) (-697.403) (-693.711) [-693.010] -- 0:00:07
Average standard deviation of split frequencies: 0.009457
880500 -- (-695.494) (-698.221) [-695.977] (-695.777) * (-691.786) (-694.191) (-699.665) [-694.541] -- 0:00:07
881000 -- (-697.097) [-693.280] (-693.262) (-693.269) * (-696.896) (-692.033) [-695.374] (-690.881) -- 0:00:07
881500 -- (-698.940) [-694.940] (-698.934) (-696.142) * (-694.832) [-692.171] (-693.947) (-695.518) -- 0:00:07
882000 -- (-695.736) (-695.603) (-693.211) [-692.644] * (-694.278) [-697.225] (-694.133) (-693.823) -- 0:00:07
882500 -- [-694.542] (-696.338) (-691.744) (-693.568) * (-699.146) (-697.178) [-692.259] (-694.389) -- 0:00:07
883000 -- [-694.540] (-693.277) (-692.227) (-691.992) * (-693.790) [-691.524] (-694.493) (-694.367) -- 0:00:07
883500 -- (-697.040) (-698.241) [-693.002] (-692.390) * (-693.987) (-697.132) [-692.791] (-701.286) -- 0:00:07
884000 -- (-696.778) [-693.388] (-692.841) (-692.557) * (-696.805) [-696.599] (-692.456) (-696.184) -- 0:00:07
884500 -- (-696.622) (-692.952) (-695.705) [-693.201] * [-697.732] (-693.079) (-695.876) (-692.316) -- 0:00:07
885000 -- (-691.384) [-699.936] (-692.646) (-692.014) * (-694.604) [-692.424] (-695.731) (-694.025) -- 0:00:07
Average standard deviation of split frequencies: 0.009151
885500 -- (-693.594) [-693.960] (-693.440) (-691.909) * (-691.035) [-693.477] (-692.131) (-694.022) -- 0:00:07
886000 -- (-693.956) [-693.207] (-691.388) (-692.372) * (-695.512) (-692.537) (-692.060) [-692.387] -- 0:00:07
886500 -- (-694.832) (-696.441) [-690.966] (-694.237) * [-692.252] (-691.597) (-691.004) (-695.590) -- 0:00:07
887000 -- (-693.050) [-692.248] (-692.259) (-690.419) * [-693.883] (-691.308) (-693.384) (-696.776) -- 0:00:07
887500 -- [-694.521] (-693.150) (-691.354) (-692.684) * (-694.230) [-692.516] (-693.915) (-692.948) -- 0:00:07
888000 -- (-693.288) [-692.367] (-693.060) (-694.410) * [-694.685] (-695.339) (-694.897) (-693.243) -- 0:00:07
888500 -- [-693.749] (-692.474) (-696.451) (-693.134) * (-695.854) (-691.282) [-692.772] (-692.039) -- 0:00:07
889000 -- (-696.032) (-693.411) [-695.756] (-691.154) * [-691.267] (-691.839) (-692.324) (-691.410) -- 0:00:07
889500 -- (-694.178) (-696.517) [-695.508] (-694.720) * (-693.861) (-692.526) (-692.438) [-692.475] -- 0:00:07
890000 -- (-694.354) (-697.694) [-692.510] (-694.550) * [-694.796] (-696.289) (-692.640) (-692.236) -- 0:00:07
Average standard deviation of split frequencies: 0.009527
890500 -- (-692.700) (-699.802) [-693.812] (-695.023) * [-693.751] (-694.758) (-695.747) (-692.343) -- 0:00:07
891000 -- (-692.365) (-698.713) [-692.444] (-694.770) * (-696.609) (-695.852) [-691.226] (-693.997) -- 0:00:07
891500 -- (-692.965) [-694.984] (-694.416) (-693.598) * (-692.048) [-694.593] (-693.468) (-693.131) -- 0:00:07
892000 -- (-696.404) (-696.557) [-693.762] (-694.718) * (-694.014) [-692.695] (-693.264) (-690.994) -- 0:00:07
892500 -- [-698.900] (-692.538) (-693.282) (-697.294) * [-694.384] (-693.068) (-692.909) (-696.252) -- 0:00:06
893000 -- (-694.802) (-694.611) [-691.076] (-694.344) * (-693.445) (-691.399) (-691.875) [-691.441] -- 0:00:06
893500 -- (-693.430) (-698.113) [-695.010] (-692.311) * (-699.445) [-692.848] (-690.856) (-690.214) -- 0:00:06
894000 -- (-696.382) [-692.605] (-692.178) (-693.807) * (-696.274) (-698.040) (-696.819) [-692.718] -- 0:00:06
894500 -- (-694.456) [-692.787] (-694.170) (-693.700) * (-695.904) (-693.086) [-693.937] (-693.665) -- 0:00:06
895000 -- (-696.212) (-700.978) [-692.681] (-695.283) * (-696.944) (-694.276) (-694.502) [-695.520] -- 0:00:06
Average standard deviation of split frequencies: 0.009084
895500 -- [-695.387] (-695.745) (-692.843) (-700.594) * (-696.435) (-695.439) (-695.912) [-693.949] -- 0:00:06
896000 -- (-694.409) [-694.279] (-692.912) (-699.625) * (-692.007) (-695.592) [-695.795] (-693.103) -- 0:00:06
896500 -- (-691.394) (-696.590) [-693.929] (-695.787) * (-695.961) (-696.231) (-691.633) [-694.768] -- 0:00:06
897000 -- [-692.535] (-691.602) (-692.096) (-693.970) * (-693.580) (-692.175) (-693.403) [-698.148] -- 0:00:06
897500 -- (-691.542) (-691.100) (-692.387) [-696.690] * (-694.234) (-693.857) [-695.279] (-696.203) -- 0:00:06
898000 -- (-691.739) (-693.778) [-697.133] (-701.712) * (-694.540) [-691.966] (-699.522) (-697.887) -- 0:00:06
898500 -- (-696.034) (-694.183) (-699.862) [-693.854] * [-697.138] (-692.188) (-694.669) (-693.809) -- 0:00:06
899000 -- (-704.255) [-694.398] (-692.670) (-697.256) * (-691.654) (-693.048) (-697.530) [-694.123] -- 0:00:06
899500 -- [-694.524] (-696.646) (-693.662) (-691.766) * (-690.930) (-690.873) [-691.942] (-697.644) -- 0:00:06
900000 -- [-695.623] (-695.683) (-693.787) (-693.955) * (-691.720) [-696.601] (-695.277) (-696.809) -- 0:00:06
Average standard deviation of split frequencies: 0.009282
900500 -- (-696.498) (-691.204) (-696.475) [-696.936] * (-696.007) [-693.185] (-695.361) (-693.899) -- 0:00:06
901000 -- (-691.919) [-692.123] (-693.197) (-693.956) * (-695.314) (-695.072) [-695.482] (-698.292) -- 0:00:06
901500 -- (-694.564) [-691.854] (-692.262) (-695.869) * [-693.051] (-695.935) (-695.696) (-694.449) -- 0:00:06
902000 -- (-691.181) [-695.069] (-694.470) (-693.649) * (-695.032) (-696.140) [-695.337] (-696.230) -- 0:00:06
902500 -- (-692.144) (-696.215) (-692.045) [-691.393] * [-693.396] (-700.062) (-697.848) (-695.467) -- 0:00:06
903000 -- (-694.917) [-691.614] (-692.884) (-693.693) * [-693.895] (-694.758) (-699.644) (-694.658) -- 0:00:06
903500 -- (-693.759) (-690.769) (-691.354) [-697.278] * (-692.865) [-693.413] (-692.088) (-692.277) -- 0:00:06
904000 -- (-690.844) (-693.799) (-695.559) [-693.256] * (-696.863) (-695.526) (-690.668) [-693.101] -- 0:00:06
904500 -- [-692.285] (-695.079) (-695.136) (-691.816) * (-698.704) (-693.002) [-692.521] (-698.829) -- 0:00:06
905000 -- (-693.921) (-696.721) [-693.218] (-696.156) * (-691.668) (-692.493) (-695.770) [-692.059] -- 0:00:06
Average standard deviation of split frequencies: 0.008533
905500 -- [-691.478] (-692.746) (-696.872) (-695.144) * [-692.641] (-696.517) (-693.944) (-692.976) -- 0:00:06
906000 -- (-693.750) (-695.706) [-698.146] (-694.195) * (-693.085) (-695.113) (-694.676) [-697.327] -- 0:00:06
906500 -- (-691.119) [-696.505] (-694.407) (-691.446) * (-693.837) (-693.078) (-694.624) [-692.794] -- 0:00:06
907000 -- [-692.520] (-695.011) (-693.995) (-695.483) * (-692.306) (-696.412) (-703.759) [-692.629] -- 0:00:06
907500 -- (-693.452) (-698.066) [-692.197] (-692.218) * [-691.885] (-697.327) (-696.003) (-691.480) -- 0:00:06
908000 -- (-694.610) (-697.935) (-691.966) [-691.579] * (-694.726) (-698.692) (-696.177) [-694.403] -- 0:00:05
908500 -- (-697.833) (-694.760) (-696.305) [-694.594] * (-696.921) (-694.747) [-692.007] (-695.067) -- 0:00:05
909000 -- (-692.474) [-691.740] (-693.449) (-694.269) * (-695.211) (-694.925) [-694.207] (-694.438) -- 0:00:05
909500 -- [-693.413] (-693.895) (-694.367) (-693.404) * (-695.644) (-697.102) (-692.205) [-691.965] -- 0:00:05
910000 -- (-691.897) (-692.014) [-694.354] (-692.013) * (-694.906) (-695.349) (-692.565) [-691.228] -- 0:00:05
Average standard deviation of split frequencies: 0.008476
910500 -- (-695.869) (-695.772) (-692.987) [-692.729] * [-695.557] (-695.682) (-699.132) (-691.312) -- 0:00:05
911000 -- (-695.586) (-692.569) (-695.626) [-692.176] * (-693.721) (-693.558) [-694.676] (-692.271) -- 0:00:05
911500 -- (-692.872) [-695.661] (-697.708) (-692.319) * (-693.281) [-693.715] (-692.906) (-694.948) -- 0:00:05
912000 -- (-694.365) (-693.234) (-693.464) [-692.869] * (-695.781) [-695.192] (-699.194) (-692.336) -- 0:00:05
912500 -- (-700.324) (-694.223) [-696.662] (-693.669) * (-699.299) (-692.722) (-694.257) [-693.846] -- 0:00:05
913000 -- [-690.443] (-696.498) (-691.752) (-691.921) * (-697.100) (-693.096) (-693.022) [-690.325] -- 0:00:05
913500 -- [-694.826] (-696.561) (-691.486) (-695.494) * (-695.954) [-694.670] (-695.872) (-691.132) -- 0:00:05
914000 -- [-691.815] (-694.096) (-695.838) (-692.830) * (-696.764) (-691.759) (-693.177) [-690.339] -- 0:00:05
914500 -- (-694.937) (-699.633) [-692.485] (-695.902) * (-695.971) (-697.644) (-695.379) [-694.488] -- 0:00:05
915000 -- [-692.314] (-693.514) (-693.009) (-692.542) * (-694.575) [-695.218] (-698.909) (-693.725) -- 0:00:05
Average standard deviation of split frequencies: 0.008749
915500 -- (-696.287) (-698.148) [-691.858] (-694.413) * (-693.899) [-692.454] (-694.827) (-694.042) -- 0:00:05
916000 -- (-692.706) (-694.971) (-693.051) [-692.353] * (-695.862) (-691.264) (-695.734) [-697.800] -- 0:00:05
916500 -- (-693.520) (-696.271) [-694.448] (-693.890) * (-693.306) [-691.977] (-693.484) (-694.649) -- 0:00:05
917000 -- [-691.614] (-692.328) (-696.136) (-693.116) * (-693.214) [-693.769] (-691.129) (-695.782) -- 0:00:05
917500 -- (-693.097) (-693.859) (-694.672) [-693.703] * (-696.592) [-692.510] (-693.762) (-694.003) -- 0:00:05
918000 -- (-692.358) (-693.423) (-695.365) [-697.176] * (-696.953) (-693.773) [-692.643] (-695.210) -- 0:00:05
918500 -- [-692.446] (-692.068) (-700.328) (-695.216) * (-694.208) (-693.233) [-693.800] (-694.346) -- 0:00:05
919000 -- [-693.517] (-693.278) (-703.699) (-694.232) * (-693.103) (-695.693) [-697.984] (-697.240) -- 0:00:05
919500 -- (-691.203) (-696.329) [-699.272] (-694.616) * (-698.697) [-692.280] (-695.860) (-694.283) -- 0:00:05
920000 -- (-696.054) (-693.154) (-693.274) [-693.687] * (-691.927) (-691.825) (-692.902) [-696.427] -- 0:00:05
Average standard deviation of split frequencies: 0.008928
920500 -- (-697.891) (-694.241) [-694.174] (-693.477) * (-698.363) (-690.405) [-694.139] (-694.581) -- 0:00:05
921000 -- (-696.757) [-691.187] (-693.337) (-691.990) * (-696.188) (-691.584) [-696.572] (-694.763) -- 0:00:05
921500 -- (-696.799) (-693.614) [-693.804] (-693.995) * [-693.458] (-691.722) (-692.624) (-694.196) -- 0:00:05
922000 -- (-694.524) (-692.184) (-691.473) [-692.830] * [-693.287] (-693.351) (-691.096) (-691.680) -- 0:00:05
922500 -- [-697.549] (-697.005) (-694.539) (-690.132) * (-691.929) (-694.663) (-697.124) [-692.773] -- 0:00:05
923000 -- (-693.570) [-692.004] (-693.255) (-693.262) * (-693.199) (-694.623) (-696.111) [-695.082] -- 0:00:05
923500 -- (-693.568) [-691.978] (-695.197) (-692.538) * [-697.353] (-693.349) (-697.378) (-693.720) -- 0:00:04
924000 -- (-693.020) [-693.676] (-690.769) (-697.861) * [-696.918] (-694.606) (-695.604) (-693.615) -- 0:00:04
924500 -- (-693.358) (-709.517) [-692.345] (-694.091) * (-696.676) (-697.391) (-698.752) [-693.982] -- 0:00:04
925000 -- [-692.307] (-698.640) (-696.398) (-696.093) * [-693.803] (-693.502) (-695.239) (-693.608) -- 0:00:04
Average standard deviation of split frequencies: 0.008559
925500 -- (-696.266) (-693.853) (-691.612) [-694.658] * (-704.530) [-692.399] (-693.775) (-695.275) -- 0:00:04
926000 -- (-694.141) [-693.386] (-691.508) (-692.946) * (-695.415) [-691.914] (-696.915) (-691.381) -- 0:00:04
926500 -- (-696.050) [-694.257] (-695.538) (-691.387) * (-693.892) (-692.626) (-694.296) [-690.874] -- 0:00:04
927000 -- (-693.620) [-695.571] (-692.534) (-693.739) * [-695.467] (-693.117) (-696.223) (-692.375) -- 0:00:04
927500 -- (-695.846) (-694.208) [-693.383] (-693.888) * (-695.867) [-693.090] (-693.781) (-693.927) -- 0:00:04
928000 -- (-690.835) [-693.920] (-698.815) (-698.361) * (-694.135) (-696.874) [-691.698] (-692.710) -- 0:00:04
928500 -- (-692.058) [-696.597] (-691.392) (-693.127) * (-696.822) (-698.972) [-693.586] (-693.237) -- 0:00:04
929000 -- (-693.494) [-697.048] (-696.416) (-696.260) * (-696.972) (-698.687) (-696.933) [-695.119] -- 0:00:04
929500 -- (-692.466) (-696.376) (-695.194) [-696.264] * (-693.600) [-692.498] (-692.999) (-691.909) -- 0:00:04
930000 -- [-691.899] (-693.249) (-693.178) (-694.573) * (-691.478) [-693.111] (-696.001) (-693.277) -- 0:00:04
Average standard deviation of split frequencies: 0.008442
930500 -- (-694.650) [-689.980] (-696.144) (-691.372) * (-693.129) (-691.885) (-698.086) [-692.107] -- 0:00:04
931000 -- [-694.414] (-692.585) (-693.662) (-693.760) * (-692.058) (-692.949) (-695.011) [-694.742] -- 0:00:04
931500 -- (-691.760) [-691.628] (-695.374) (-694.677) * (-692.623) [-692.523] (-693.902) (-695.271) -- 0:00:04
932000 -- (-690.932) (-692.028) (-695.427) [-689.696] * (-696.199) (-694.108) [-693.214] (-694.857) -- 0:00:04
932500 -- (-692.963) (-692.762) [-692.607] (-693.943) * [-692.142] (-696.016) (-692.094) (-693.722) -- 0:00:04
933000 -- (-693.012) (-697.705) (-693.342) [-690.980] * (-696.467) (-696.070) [-691.336] (-696.249) -- 0:00:04
933500 -- (-696.637) (-693.169) [-692.217] (-692.433) * (-693.080) (-694.904) (-693.838) [-693.437] -- 0:00:04
934000 -- (-695.571) (-696.804) (-695.907) [-692.413] * (-696.698) (-694.261) [-693.980] (-692.430) -- 0:00:04
934500 -- (-692.983) (-695.912) (-694.833) [-690.912] * (-692.129) (-698.509) [-692.746] (-693.849) -- 0:00:04
935000 -- (-693.984) [-693.954] (-692.707) (-696.949) * (-693.247) (-692.329) (-695.210) [-691.846] -- 0:00:04
Average standard deviation of split frequencies: 0.008730
935500 -- (-696.087) [-693.241] (-692.174) (-693.442) * (-697.180) (-692.767) [-690.985] (-694.633) -- 0:00:04
936000 -- (-696.868) [-692.635] (-692.972) (-693.935) * [-693.104] (-695.672) (-695.533) (-695.886) -- 0:00:04
936500 -- [-693.347] (-692.212) (-692.434) (-697.706) * (-693.319) (-694.640) (-695.540) [-691.379] -- 0:00:04
937000 -- (-696.526) (-692.978) [-694.428] (-695.075) * (-696.092) (-694.677) (-690.109) [-692.144] -- 0:00:04
937500 -- [-692.052] (-692.766) (-695.762) (-695.007) * (-695.617) (-695.240) [-690.531] (-693.459) -- 0:00:04
938000 -- (-692.617) (-691.440) (-691.761) [-693.456] * (-692.725) [-696.541] (-694.724) (-693.748) -- 0:00:04
938500 -- (-693.374) (-695.415) (-693.329) [-695.179] * (-693.639) (-693.366) [-691.370] (-692.985) -- 0:00:03
939000 -- (-692.381) (-696.034) (-691.950) [-692.329] * (-692.084) (-695.379) [-695.736] (-694.314) -- 0:00:03
939500 -- [-695.864] (-693.875) (-696.342) (-693.545) * [-693.923] (-696.300) (-694.055) (-692.423) -- 0:00:03
940000 -- [-692.746] (-692.320) (-693.784) (-693.343) * [-693.894] (-694.458) (-693.306) (-694.752) -- 0:00:03
Average standard deviation of split frequencies: 0.008352
940500 -- (-696.296) (-694.868) (-693.998) [-693.847] * (-692.381) (-695.745) [-693.838] (-695.420) -- 0:00:03
941000 -- (-694.466) (-691.624) [-690.587] (-693.941) * (-692.801) (-697.398) (-694.568) [-693.867] -- 0:00:03
941500 -- (-695.416) (-695.885) [-693.961] (-692.382) * (-691.121) (-696.313) (-696.150) [-692.228] -- 0:00:03
942000 -- (-694.859) (-695.450) [-694.707] (-695.817) * (-691.901) (-697.718) [-692.182] (-693.131) -- 0:00:03
942500 -- (-694.453) (-692.764) (-696.118) [-700.675] * (-693.090) (-697.208) (-692.410) [-695.282] -- 0:00:03
943000 -- (-706.756) (-694.927) [-691.703] (-693.700) * (-693.194) (-694.085) (-694.339) [-694.823] -- 0:00:03
943500 -- (-702.832) (-694.387) (-695.728) [-694.136] * (-692.147) [-696.106] (-692.157) (-696.732) -- 0:00:03
944000 -- [-697.250] (-694.831) (-696.694) (-694.279) * (-691.732) [-693.740] (-694.653) (-691.839) -- 0:00:03
944500 -- [-697.536] (-692.992) (-694.381) (-696.378) * (-695.281) (-696.019) (-692.720) [-694.243] -- 0:00:03
945000 -- (-695.559) (-696.410) [-695.813] (-694.198) * (-693.802) (-695.649) [-695.297] (-693.234) -- 0:00:03
Average standard deviation of split frequencies: 0.008338
945500 -- (-696.062) [-693.022] (-695.085) (-693.871) * (-691.327) (-695.717) [-692.222] (-695.910) -- 0:00:03
946000 -- [-693.547] (-693.709) (-692.650) (-695.013) * [-695.294] (-699.095) (-694.175) (-692.481) -- 0:00:03
946500 -- (-696.444) (-691.171) (-699.167) [-692.599] * (-691.938) [-697.804] (-691.591) (-693.810) -- 0:00:03
947000 -- [-694.086] (-691.561) (-695.887) (-692.862) * [-693.972] (-695.559) (-693.133) (-697.334) -- 0:00:03
947500 -- (-695.748) [-694.272] (-691.129) (-695.773) * (-692.867) (-693.488) [-691.102] (-692.439) -- 0:00:03
948000 -- [-694.274] (-694.745) (-694.925) (-697.428) * (-694.789) [-696.069] (-692.655) (-691.364) -- 0:00:03
948500 -- [-691.332] (-693.139) (-691.329) (-700.019) * (-694.830) (-696.244) (-694.237) [-691.685] -- 0:00:03
949000 -- [-693.578] (-694.665) (-693.711) (-693.619) * (-693.173) [-694.838] (-692.547) (-695.368) -- 0:00:03
949500 -- [-692.139] (-692.649) (-690.139) (-693.301) * (-696.539) (-695.800) (-691.593) [-692.667] -- 0:00:03
950000 -- (-697.301) [-691.052] (-690.793) (-694.187) * [-696.413] (-691.671) (-699.249) (-694.123) -- 0:00:03
Average standard deviation of split frequencies: 0.008231
950500 -- (-693.849) [-692.821] (-693.588) (-694.963) * [-695.839] (-694.098) (-693.786) (-698.390) -- 0:00:03
951000 -- (-691.975) [-691.140] (-694.738) (-696.612) * (-694.451) (-691.386) [-696.172] (-693.932) -- 0:00:03
951500 -- (-692.466) [-694.509] (-693.969) (-692.799) * (-693.550) (-695.802) [-691.778] (-698.501) -- 0:00:03
952000 -- [-692.287] (-699.230) (-693.902) (-693.260) * (-695.909) (-695.264) (-692.001) [-692.453] -- 0:00:03
952500 -- (-696.283) (-693.233) (-691.439) [-692.203] * (-694.118) (-690.953) [-691.490] (-694.757) -- 0:00:03
953000 -- (-694.315) (-694.038) [-693.635] (-693.441) * (-693.663) (-693.706) [-696.137] (-693.071) -- 0:00:03
953500 -- (-694.432) (-696.217) (-692.520) [-696.064] * (-694.318) (-694.267) (-694.371) [-691.655] -- 0:00:03
954000 -- (-699.182) [-695.805] (-692.597) (-695.327) * (-693.436) (-702.599) (-694.492) [-698.715] -- 0:00:02
954500 -- (-695.295) (-696.130) [-691.233] (-692.311) * (-692.503) (-698.089) [-694.222] (-691.320) -- 0:00:02
955000 -- [-692.010] (-696.654) (-690.344) (-694.727) * (-692.843) (-696.131) (-690.431) [-692.695] -- 0:00:02
Average standard deviation of split frequencies: 0.008383
955500 -- (-692.495) (-694.432) [-694.135] (-693.764) * (-692.665) [-694.670] (-692.650) (-693.388) -- 0:00:02
956000 -- (-694.664) (-694.896) (-694.396) [-693.290] * (-693.758) (-694.915) [-690.864] (-695.426) -- 0:00:02
956500 -- (-692.547) (-693.535) [-694.063] (-695.561) * (-692.674) [-694.195] (-694.714) (-696.476) -- 0:00:02
957000 -- (-697.054) (-697.536) [-692.361] (-692.602) * (-697.738) (-693.415) (-693.143) [-691.011] -- 0:00:02
957500 -- (-694.476) [-693.508] (-694.651) (-692.842) * (-693.477) [-691.662] (-696.644) (-690.651) -- 0:00:02
958000 -- (-692.789) [-692.180] (-695.873) (-693.838) * (-692.913) (-691.992) [-695.593] (-691.888) -- 0:00:02
958500 -- (-694.360) [-693.860] (-691.872) (-692.052) * [-691.939] (-695.002) (-693.279) (-691.668) -- 0:00:02
959000 -- [-694.375] (-695.183) (-697.727) (-694.372) * (-694.481) (-692.281) (-701.179) [-692.148] -- 0:00:02
959500 -- [-693.594] (-695.281) (-694.779) (-691.470) * (-691.765) (-694.448) (-691.353) [-694.802] -- 0:00:02
960000 -- (-695.227) [-695.847] (-696.301) (-694.920) * (-698.072) (-692.696) (-695.063) [-692.324] -- 0:00:02
Average standard deviation of split frequencies: 0.008506
960500 -- [-693.245] (-693.617) (-693.148) (-695.095) * (-696.314) [-692.977] (-693.749) (-694.499) -- 0:00:02
961000 -- [-695.250] (-691.112) (-695.572) (-696.240) * (-695.289) (-691.728) (-695.619) [-691.777] -- 0:00:02
961500 -- [-692.339] (-690.840) (-694.664) (-693.997) * [-695.700] (-694.438) (-692.469) (-693.241) -- 0:00:02
962000 -- [-695.569] (-691.980) (-695.764) (-693.218) * [-693.746] (-692.519) (-696.013) (-691.090) -- 0:00:02
962500 -- (-691.068) [-693.565] (-697.550) (-697.581) * (-697.713) [-695.467] (-693.479) (-691.469) -- 0:00:02
963000 -- (-692.092) (-696.403) (-699.492) [-693.595] * [-692.510] (-700.857) (-692.343) (-693.461) -- 0:00:02
963500 -- (-692.718) [-694.187] (-694.230) (-695.446) * (-692.514) (-693.128) [-694.992] (-695.540) -- 0:00:02
964000 -- [-691.071] (-692.823) (-693.726) (-692.441) * [-697.184] (-694.034) (-692.504) (-696.709) -- 0:00:02
964500 -- (-693.851) [-694.653] (-691.298) (-692.532) * (-693.873) (-694.429) [-692.584] (-692.156) -- 0:00:02
965000 -- (-693.020) (-692.862) [-691.718] (-695.295) * [-691.719] (-695.530) (-692.648) (-693.966) -- 0:00:02
Average standard deviation of split frequencies: 0.008166
965500 -- (-695.380) [-692.663] (-693.253) (-694.320) * [-692.157] (-697.248) (-692.264) (-694.048) -- 0:00:02
966000 -- (-697.459) (-695.016) (-695.217) [-696.592] * (-692.433) (-693.819) (-692.743) [-694.450] -- 0:00:02
966500 -- (-693.083) [-696.390] (-693.349) (-694.944) * (-694.316) (-694.305) [-693.310] (-694.273) -- 0:00:02
967000 -- (-696.015) (-692.343) (-694.813) [-695.327] * [-691.730] (-695.421) (-692.020) (-695.061) -- 0:00:02
967500 -- (-694.286) [-692.249] (-695.376) (-696.796) * (-694.435) (-693.810) [-691.954] (-696.058) -- 0:00:02
968000 -- (-692.622) [-691.161] (-695.825) (-695.366) * (-692.894) (-695.580) (-692.153) [-691.718] -- 0:00:02
968500 -- (-694.876) [-693.859] (-696.550) (-697.023) * (-692.839) (-693.078) [-693.609] (-695.396) -- 0:00:02
969000 -- [-691.427] (-694.612) (-694.943) (-694.463) * [-695.193] (-698.589) (-695.551) (-695.066) -- 0:00:02
969500 -- [-691.844] (-694.012) (-698.766) (-697.713) * (-695.027) (-693.703) (-698.972) [-691.697] -- 0:00:01
970000 -- [-692.315] (-694.288) (-696.758) (-697.191) * (-695.146) (-693.477) [-694.931] (-694.276) -- 0:00:01
Average standard deviation of split frequencies: 0.007900
970500 -- (-691.406) [-692.764] (-696.605) (-695.043) * (-691.479) (-698.903) [-692.740] (-693.907) -- 0:00:01
971000 -- (-695.395) (-693.229) [-692.340] (-695.118) * (-693.454) (-696.347) (-693.053) [-693.378] -- 0:00:01
971500 -- (-696.037) [-692.730] (-691.667) (-693.540) * [-692.441] (-696.329) (-695.749) (-692.426) -- 0:00:01
972000 -- (-692.176) (-695.218) [-694.825] (-695.755) * (-693.246) (-696.297) [-695.722] (-699.460) -- 0:00:01
972500 -- (-691.441) (-692.150) [-694.375] (-695.971) * [-693.819] (-691.840) (-694.381) (-698.723) -- 0:00:01
973000 -- (-692.970) (-695.455) (-693.347) [-696.801] * [-692.191] (-694.907) (-694.216) (-699.400) -- 0:00:01
973500 -- [-693.416] (-693.498) (-694.845) (-699.272) * (-694.017) (-694.841) (-692.729) [-695.504] -- 0:00:01
974000 -- (-692.405) [-691.760] (-693.307) (-695.340) * [-694.386] (-692.341) (-696.396) (-692.199) -- 0:00:01
974500 -- (-696.882) (-691.411) (-691.314) [-692.004] * (-693.879) (-693.293) [-696.556] (-696.603) -- 0:00:01
975000 -- (-694.620) (-698.520) [-692.010] (-694.360) * (-690.907) (-695.082) [-692.719] (-693.268) -- 0:00:01
Average standard deviation of split frequencies: 0.007825
975500 -- (-695.200) (-696.029) [-695.479] (-694.509) * (-693.730) (-691.550) (-692.333) [-695.399] -- 0:00:01
976000 -- (-695.749) (-692.220) (-692.306) [-691.701] * (-690.899) (-694.343) [-692.398] (-695.069) -- 0:00:01
976500 -- (-694.674) (-693.490) (-691.869) [-695.515] * (-694.253) (-698.734) [-693.109] (-695.529) -- 0:00:01
977000 -- (-695.559) (-695.271) (-692.564) [-696.862] * (-691.156) [-694.732] (-694.027) (-696.205) -- 0:00:01
977500 -- (-696.269) [-693.437] (-692.311) (-696.283) * (-694.267) (-694.859) (-693.165) [-692.194] -- 0:00:01
978000 -- (-691.504) [-693.827] (-694.899) (-698.652) * (-693.825) (-692.734) [-696.238] (-693.731) -- 0:00:01
978500 -- [-692.599] (-693.296) (-694.374) (-697.843) * [-693.228] (-697.178) (-695.703) (-696.396) -- 0:00:01
979000 -- (-695.789) (-693.706) (-693.024) [-694.454] * [-695.954] (-691.093) (-693.021) (-695.071) -- 0:00:01
979500 -- (-697.346) (-694.100) [-694.797] (-691.813) * (-696.404) (-692.709) (-693.042) [-693.698] -- 0:00:01
980000 -- (-698.542) [-698.043] (-693.294) (-695.540) * [-692.785] (-690.466) (-691.329) (-692.270) -- 0:00:01
Average standard deviation of split frequencies: 0.007851
980500 -- [-692.914] (-692.689) (-694.511) (-696.379) * (-692.417) (-694.469) (-701.028) [-694.560] -- 0:00:01
981000 -- (-693.953) (-692.240) (-695.157) [-694.360] * (-694.202) (-691.224) [-691.907] (-697.143) -- 0:00:01
981500 -- (-695.629) (-694.714) (-692.091) [-692.711] * [-696.204] (-694.182) (-697.064) (-691.708) -- 0:00:01
982000 -- [-693.935] (-694.430) (-690.846) (-693.955) * (-695.692) (-695.233) (-695.272) [-691.754] -- 0:00:01
982500 -- (-693.312) (-694.389) (-693.833) [-692.042] * (-699.697) [-695.309] (-698.072) (-695.128) -- 0:00:01
983000 -- (-696.598) (-696.741) [-693.891] (-695.834) * (-696.233) [-691.176] (-694.343) (-696.611) -- 0:00:01
983500 -- [-691.810] (-694.826) (-693.330) (-694.993) * [-695.243] (-690.103) (-693.666) (-694.099) -- 0:00:01
984000 -- (-695.510) (-695.797) (-693.863) [-692.981] * (-695.902) (-691.537) (-696.129) [-695.986] -- 0:00:01
984500 -- [-693.103] (-693.194) (-695.638) (-692.210) * (-697.290) (-692.590) (-691.723) [-697.036] -- 0:00:01
985000 -- (-693.082) [-692.555] (-695.694) (-693.754) * (-694.213) (-690.534) [-692.685] (-693.242) -- 0:00:00
Average standard deviation of split frequencies: 0.007745
985500 -- (-696.679) [-694.002] (-695.074) (-692.271) * (-697.168) (-695.279) [-693.416] (-694.953) -- 0:00:00
986000 -- [-694.815] (-693.580) (-694.544) (-695.975) * [-692.297] (-694.022) (-694.041) (-691.750) -- 0:00:00
986500 -- (-695.096) (-697.308) [-694.227] (-692.939) * [-692.421] (-690.963) (-695.060) (-692.926) -- 0:00:00
987000 -- [-693.804] (-698.336) (-692.541) (-693.450) * (-695.242) (-691.888) (-694.913) [-691.587] -- 0:00:00
987500 -- (-695.302) [-694.354] (-695.525) (-697.117) * [-693.719] (-690.662) (-692.750) (-696.867) -- 0:00:00
988000 -- [-691.674] (-693.735) (-694.463) (-691.999) * [-698.073] (-692.543) (-695.983) (-694.096) -- 0:00:00
988500 -- [-691.684] (-691.480) (-693.274) (-692.294) * (-693.815) (-694.130) (-701.018) [-692.570] -- 0:00:00
989000 -- (-692.900) (-692.055) (-696.533) [-693.403] * (-697.807) (-695.128) (-697.580) [-691.517] -- 0:00:00
989500 -- (-694.630) (-692.366) [-693.453] (-693.886) * (-696.208) (-696.409) [-692.162] (-694.807) -- 0:00:00
990000 -- (-695.167) (-693.108) (-694.477) [-704.994] * (-695.858) [-691.685] (-695.007) (-693.114) -- 0:00:00
Average standard deviation of split frequencies: 0.007645
990500 -- [-693.340] (-691.917) (-691.757) (-694.907) * (-695.833) [-693.569] (-693.703) (-695.686) -- 0:00:00
991000 -- (-694.028) [-693.000] (-697.621) (-695.697) * (-694.364) (-692.381) [-692.592] (-691.903) -- 0:00:00
991500 -- [-691.776] (-692.710) (-695.108) (-694.305) * (-697.567) [-692.241] (-695.800) (-690.533) -- 0:00:00
992000 -- (-695.814) (-692.806) (-696.522) [-692.646] * (-694.727) (-693.313) [-690.374] (-696.194) -- 0:00:00
992500 -- (-692.745) (-696.238) [-694.047] (-692.875) * [-693.090] (-693.110) (-696.413) (-695.532) -- 0:00:00
993000 -- [-694.930] (-695.947) (-696.854) (-692.974) * (-694.711) (-694.552) [-694.921] (-693.096) -- 0:00:00
993500 -- (-692.047) [-697.390] (-695.840) (-691.269) * (-697.349) [-692.006] (-694.172) (-693.368) -- 0:00:00
994000 -- (-693.716) (-698.848) (-694.726) [-695.108] * (-696.191) [-694.497] (-695.180) (-694.708) -- 0:00:00
994500 -- [-693.871] (-695.213) (-693.914) (-693.494) * (-690.709) (-694.999) (-703.136) [-691.985] -- 0:00:00
995000 -- (-694.637) (-693.831) (-695.862) [-693.481] * (-692.963) (-695.438) [-691.520] (-692.458) -- 0:00:00
Average standard deviation of split frequencies: 0.007667
995500 -- [-692.939] (-694.580) (-695.486) (-694.309) * (-691.957) [-693.870] (-697.123) (-693.270) -- 0:00:00
996000 -- (-695.619) [-691.229] (-697.126) (-695.188) * (-695.001) [-694.858] (-696.977) (-693.211) -- 0:00:00
996500 -- [-690.826] (-694.592) (-694.460) (-694.064) * (-692.266) (-694.860) (-693.779) [-693.484] -- 0:00:00
997000 -- (-693.363) (-692.573) (-694.319) [-696.157] * (-698.666) (-692.607) [-696.606] (-691.859) -- 0:00:00
997500 -- [-691.238] (-697.917) (-690.825) (-693.870) * (-700.344) (-694.583) [-694.432] (-694.438) -- 0:00:00
998000 -- (-692.108) (-696.987) [-695.234] (-693.216) * (-697.639) [-692.997] (-691.885) (-694.293) -- 0:00:00
998500 -- [-691.075] (-693.216) (-694.982) (-692.015) * (-693.479) [-692.257] (-691.989) (-692.858) -- 0:00:00
999000 -- (-692.684) [-691.327] (-693.153) (-691.954) * [-693.196] (-694.615) (-694.484) (-694.223) -- 0:00:00
999500 -- (-692.537) [-692.090] (-698.169) (-691.710) * (-692.461) (-692.024) (-694.475) [-691.812] -- 0:00:00
1000000 -- (-695.961) (-694.976) (-694.641) [-695.338] * (-691.776) (-695.825) (-694.356) [-692.214] -- 0:00:00
Average standard deviation of split frequencies: 0.007714
Analysis completed in 1 mins 5 seconds
Analysis used 63.94 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -688.94
Likelihood of best state for "cold" chain of run 2 was -688.63
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 79 %) Dirichlet(Revmat{all})
97.8 % ( 95 %) Slider(Revmat{all})
31.7 % ( 26 %) Dirichlet(Pi{all})
32.7 % ( 26 %) Slider(Pi{all})
62.0 % ( 35 %) Multiplier(Alpha{1,2})
79.1 % ( 64 %) Multiplier(Alpha{3})
26.5 % ( 29 %) Slider(Pinvar{all})
97.4 % ( 97 %) ExtSPR(Tau{all},V{all})
69.0 % ( 72 %) ExtTBR(Tau{all},V{all})
98.4 % (100 %) NNI(Tau{all},V{all})
88.0 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
93.9 % ( 94 %) Nodeslider(V{all})
30.3 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.3 % ( 70 %) Dirichlet(Revmat{all})
97.9 % ( 98 %) Slider(Revmat{all})
31.2 % ( 20 %) Dirichlet(Pi{all})
32.8 % ( 21 %) Slider(Pi{all})
61.2 % ( 39 %) Multiplier(Alpha{1,2})
79.2 % ( 54 %) Multiplier(Alpha{3})
27.3 % ( 29 %) Slider(Pinvar{all})
97.4 % (100 %) ExtSPR(Tau{all},V{all})
69.3 % ( 74 %) ExtTBR(Tau{all},V{all})
98.4 % (100 %) NNI(Tau{all},V{all})
88.2 % ( 85 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
93.9 % ( 94 %) Nodeslider(V{all})
30.7 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166636 0.82 0.66
3 | 166233 166727 0.83
4 | 167128 166727 166549
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166973 0.82 0.66
3 | 167010 167235 0.83
4 | 166431 166336 166015
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -692.46
| 2 2 |
| 2 1 |
| 1 1 2 2 |
| 2 2 2 2 |
| 2211 22 2 2 1 2 2 2|
|1 1 1 2 1 12 1 1 1 22 1 1 1 |
| 1 2 * 2 1* 1 1 2 11 21 1 |
|21 2 21 21 1 12 221 11 2 |
| 1 2 2 211 2 2 * 1 21 1 1 22 221|
| 22 1 1 21 1 2 1 2 1 |
| 2 11 2 1 2 2 2 1 |
| 11 2 11 2 |
| 1 |
| |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -694.73
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -692.34 -697.87
2 -692.33 -696.53
--------------------------------------
TOTAL -692.34 -697.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.863616 0.087519 0.373989 1.484248 0.841070 1380.37 1440.68 1.000
r(A<->C){all} 0.168400 0.018747 0.000045 0.435323 0.134791 303.57 331.43 1.000
r(A<->G){all} 0.169294 0.021530 0.000120 0.470548 0.126976 183.29 218.93 1.004
r(A<->T){all} 0.133047 0.015185 0.000074 0.382133 0.096839 167.02 225.97 1.008
r(C<->G){all} 0.181319 0.021406 0.000072 0.471646 0.145929 214.86 225.31 1.011
r(C<->T){all} 0.130328 0.013976 0.000021 0.367920 0.097093 247.87 261.01 1.000
r(G<->T){all} 0.217613 0.024577 0.000426 0.529423 0.182453 164.21 201.79 1.004
pi(A){all} 0.235690 0.000352 0.201253 0.273276 0.235708 1010.30 1237.51 1.000
pi(C){all} 0.284092 0.000412 0.245927 0.325404 0.283466 1268.80 1341.40 1.000
pi(G){all} 0.290608 0.000399 0.250500 0.328380 0.290697 1057.12 1279.06 1.000
pi(T){all} 0.189610 0.000313 0.152821 0.221852 0.189100 1274.04 1353.65 1.000
alpha{1,2} 0.233803 0.057797 0.003509 0.628750 0.169601 1267.42 1384.21 1.000
alpha{3} 0.391240 0.209067 0.000150 1.351097 0.219084 1152.88 1260.69 1.000
pinvar{all} 0.992443 0.000039 0.981274 0.999766 0.993970 1442.90 1459.93 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..****
8 -- ..**..
9 -- .**...
10 -- ....**
11 -- .*.*..
12 -- .*..*.
13 -- .**.**
14 -- ..*..*
15 -- ...*.*
16 -- .****.
17 -- ...**.
18 -- .*.***
19 -- .***.*
20 -- .*...*
21 -- ..*.*.
22 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 448 0.149234 0.003769 0.146569 0.151899 2
8 446 0.148568 0.001884 0.147235 0.149900 2
9 445 0.148235 0.006124 0.143904 0.152565 2
10 438 0.145903 0.017901 0.133245 0.158561 2
11 438 0.145903 0.004711 0.142572 0.149234 2
12 438 0.145903 0.005653 0.141905 0.149900 2
13 430 0.143238 0.007537 0.137908 0.148568 2
14 426 0.141905 0.015075 0.131246 0.152565 2
15 425 0.141572 0.000471 0.141239 0.141905 2
16 420 0.139907 0.000000 0.139907 0.139907 2
17 418 0.139241 0.006595 0.134577 0.143904 2
18 417 0.138907 0.012719 0.129913 0.147901 2
19 406 0.135243 0.011306 0.127249 0.143238 2
20 400 0.133245 0.002827 0.131246 0.135243 2
21 397 0.132245 0.017430 0.119920 0.144570 2
22 284 0.094604 0.009422 0.087941 0.101266 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.085191 0.007981 0.000030 0.264682 0.056226 1.000 2
length{all}[2] 0.085299 0.008057 0.000006 0.265195 0.057047 1.000 2
length{all}[3] 0.086500 0.008345 0.000042 0.265726 0.057127 1.000 2
length{all}[4] 0.087163 0.008090 0.000003 0.263280 0.057715 1.000 2
length{all}[5] 0.087884 0.008018 0.000009 0.271487 0.060220 1.000 2
length{all}[6] 0.165594 0.016876 0.000322 0.410774 0.135028 1.001 2
length{all}[7] 0.083159 0.007003 0.000187 0.258799 0.055848 0.998 2
length{all}[8] 0.091457 0.008628 0.000261 0.272564 0.060507 1.011 2
length{all}[9] 0.082992 0.007150 0.000386 0.258999 0.060045 1.008 2
length{all}[10] 0.085558 0.007395 0.000404 0.244370 0.058713 0.998 2
length{all}[11] 0.083525 0.006255 0.000142 0.242017 0.059010 0.999 2
length{all}[12] 0.092320 0.008170 0.000082 0.269279 0.064201 0.999 2
length{all}[13] 0.086832 0.006849 0.000273 0.248631 0.059895 0.998 2
length{all}[14] 0.087901 0.006421 0.000007 0.261365 0.063190 0.998 2
length{all}[15] 0.091564 0.009425 0.000177 0.275648 0.061187 0.999 2
length{all}[16] 0.090187 0.009193 0.000137 0.276310 0.060999 0.999 2
length{all}[17] 0.089850 0.008352 0.000631 0.273205 0.062814 0.998 2
length{all}[18] 0.094241 0.011297 0.000224 0.285467 0.063489 1.000 2
length{all}[19] 0.091182 0.008358 0.000006 0.284186 0.059767 1.003 2
length{all}[20] 0.096548 0.009356 0.000228 0.310208 0.070667 0.998 2
length{all}[21] 0.093896 0.007146 0.000103 0.267139 0.063446 1.001 2
length{all}[22] 0.083839 0.006648 0.000775 0.245944 0.057602 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007714
Maximum standard deviation of split frequencies = 0.017901
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------ C1 (1)
|
|------------------------------ C2 (2)
|
|------------------------------ C3 (3)
+
|------------------------------- C4 (4)
|
|-------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 495
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 165 / 165 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 165 / 165 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.034842 0.042348 0.067849 0.052449 0.035000 0.051461 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -713.308215
Iterating by ming2
Initial: fx= 713.308215
x= 0.03484 0.04235 0.06785 0.05245 0.03500 0.05146 0.30000 1.30000
1 h-m-p 0.0000 0.0002 391.7619 +++ 680.792285 m 0.0002 14 | 1/8
2 h-m-p 0.0000 0.0000 2916.3119 ++ 680.685841 m 0.0000 25 | 2/8
3 h-m-p 0.0000 0.0001 138.0482 ++ 676.853406 m 0.0001 36 | 3/8
4 h-m-p 0.0000 0.0001 155.9903 ++ 673.446330 m 0.0001 47 | 4/8
5 h-m-p 0.0000 0.0000 822.5887 ++ 670.687330 m 0.0000 58 | 5/8
6 h-m-p 0.0113 0.4931 0.7139 ++YCYYCCC 669.902857 6 0.3189 81 | 5/8
7 h-m-p 0.0596 0.2981 0.4717 ++ 669.838162 m 0.2981 95 | 6/8
8 h-m-p 0.0776 8.0000 0.4539 ++CYC 669.808562 2 1.1106 114 | 6/8
9 h-m-p 0.9589 8.0000 0.5257 YCCC 669.756654 3 2.1904 132 | 6/8
10 h-m-p 1.6000 8.0000 0.5040 YCCC 669.730851 3 2.8181 150 | 6/8
11 h-m-p 1.6000 8.0000 0.7415 YC 669.708882 1 3.4022 164 | 6/8
12 h-m-p 1.6000 8.0000 1.0402 YCCC 669.696592 3 3.1278 182 | 6/8
13 h-m-p 1.6000 8.0000 1.5997 YC 669.686987 1 3.4695 194 | 6/8
14 h-m-p 1.6000 8.0000 2.3025 YCC 669.681373 2 3.1155 208 | 6/8
15 h-m-p 1.6000 8.0000 3.5107 YC 669.677086 1 3.5456 220 | 6/8
16 h-m-p 1.6000 8.0000 5.1116 YC 669.674558 1 3.0817 232 | 6/8
17 h-m-p 1.6000 8.0000 7.4649 YC 669.672688 1 3.4471 244 | 6/8
18 h-m-p 1.6000 8.0000 11.3056 YC 669.671491 1 3.2109 256 | 6/8
19 h-m-p 1.6000 8.0000 16.5298 YC 669.670656 1 3.2712 268 | 6/8
20 h-m-p 1.6000 8.0000 24.5740 YC 669.670097 1 3.3611 280 | 6/8
21 h-m-p 1.6000 8.0000 36.2227 YC 669.669725 1 3.1205 292 | 6/8
22 h-m-p 1.6000 8.0000 53.3329 YC 669.669463 1 3.5411 304 | 6/8
23 h-m-p 1.1130 5.5650 80.3529 +YC 669.669295 1 2.9794 317 | 6/8
24 h-m-p 0.3589 1.7944 115.7799 ++ 669.669203 m 1.7944 328 | 7/8
25 h-m-p 1.6000 8.0000 0.0000 Y 669.669203 0 1.1318 339 | 7/8
26 h-m-p 1.6000 8.0000 0.0000 ------------N 669.669203 0 0.0000 363
Out..
lnL = -669.669203
364 lfun, 364 eigenQcodon, 2184 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.072924 0.080489 0.048026 0.013540 0.079870 0.027999 0.000100 0.875729 0.152126
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 21.489190
np = 9
lnL0 = -716.712970
Iterating by ming2
Initial: fx= 716.712970
x= 0.07292 0.08049 0.04803 0.01354 0.07987 0.02800 0.00011 0.87573 0.15213
1 h-m-p 0.0000 0.0000 341.1971 ++ 716.535212 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 12674.9095 ++ 705.507110 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0002 442.2407 ++ 684.646368 m 0.0002 38 | 3/9
4 h-m-p 0.0000 0.0000 1983.8001 ++ 672.912569 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0002 163.5925 ++ 670.784712 m 0.0002 62 | 5/9
6 h-m-p 0.0000 0.0000 722.6135 ++ 670.695025 m 0.0000 74 | 6/9
7 h-m-p 0.0010 0.0277 1.3305 ++YCYC 670.535950 3 0.0112 92 | 6/9
8 h-m-p 0.0182 0.3943 0.8165 +++ 670.290962 m 0.3943 105 | 6/9
9 h-m-p 0.0000 0.0000 11.3838
h-m-p: 0.00000000e+00 0.00000000e+00 1.13838461e+01 670.290962
.. | 6/9
10 h-m-p 0.0009 0.4631 4.3193 -CC 670.290530 1 0.0000 132 | 6/9
11 h-m-p 0.0008 0.3835 2.1736 +++++ 669.910392 m 0.3835 147 | 7/9
12 h-m-p 1.6000 8.0000 0.0013 YCC 669.907009 2 0.8792 162 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 C 669.907009 0 1.6576 176 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ----N 669.907009 0 0.0016 194
Out..
lnL = -669.907009
195 lfun, 585 eigenQcodon, 2340 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.074910 0.064732 0.089360 0.100422 0.039588 0.100110 0.000100 0.880026 0.260335 0.225833 1175.926000
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.058576
np = 11
lnL0 = -700.983291
Iterating by ming2
Initial: fx= 700.983291
x= 0.07491 0.06473 0.08936 0.10042 0.03959 0.10011 0.00011 0.88003 0.26033 0.22583 951.42857
1 h-m-p 0.0000 0.0000 65.1738 ++ 700.962774 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0194 24.4024 +++++ 691.548252 m 0.0194 33 | 2/11
3 h-m-p 0.0004 0.0019 39.1886 ++ 688.190390 m 0.0019 47 | 3/11
4 h-m-p 0.0007 0.0033 28.5144 ++ 686.870359 m 0.0033 61 | 4/11
5 h-m-p 0.0002 0.0011 203.9780 ++ 683.598741 m 0.0011 75 | 5/11
6 h-m-p 0.0000 0.0001 530.7668 ++ 682.628701 m 0.0001 89 | 6/11
7 h-m-p 0.0015 0.0226 34.1312 ++ 675.984843 m 0.0226 103 | 6/11
8 h-m-p 0.2170 1.0849 1.5591 Y
a 0.000000 0.216976 0.867903 0.492617
f 675.984843 672.566325 673.896492 674.085421
0.000000e+00 675.984843
4.339513e-02 669.828876
8.679027e-02 670.559748
1.301854e-01 671.330049
1.735805e-01 672.005898
2.169757e-01 672.566325
2.603708e-01 673.016170
3.037659e-01 673.367761
3.471611e-01 673.635172
3.905562e-01 673.832075
4.339513e-01 673.970910
4.773465e-01 674.062588
5.207416e-01 674.116458
5.641367e-01 674.140391
6.075319e-01 674.140926
6.509270e-01 674.123450
6.943221e-01 674.092382
7.377173e-01 674.051355
7.811124e-01 674.003387
8.245075e-01 673.951031
8.679027e-01 673.896492
Linesearch2 a4: multiple optima?
YCYYCYYYC 669.691697 9 0.0258 151 | 6/11
9 h-m-p 1.6000 8.0000 0.0090 ++ 669.690710 m 8.0000 165 | 6/11
10 h-m-p 0.0792 8.0000 0.9132 ++CCC 669.682371 2 1.6045 190 | 6/11
11 h-m-p 1.6000 8.0000 0.0018 ++ 669.682259 m 8.0000 209 | 6/11
12 h-m-p 0.0122 4.6189 1.1555 +++++ 669.669737 m 4.6189 231 | 7/11
13 h-m-p 1.6000 8.0000 0.1756 ++ 669.669435 m 8.0000 245 | 7/11
14 h-m-p 1.6000 8.0000 0.6183 C 669.669380 0 1.6000 263 | 7/11
15 h-m-p 1.6000 8.0000 0.0739 C 669.669379 0 2.5057 281 | 7/11
16 h-m-p 1.6000 8.0000 0.0185 ++ 669.669370 m 8.0000 299 | 7/11
17 h-m-p 0.0887 8.0000 1.6647 +YC 669.669318 1 0.8554 319 | 7/11
18 h-m-p 1.6000 8.0000 0.2890 Y 669.669307 0 2.8045 333 | 7/11
19 h-m-p 1.6000 8.0000 0.1103 Y 669.669307 0 0.8826 351 | 7/11
20 h-m-p 1.6000 8.0000 0.0238 +Y 669.669307 0 4.0549 370 | 7/11
21 h-m-p 1.6000 8.0000 0.0058 ++ 669.669305 m 8.0000 388 | 7/11
22 h-m-p 0.0608 8.0000 0.7667 +++Y 669.669238 0 5.8756 409 | 7/11
23 h-m-p 1.6000 8.0000 0.6860 C 669.669225 0 1.6000 427 | 7/11
24 h-m-p 1.6000 8.0000 0.4865 +C 669.669218 0 6.1717 446 | 7/11
25 h-m-p 1.6000 8.0000 0.1857 C 669.669217 0 2.0952 464 | 7/11
26 h-m-p 1.0858 8.0000 0.3584 +Y 669.669216 0 5.9324 483 | 7/11
27 h-m-p 1.6000 8.0000 0.4281 C 669.669216 0 1.7133 501 | 7/11
28 h-m-p 1.6000 8.0000 0.3883 Y 669.669216 0 3.2469 519 | 7/11
29 h-m-p 1.6000 8.0000 0.5704 Y 669.669216 0 3.0504 537 | 7/11
30 h-m-p 1.6000 8.0000 0.3484 C 669.669216 0 1.3660 555 | 7/11
31 h-m-p 0.7158 8.0000 0.6649 +C 669.669216 0 2.8632 574 | 7/11
32 h-m-p 1.6000 8.0000 0.3879 Y 669.669216 0 2.7827 592 | 7/11
33 h-m-p 1.6000 8.0000 0.5817 C 669.669216 0 1.6000 610 | 7/11
34 h-m-p 0.3906 8.0000 2.3830 ++Y 669.669216 0 5.2100 630 | 7/11
35 h-m-p 1.5198 8.0000 8.1691 +Y 669.669216 0 4.4805 645 | 7/11
36 h-m-p 0.3834 1.9171 32.9374 ++ 669.669216 m 1.9171 659 | 7/11
37 h-m-p -0.0000 -0.0000 765.4268
h-m-p: -0.00000000e+00 -0.00000000e+00 7.65426766e+02 669.669216
.. | 7/11
38 h-m-p 0.0160 8.0000 0.0266 ---Y 669.669216 0 0.0000 687 | 7/11
39 h-m-p 1.6000 8.0000 0.0000 ---Y 669.669216 0 0.0063 708
Out..
lnL = -669.669216
709 lfun, 2836 eigenQcodon, 12762 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -674.611304 S = -673.172454 -2.367415
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:05
did 20 / 57 patterns 0:05
did 30 / 57 patterns 0:05
did 40 / 57 patterns 0:05
did 50 / 57 patterns 0:05
did 57 / 57 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.077114 0.088123 0.093824 0.023604 0.054768 0.060715 0.000100 0.866985 1.993270
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.916994
np = 9
lnL0 = -727.942747
Iterating by ming2
Initial: fx= 727.942747
x= 0.07711 0.08812 0.09382 0.02360 0.05477 0.06072 0.00011 0.86699 1.99327
1 h-m-p 0.0000 0.0000 352.6371 ++ 727.763529 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0003 243.4700 ++CYCYYYCYCC 718.915902 10 0.0002 42 | 1/9
3 h-m-p 0.0013 0.0107 45.8906 ++ 703.668397 m 0.0107 54 | 2/9
4 h-m-p 0.0002 0.0009 64.9274 ++ 690.150099 m 0.0009 66 | 3/9
5 h-m-p 0.0037 0.0201 12.9098 ------------.. | 3/9
6 h-m-p 0.0000 0.0002 263.7282 +++ 676.746457 m 0.0002 101 | 4/9
7 h-m-p 0.0000 0.0000 23191.5689 ++ 672.226739 m 0.0000 113 | 5/9
8 h-m-p 0.0001 0.0003 36.6207 ++ 671.145358 m 0.0003 125 | 6/9
9 h-m-p 0.0073 1.1524 0.6884 +++YCYYCCC 670.292035 6 0.7259 149 | 6/9
10 h-m-p 0.7235 8.0000 0.6907 YCCCC 670.224886 4 0.3790 171 | 6/9
11 h-m-p 0.6887 8.0000 0.3800 +YYYCCCC 670.042794 6 2.9048 196 | 6/9
12 h-m-p 0.8133 4.0664 0.4449 +
QuantileBeta(0.85, 3.42001, 0.00500) = 1.000000e+00 2000 rounds
YCCC 669.958736 3 2.2511 217 | 6/9
13 h-m-p 0.2395 1.1977 0.6194 +
QuantileBeta(0.85, 3.33242, 0.00500) = 1.000000e+00 2000 rounds
+ 669.911298 m 1.1977 232
QuantileBeta(0.85, 3.33242, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.33242, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.33242, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.33242, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.33242, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.33242, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.33242, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.33242, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.33257, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.33227, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
14 h-m-p 1.6000 8.0000 0.1484
QuantileBeta(0.85, 3.56988, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.28227, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.47947, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 3.49323, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 3.53156, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49522, 0.00500) = 1.000000e+00 2000 rounds
C 669.907010 2 1.0970 250
QuantileBeta(0.85, 3.49522, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49522, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49522, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49522, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49522, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49522, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49522, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49522, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49537, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49522, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
15 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.85, 3.49535, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49574, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
C 669.907010 0 1.5121 264
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49550, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49519, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
16 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 3.49527, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49533, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
N 669.907010 0 0.0016 282
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49550, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49519, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
17 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
C 669.907010 0 0.0039 296
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49550, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49519, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
18 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
C 669.907010 0 0.0000 315
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -669.907010
316 lfun, 3476 eigenQcodon, 18960 P(t)
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.49534, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.027574 0.053563 0.086194 0.032352 0.063530 0.102237 0.000100 0.900000 0.645051 1.230734 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.124045
np = 11
lnL0 = -685.773236
Iterating by ming2
Initial: fx= 685.773236
x= 0.02757 0.05356 0.08619 0.03235 0.06353 0.10224 0.00011 0.90000 0.64505 1.23073 951.42857
1 h-m-p 0.0000 0.0000 121.9854 ++ 685.556232 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 525.0304 ++YYYYYYCYCY 674.645553 10 0.0002 43 | 1/11
3 h-m-p 0.0029 0.0145 8.3953 ++ 674.144717 m 0.0145 57 | 2/11
4 h-m-p 0.0020 0.0100 3.6615 ++ 673.623097 m 0.0100 71 | 3/11
5 h-m-p 0.0021 0.0106 7.4626 ++ 673.152089 m 0.0106 85 | 4/11
6 h-m-p 0.0015 0.0077 4.7323 ++ 672.868005 m 0.0077 99 | 5/11
7 h-m-p 0.0000 0.0001 1011.9522 ++ 672.649484 m 0.0001 113 | 6/11
8 h-m-p 0.0976 0.6085 0.8864 +YYCYYYYCYY 671.204908 10 0.5540 139 | 6/11
9 h-m-p 0.0000 0.0000 33733.5613 +YYYYYCYCYC 670.567301 9 0.0000 171 | 6/11
10 h-m-p 0.0031 0.0154 0.5147 C 670.566636 0 0.0006 185 | 6/11
11 h-m-p 0.0160 8.0000 0.1523 +++++ 669.945328 m 8.0000 207 | 6/11
12 h-m-p 1.6000 8.0000 0.0786 ++ 669.832848 m 8.0000 226 | 6/11
13 h-m-p 1.1615 5.8077 0.5000 CCCCC 669.781380 4 1.5556 253 | 6/11
14 h-m-p 1.6000 8.0000 0.2429 +YCCC 669.746897 3 4.6788 278 | 6/11
15 h-m-p 1.6000 8.0000 0.6016 YCCC 669.718494 3 3.0447 302 | 6/11
16 h-m-p 1.6000 8.0000 0.8325 YCCC 669.703353 3 2.8675 326 | 6/11
17 h-m-p 1.6000 8.0000 1.4156 CCC 669.691619 2 2.4779 349 | 6/11
18 h-m-p 1.6000 8.0000 1.6585 YC 669.683483 1 3.9480 364 | 6/11
19 h-m-p 1.6000 8.0000 2.9537 CCC 669.678669 2 2.0799 382 | 6/11
20 h-m-p 1.6000 8.0000 3.3351 +CC 669.674238 1 5.9118 399 | 6/11
21 h-m-p 1.6000 8.0000 6.6587 CC 669.672330 1 1.7656 415 | 6/11
22 h-m-p 1.1943 5.9716 7.0091 ++ 669.670338 m 5.9716 429 | 6/11
23 h-m-p 0.0000 0.0000 18.6829
h-m-p: 0.00000000e+00 0.00000000e+00 1.86829475e+01 669.670338
.. | 6/11
24 h-m-p 0.0000 0.0025 2.4034 +C 669.670231 0 0.0000 455 | 7/11
25 h-m-p 0.0204 8.0000 0.0043 +++++ 669.670093 m 8.0000 472 | 7/11
26 h-m-p 0.1187 1.2311 0.2887 ++ 669.669219 m 1.2311 490 | 8/11
27 h-m-p 0.3759 8.0000 0.0001 C 669.669216 0 0.3509 508 | 8/11
28 h-m-p 1.6000 8.0000 0.0000 ----------Y 669.669216 0 0.0000 535
Out..
lnL = -669.669216
536 lfun, 6432 eigenQcodon, 35376 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -674.350972 S = -673.173224 -1.981228
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:19
did 20 / 57 patterns 0:19
did 30 / 57 patterns 0:19
did 40 / 57 patterns 0:20
did 50 / 57 patterns 0:20
did 57 / 57 patterns 0:20
Time used: 0:20
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=165
NC_011896_1_WP_010909013_1_2840_MLBR_RS13520 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
NC_002677_1_NP_302694_1_1566_ML2654 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950 MMLRLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR
*** **********************************************
NC_011896_1_WP_010909013_1_2840_MLBR_RS13520 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
NC_002677_1_NP_302694_1_1566_ML2654 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950 AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS
**************************************************
NC_011896_1_WP_010909013_1_2840_MLBR_RS13520 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
NC_002677_1_NP_302694_1_1566_ML2654 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950 QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV
**************************************************
NC_011896_1_WP_010909013_1_2840_MLBR_RS13520 DNGALTDVVVHPLEK
NC_002677_1_NP_302694_1_1566_ML2654 DNGALTDVVVHPLEK
NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255 DNGALTDVVVHPLEK
NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585 DNGALTDVVVHPLEK
NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610 DNGALTDVVVHPLEK
NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950 DNGALTDVVVHPLEK
***************
>NC_011896_1_WP_010909013_1_2840_MLBR_RS13520 ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA >NC_002677_1_NP_302694_1_1566_ML2654 ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA >NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255 ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA >NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585 ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA >NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610 ATGATGCTACTGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA >NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950 ATGATGCTACGGCTGATTGCCGATACCCATGTGCCACAACGCGCACCCGA CATGCCCGCACAGGTATGGGACGAGGTCGCAAAGGCTGATGTCGTAGTTC ACGCCGGCGACTGGGTATCGCCCAAATTACTCGACGAGCTGGAATCCAGG GCTGCTCAGCTGGTCGCGTGCTGGGGAAATAACGACGGGCCCGAACTGCG GTCACGACTGCCGGAGCGAGCAAACGTGACATTAGCAGGCATGAATTTCA CAGTTGTGCACGAGACCGGCGCAGCAGACGGCCGCGAAGCCCGGATGTCG CAACTGTATCCGGACAGCCAGGTCTTGGTGTTCGGACATAGTCACATACC ATGTGATACCACGACGACGACCGGTTTGCGGCTGCTGAATCCTGGCTCGC CAACAGATCGTCGCCATCAAGCTTTTTGCAGCTACATGACCGCTAATGTC GACAACGGGGCATTAACGGACGTAGTCGTCCACCCGTTGGAAAAA
>NC_011896_1_WP_010909013_1_2840_MLBR_RS13520 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV DNGALTDVVVHPLEK >NC_002677_1_NP_302694_1_1566_ML2654 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV DNGALTDVVVHPLEK >NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV DNGALTDVVVHPLEK >NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV DNGALTDVVVHPLEK >NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610 MMLLLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV DNGALTDVVVHPLEK >NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950 MMLRLIADTHVPQRAPDMPAQVWDEVAKADVVVHAGDWVSPKLLDELESR AAQLVACWGNNDGPELRSRLPERANVTLAGMNFTVVHETGAADGREARMS QLYPDSQVLVFGHSHIPCDTTTTTGLRLLNPGSPTDRRHQAFCSYMTANV DNGALTDVVVHPLEK
#NEXUS
[ID: 5163787124]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010909013_1_2840_MLBR_RS13520
NC_002677_1_NP_302694_1_1566_ML2654
NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255
NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585
NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610
NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950
;
end;
begin trees;
translate
1 NC_011896_1_WP_010909013_1_2840_MLBR_RS13520,
2 NC_002677_1_NP_302694_1_1566_ML2654,
3 NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255,
4 NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585,
5 NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610,
6 NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05622617,2:0.05704743,3:0.0571275,4:0.05771466,5:0.06022024,6:0.1350284);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05622617,2:0.05704743,3:0.0571275,4:0.05771466,5:0.06022024,6:0.1350284);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -692.34 -697.87
2 -692.33 -696.53
--------------------------------------
TOTAL -692.34 -697.41
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2654/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.863616 0.087519 0.373989 1.484248 0.841070 1380.37 1440.68 1.000
r(A<->C){all} 0.168400 0.018747 0.000045 0.435323 0.134791 303.57 331.43 1.000
r(A<->G){all} 0.169294 0.021530 0.000120 0.470548 0.126976 183.29 218.93 1.004
r(A<->T){all} 0.133047 0.015185 0.000074 0.382133 0.096839 167.02 225.97 1.008
r(C<->G){all} 0.181319 0.021406 0.000072 0.471646 0.145929 214.86 225.31 1.011
r(C<->T){all} 0.130328 0.013976 0.000021 0.367920 0.097093 247.87 261.01 1.000
r(G<->T){all} 0.217613 0.024577 0.000426 0.529423 0.182453 164.21 201.79 1.004
pi(A){all} 0.235690 0.000352 0.201253 0.273276 0.235708 1010.30 1237.51 1.000
pi(C){all} 0.284092 0.000412 0.245927 0.325404 0.283466 1268.80 1341.40 1.000
pi(G){all} 0.290608 0.000399 0.250500 0.328380 0.290697 1057.12 1279.06 1.000
pi(T){all} 0.189610 0.000313 0.152821 0.221852 0.189100 1274.04 1353.65 1.000
alpha{1,2} 0.233803 0.057797 0.003509 0.628750 0.169601 1267.42 1384.21 1.000
alpha{3} 0.391240 0.209067 0.000150 1.351097 0.219084 1152.88 1260.69 1.000
pinvar{all} 0.992443 0.000039 0.981274 0.999766 0.993970 1442.90 1459.93 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/9res/ML2654/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 165
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 2 2 2 2 2 2 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 3 3 3 3 3 3 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 3 3 3 3 3 3 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 4 4 4 4 4 4 | CAC 4 4 4 4 4 4 | CGC 3 3 3 3 3 3
CTA 1 1 1 1 1 1 | CCA 3 3 3 3 3 3 | Gln CAA 3 3 3 3 3 3 | CGA 2 2 2 2 2 2
CTG 9 9 9 9 9 8 | CCG 3 3 3 3 3 3 | CAG 3 3 3 3 3 3 | CGG 3 3 3 3 3 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 4 4 4 4 4 4 | Ser AGT 1 1 1 1 1 1
ATC 0 0 0 0 0 0 | ACC 5 5 5 5 5 5 | AAC 3 3 3 3 3 3 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 3 3 3 3 3 3 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 6 6 6 6 6 6 | ACG 4 4 4 4 4 4 | AAG 1 1 1 1 1 1 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 5 5 5 5 5 5 | Asp GAT 4 4 4 4 4 4 | Gly GGT 1 1 1 1 1 1
GTC 7 7 7 7 7 7 | GCC 3 3 3 3 3 3 | GAC 9 9 9 9 9 9 | GGC 5 5 5 5 5 5
GTA 4 4 4 4 4 4 | GCA 8 8 8 8 8 8 | Glu GAA 4 4 4 4 4 4 | GGA 2 2 2 2 2 2
GTG 4 4 4 4 4 4 | GCG 1 1 1 1 1 1 | GAG 4 4 4 4 4 4 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010909013_1_2840_MLBR_RS13520
position 1: T:0.13333 C:0.26667 A:0.20606 G:0.39394
position 2: T:0.27273 C:0.27273 A:0.27879 G:0.17576
position 3: T:0.15758 C:0.31515 A:0.22424 G:0.30303
Average T:0.18788 C:0.28485 A:0.23636 G:0.29091
#2: NC_002677_1_NP_302694_1_1566_ML2654
position 1: T:0.13333 C:0.26667 A:0.20606 G:0.39394
position 2: T:0.27273 C:0.27273 A:0.27879 G:0.17576
position 3: T:0.15758 C:0.31515 A:0.22424 G:0.30303
Average T:0.18788 C:0.28485 A:0.23636 G:0.29091
#3: NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255
position 1: T:0.13333 C:0.26667 A:0.20606 G:0.39394
position 2: T:0.27273 C:0.27273 A:0.27879 G:0.17576
position 3: T:0.15758 C:0.31515 A:0.22424 G:0.30303
Average T:0.18788 C:0.28485 A:0.23636 G:0.29091
#4: NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585
position 1: T:0.13333 C:0.26667 A:0.20606 G:0.39394
position 2: T:0.27273 C:0.27273 A:0.27879 G:0.17576
position 3: T:0.15758 C:0.31515 A:0.22424 G:0.30303
Average T:0.18788 C:0.28485 A:0.23636 G:0.29091
#5: NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610
position 1: T:0.13333 C:0.26667 A:0.20606 G:0.39394
position 2: T:0.27273 C:0.27273 A:0.27879 G:0.17576
position 3: T:0.15758 C:0.31515 A:0.22424 G:0.30303
Average T:0.18788 C:0.28485 A:0.23636 G:0.29091
#6: NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950
position 1: T:0.13333 C:0.26667 A:0.20606 G:0.39394
position 2: T:0.26667 C:0.27273 A:0.27879 G:0.18182
position 3: T:0.15758 C:0.31515 A:0.22424 G:0.30303
Average T:0.18586 C:0.28485 A:0.23636 G:0.29293
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 6
TTC 12 | TCC 6 | TAC 6 | TGC 12
Leu L TTA 18 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 18 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 18 | Arg R CGT 6
CTC 6 | CCC 24 | CAC 24 | CGC 18
CTA 6 | CCA 18 | Gln Q CAA 18 | CGA 12
CTG 53 | CCG 18 | CAG 18 | CGG 19
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 24 | Ser S AGT 6
ATC 0 | ACC 30 | AAC 18 | AGC 12
ATA 6 | ACA 18 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 36 | ACG 24 | AAG 6 | AGG 6
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 30 | Asp D GAT 24 | Gly G GGT 6
GTC 42 | GCC 18 | GAC 54 | GGC 30
GTA 24 | GCA 48 | Glu E GAA 24 | GGA 12
GTG 24 | GCG 6 | GAG 24 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13333 C:0.26667 A:0.20606 G:0.39394
position 2: T:0.27172 C:0.27273 A:0.27879 G:0.17677
position 3: T:0.15758 C:0.31515 A:0.22424 G:0.30303
Average T:0.18754 C:0.28485 A:0.23636 G:0.29125
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -669.669203 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005989 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006009
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005989);
(NC_011896_1_WP_010909013_1_2840_MLBR_RS13520: 0.000004, NC_002677_1_NP_302694_1_1566_ML2654: 0.000004, NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255: 0.000004, NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585: 0.000004, NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610: 0.000004, NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950: 0.005989);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 382.2 112.8 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 382.2 112.8 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 382.2 112.8 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 382.2 112.8 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 382.2 112.8 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.006 382.2 112.8 999.0000 0.0026 0.0000 1.0 0.0
tree length for dN: 0.0026
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -669.907009 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.006112 0.000100 0.530927 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006132
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.006112);
(NC_011896_1_WP_010909013_1_2840_MLBR_RS13520: 0.000004, NC_002677_1_NP_302694_1_1566_ML2654: 0.000004, NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255: 0.000004, NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585: 0.000004, NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610: 0.000004, NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950: 0.006112);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.53093 0.46907
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 382.2 112.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 382.2 112.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 382.2 112.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 382.2 112.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 382.2 112.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.006 382.2 112.8 1.0000 0.0020 0.0020 0.8 0.2
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -669.669216 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005989 0.000100 0.000000 0.000000 1.000000 951.794123
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006009
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005989);
(NC_011896_1_WP_010909013_1_2840_MLBR_RS13520: 0.000004, NC_002677_1_NP_302694_1_1566_ML2654: 0.000004, NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255: 0.000004, NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585: 0.000004, NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610: 0.000004, NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950: 0.005989);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 951.79412
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 382.2 112.8 951.7941 0.0000 0.0000 0.0 0.0
7..2 0.000 382.2 112.8 951.7941 0.0000 0.0000 0.0 0.0
7..3 0.000 382.2 112.8 951.7941 0.0000 0.0000 0.0 0.0
7..4 0.000 382.2 112.8 951.7941 0.0000 0.0000 0.0 0.0
7..5 0.000 382.2 112.8 951.7941 0.0000 0.0000 0.0 0.0
7..6 0.006 382.2 112.8 951.7941 0.0026 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909013_1_2840_MLBR_RS13520)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.794
2 M 1.000** 951.794
3 L 1.000** 951.794
4 L 1.000** 951.794
5 L 1.000** 951.794
6 I 1.000** 951.794
7 A 1.000** 951.794
8 D 1.000** 951.794
9 T 1.000** 951.794
10 H 1.000** 951.794
11 V 1.000** 951.794
12 P 1.000** 951.794
13 Q 1.000** 951.794
14 R 1.000** 951.794
15 A 1.000** 951.794
16 P 1.000** 951.794
17 D 1.000** 951.794
18 M 1.000** 951.794
19 P 1.000** 951.794
20 A 1.000** 951.794
21 Q 1.000** 951.794
22 V 1.000** 951.794
23 W 1.000** 951.794
24 D 1.000** 951.794
25 E 1.000** 951.794
26 V 1.000** 951.794
27 A 1.000** 951.794
28 K 1.000** 951.794
29 A 1.000** 951.794
30 D 1.000** 951.794
31 V 1.000** 951.794
32 V 1.000** 951.794
33 V 1.000** 951.794
34 H 1.000** 951.794
35 A 1.000** 951.794
36 G 1.000** 951.794
37 D 1.000** 951.794
38 W 1.000** 951.794
39 V 1.000** 951.794
40 S 1.000** 951.794
41 P 1.000** 951.794
42 K 1.000** 951.794
43 L 1.000** 951.794
44 L 1.000** 951.794
45 D 1.000** 951.794
46 E 1.000** 951.794
47 L 1.000** 951.794
48 E 1.000** 951.794
49 S 1.000** 951.794
50 R 1.000** 951.794
51 A 1.000** 951.794
52 A 1.000** 951.794
53 Q 1.000** 951.794
54 L 1.000** 951.794
55 V 1.000** 951.794
56 A 1.000** 951.794
57 C 1.000** 951.794
58 W 1.000** 951.794
59 G 1.000** 951.794
60 N 1.000** 951.794
61 N 1.000** 951.794
62 D 1.000** 951.794
63 G 1.000** 951.794
64 P 1.000** 951.794
65 E 1.000** 951.794
66 L 1.000** 951.794
67 R 1.000** 951.794
68 S 1.000** 951.794
69 R 1.000** 951.794
70 L 1.000** 951.794
71 P 1.000** 951.794
72 E 1.000** 951.794
73 R 1.000** 951.794
74 A 1.000** 951.794
75 N 1.000** 951.794
76 V 1.000** 951.794
77 T 1.000** 951.794
78 L 1.000** 951.794
79 A 1.000** 951.794
80 G 1.000** 951.794
81 M 1.000** 951.794
82 N 1.000** 951.794
83 F 1.000** 951.794
84 T 1.000** 951.794
85 V 1.000** 951.794
86 V 1.000** 951.794
87 H 1.000** 951.794
88 E 1.000** 951.794
89 T 1.000** 951.794
90 G 1.000** 951.794
91 A 1.000** 951.794
92 A 1.000** 951.794
93 D 1.000** 951.794
94 G 1.000** 951.794
95 R 1.000** 951.794
96 E 1.000** 951.794
97 A 1.000** 951.794
98 R 1.000** 951.794
99 M 1.000** 951.794
100 S 1.000** 951.794
101 Q 1.000** 951.794
102 L 1.000** 951.794
103 Y 1.000** 951.794
104 P 1.000** 951.794
105 D 1.000** 951.794
106 S 1.000** 951.794
107 Q 1.000** 951.794
108 V 1.000** 951.794
109 L 1.000** 951.794
110 V 1.000** 951.794
111 F 1.000** 951.794
112 G 1.000** 951.794
113 H 1.000** 951.794
114 S 1.000** 951.794
115 H 1.000** 951.794
116 I 1.000** 951.794
117 P 1.000** 951.794
118 C 1.000** 951.794
119 D 1.000** 951.794
120 T 1.000** 951.794
121 T 1.000** 951.794
122 T 1.000** 951.794
123 T 1.000** 951.794
124 T 1.000** 951.794
125 G 1.000** 951.794
126 L 1.000** 951.794
127 R 1.000** 951.794
128 L 1.000** 951.794
129 L 1.000** 951.794
130 N 1.000** 951.794
131 P 1.000** 951.794
132 G 1.000** 951.794
133 S 1.000** 951.794
134 P 1.000** 951.794
135 T 1.000** 951.794
136 D 1.000** 951.794
137 R 1.000** 951.794
138 R 1.000** 951.794
139 H 1.000** 951.794
140 Q 1.000** 951.794
141 A 1.000** 951.794
142 F 1.000** 951.794
143 C 1.000** 951.794
144 S 1.000** 951.794
145 Y 1.000** 951.794
146 M 1.000** 951.794
147 T 1.000** 951.794
148 A 1.000** 951.794
149 N 1.000** 951.794
150 V 1.000** 951.794
151 D 1.000** 951.794
152 N 1.000** 951.794
153 G 1.000** 951.794
154 A 1.000** 951.794
155 L 1.000** 951.794
156 T 1.000** 951.794
157 D 1.000** 951.794
158 V 1.000** 951.794
159 V 1.000** 951.794
160 V 1.000** 951.794
161 H 1.000** 951.794
162 P 1.000** 951.794
163 L 1.000** 951.794
164 E 1.000** 951.794
165 K 1.000** 951.794
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909013_1_2840_MLBR_RS13520)
Pr(w>1) post mean +- SE for w
4 L 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -669.907010 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.006112 0.000100 3.495344 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006132
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.006112);
(NC_011896_1_WP_010909013_1_2840_MLBR_RS13520: 0.000004, NC_002677_1_NP_302694_1_1566_ML2654: 0.000004, NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255: 0.000004, NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585: 0.000004, NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610: 0.000004, NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950: 0.006112);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 3.49534 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 382.2 112.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 382.2 112.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 382.2 112.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 382.2 112.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 382.2 112.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.006 382.2 112.8 1.0000 0.0020 0.0020 0.8 0.2
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -669.669216 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005989 0.000100 0.000010 0.882648 99.000000 952.542142
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006009
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005989);
(NC_011896_1_WP_010909013_1_2840_MLBR_RS13520: 0.000004, NC_002677_1_NP_302694_1_1566_ML2654: 0.000004, NZ_LVXE01000015_1_WP_010909013_1_551_A3216_RS06255: 0.000004, NZ_LYPH01000020_1_WP_010909013_1_756_A8144_RS03585: 0.000004, NZ_CP029543_1_WP_010909013_1_2871_DIJ64_RS14610: 0.000004, NZ_AP014567_1_WP_119608029_1_2939_JK2ML_RS14950: 0.005989);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.88265 q = 99.00000
(p1 = 0.99999) w = 952.54214
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00033 0.00119 0.00224 0.00349 0.00498 0.00681 0.00914 0.01228 0.01711 0.02755 952.54214
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 382.2 112.8 952.5326 0.0000 0.0000 0.0 0.0
7..2 0.000 382.2 112.8 952.5326 0.0000 0.0000 0.0 0.0
7..3 0.000 382.2 112.8 952.5326 0.0000 0.0000 0.0 0.0
7..4 0.000 382.2 112.8 952.5326 0.0000 0.0000 0.0 0.0
7..5 0.000 382.2 112.8 952.5326 0.0000 0.0000 0.0 0.0
7..6 0.006 382.2 112.8 952.5326 0.0026 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909013_1_2840_MLBR_RS13520)
Pr(w>1) post mean +- SE for w
1 M 1.000** 952.533
2 M 1.000** 952.533
3 L 1.000** 952.533
4 L 1.000** 952.542
5 L 1.000** 952.533
6 I 1.000** 952.533
7 A 1.000** 952.533
8 D 1.000** 952.533
9 T 1.000** 952.533
10 H 1.000** 952.533
11 V 1.000** 952.533
12 P 1.000** 952.533
13 Q 1.000** 952.533
14 R 1.000** 952.533
15 A 1.000** 952.533
16 P 1.000** 952.533
17 D 1.000** 952.533
18 M 1.000** 952.533
19 P 1.000** 952.533
20 A 1.000** 952.533
21 Q 1.000** 952.533
22 V 1.000** 952.533
23 W 1.000** 952.533
24 D 1.000** 952.533
25 E 1.000** 952.533
26 V 1.000** 952.533
27 A 1.000** 952.533
28 K 1.000** 952.533
29 A 1.000** 952.533
30 D 1.000** 952.533
31 V 1.000** 952.533
32 V 1.000** 952.533
33 V 1.000** 952.533
34 H 1.000** 952.533
35 A 1.000** 952.533
36 G 1.000** 952.533
37 D 1.000** 952.533
38 W 1.000** 952.533
39 V 1.000** 952.533
40 S 1.000** 952.533
41 P 1.000** 952.533
42 K 1.000** 952.533
43 L 1.000** 952.533
44 L 1.000** 952.533
45 D 1.000** 952.533
46 E 1.000** 952.533
47 L 1.000** 952.533
48 E 1.000** 952.533
49 S 1.000** 952.533
50 R 1.000** 952.533
51 A 1.000** 952.533
52 A 1.000** 952.533
53 Q 1.000** 952.533
54 L 1.000** 952.533
55 V 1.000** 952.533
56 A 1.000** 952.533
57 C 1.000** 952.533
58 W 1.000** 952.533
59 G 1.000** 952.533
60 N 1.000** 952.533
61 N 1.000** 952.533
62 D 1.000** 952.533
63 G 1.000** 952.533
64 P 1.000** 952.533
65 E 1.000** 952.533
66 L 1.000** 952.533
67 R 1.000** 952.533
68 S 1.000** 952.533
69 R 1.000** 952.533
70 L 1.000** 952.533
71 P 1.000** 952.533
72 E 1.000** 952.533
73 R 1.000** 952.533
74 A 1.000** 952.533
75 N 1.000** 952.533
76 V 1.000** 952.533
77 T 1.000** 952.533
78 L 1.000** 952.533
79 A 1.000** 952.533
80 G 1.000** 952.533
81 M 1.000** 952.533
82 N 1.000** 952.533
83 F 1.000** 952.533
84 T 1.000** 952.533
85 V 1.000** 952.533
86 V 1.000** 952.533
87 H 1.000** 952.533
88 E 1.000** 952.533
89 T 1.000** 952.533
90 G 1.000** 952.533
91 A 1.000** 952.533
92 A 1.000** 952.533
93 D 1.000** 952.533
94 G 1.000** 952.533
95 R 1.000** 952.533
96 E 1.000** 952.533
97 A 1.000** 952.533
98 R 1.000** 952.533
99 M 1.000** 952.533
100 S 1.000** 952.533
101 Q 1.000** 952.533
102 L 1.000** 952.533
103 Y 1.000** 952.533
104 P 1.000** 952.533
105 D 1.000** 952.533
106 S 1.000** 952.533
107 Q 1.000** 952.533
108 V 1.000** 952.533
109 L 1.000** 952.533
110 V 1.000** 952.533
111 F 1.000** 952.533
112 G 1.000** 952.533
113 H 1.000** 952.533
114 S 1.000** 952.533
115 H 1.000** 952.533
116 I 1.000** 952.533
117 P 1.000** 952.533
118 C 1.000** 952.533
119 D 1.000** 952.533
120 T 1.000** 952.533
121 T 1.000** 952.533
122 T 1.000** 952.533
123 T 1.000** 952.533
124 T 1.000** 952.533
125 G 1.000** 952.533
126 L 1.000** 952.533
127 R 1.000** 952.533
128 L 1.000** 952.533
129 L 1.000** 952.533
130 N 1.000** 952.533
131 P 1.000** 952.533
132 G 1.000** 952.533
133 S 1.000** 952.533
134 P 1.000** 952.533
135 T 1.000** 952.533
136 D 1.000** 952.533
137 R 1.000** 952.533
138 R 1.000** 952.533
139 H 1.000** 952.533
140 Q 1.000** 952.533
141 A 1.000** 952.533
142 F 1.000** 952.533
143 C 1.000** 952.533
144 S 1.000** 952.533
145 Y 1.000** 952.533
146 M 1.000** 952.533
147 T 1.000** 952.533
148 A 1.000** 952.533
149 N 1.000** 952.533
150 V 1.000** 952.533
151 D 1.000** 952.533
152 N 1.000** 952.533
153 G 1.000** 952.533
154 A 1.000** 952.533
155 L 1.000** 952.533
156 T 1.000** 952.533
157 D 1.000** 952.533
158 V 1.000** 952.533
159 V 1.000** 952.533
160 V 1.000** 952.533
161 H 1.000** 952.533
162 P 1.000** 952.533
163 L 1.000** 952.533
164 E 1.000** 952.533
165 K 1.000** 952.533
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909013_1_2840_MLBR_RS13520)
Pr(w>1) post mean +- SE for w
1 M 0.639 4.860 +- 3.856
2 M 0.639 4.860 +- 3.856
3 L 0.639 4.860 +- 3.856
4 L 0.923 6.858 +- 3.003
5 L 0.639 4.860 +- 3.856
6 I 0.639 4.860 +- 3.856
7 A 0.639 4.860 +- 3.856
8 D 0.639 4.860 +- 3.856
9 T 0.639 4.860 +- 3.856
10 H 0.639 4.860 +- 3.856
11 V 0.639 4.860 +- 3.856
12 P 0.639 4.860 +- 3.856
13 Q 0.639 4.860 +- 3.856
14 R 0.639 4.860 +- 3.856
15 A 0.639 4.860 +- 3.856
16 P 0.639 4.860 +- 3.856
17 D 0.639 4.860 +- 3.856
18 M 0.639 4.860 +- 3.856
19 P 0.639 4.860 +- 3.856
20 A 0.639 4.860 +- 3.856
21 Q 0.639 4.860 +- 3.856
22 V 0.639 4.860 +- 3.856
23 W 0.639 4.860 +- 3.856
24 D 0.639 4.860 +- 3.856
25 E 0.639 4.860 +- 3.856
26 V 0.639 4.860 +- 3.856
27 A 0.639 4.860 +- 3.856
28 K 0.639 4.860 +- 3.856
29 A 0.639 4.860 +- 3.856
30 D 0.639 4.860 +- 3.856
31 V 0.639 4.860 +- 3.856
32 V 0.639 4.860 +- 3.856
33 V 0.639 4.860 +- 3.856
34 H 0.639 4.860 +- 3.856
35 A 0.639 4.860 +- 3.856
36 G 0.639 4.860 +- 3.856
37 D 0.639 4.860 +- 3.856
38 W 0.639 4.860 +- 3.856
39 V 0.639 4.860 +- 3.856
40 S 0.639 4.860 +- 3.856
41 P 0.639 4.860 +- 3.856
42 K 0.639 4.860 +- 3.856
43 L 0.639 4.860 +- 3.856
44 L 0.639 4.860 +- 3.856
45 D 0.639 4.860 +- 3.856
46 E 0.639 4.860 +- 3.856
47 L 0.639 4.860 +- 3.856
48 E 0.639 4.860 +- 3.856
49 S 0.639 4.860 +- 3.856
50 R 0.639 4.860 +- 3.856
51 A 0.639 4.860 +- 3.856
52 A 0.639 4.860 +- 3.856
53 Q 0.639 4.860 +- 3.856
54 L 0.639 4.860 +- 3.856
55 V 0.639 4.860 +- 3.856
56 A 0.639 4.860 +- 3.856
57 C 0.639 4.860 +- 3.856
58 W 0.639 4.860 +- 3.856
59 G 0.639 4.860 +- 3.856
60 N 0.639 4.860 +- 3.856
61 N 0.639 4.860 +- 3.856
62 D 0.639 4.860 +- 3.856
63 G 0.639 4.860 +- 3.856
64 P 0.639 4.860 +- 3.856
65 E 0.639 4.860 +- 3.856
66 L 0.639 4.860 +- 3.856
67 R 0.639 4.860 +- 3.856
68 S 0.639 4.860 +- 3.856
69 R 0.639 4.860 +- 3.856
70 L 0.639 4.860 +- 3.856
71 P 0.639 4.860 +- 3.856
72 E 0.639 4.860 +- 3.856
73 R 0.639 4.860 +- 3.856
74 A 0.639 4.860 +- 3.856
75 N 0.639 4.860 +- 3.856
76 V 0.639 4.860 +- 3.856
77 T 0.639 4.860 +- 3.856
78 L 0.639 4.860 +- 3.856
79 A 0.639 4.860 +- 3.856
80 G 0.639 4.860 +- 3.856
81 M 0.639 4.860 +- 3.856
82 N 0.639 4.860 +- 3.856
83 F 0.639 4.860 +- 3.856
84 T 0.639 4.860 +- 3.856
85 V 0.639 4.860 +- 3.856
86 V 0.639 4.860 +- 3.856
87 H 0.639 4.860 +- 3.856
88 E 0.639 4.860 +- 3.856
89 T 0.639 4.860 +- 3.856
90 G 0.639 4.860 +- 3.856
91 A 0.639 4.860 +- 3.856
92 A 0.639 4.860 +- 3.856
93 D 0.639 4.860 +- 3.856
94 G 0.639 4.860 +- 3.856
95 R 0.639 4.860 +- 3.856
96 E 0.639 4.860 +- 3.856
97 A 0.639 4.860 +- 3.856
98 R 0.639 4.860 +- 3.856
99 M 0.639 4.860 +- 3.856
100 S 0.639 4.860 +- 3.856
101 Q 0.639 4.860 +- 3.856
102 L 0.639 4.860 +- 3.856
103 Y 0.639 4.860 +- 3.856
104 P 0.639 4.860 +- 3.856
105 D 0.639 4.860 +- 3.856
106 S 0.639 4.860 +- 3.856
107 Q 0.639 4.860 +- 3.856
108 V 0.639 4.860 +- 3.856
109 L 0.639 4.860 +- 3.856
110 V 0.639 4.860 +- 3.856
111 F 0.639 4.860 +- 3.856
112 G 0.639 4.860 +- 3.856
113 H 0.639 4.860 +- 3.856
114 S 0.639 4.860 +- 3.856
115 H 0.639 4.860 +- 3.856
116 I 0.639 4.860 +- 3.856
117 P 0.639 4.860 +- 3.856
118 C 0.639 4.860 +- 3.856
119 D 0.639 4.860 +- 3.856
120 T 0.639 4.860 +- 3.856
121 T 0.639 4.860 +- 3.856
122 T 0.639 4.860 +- 3.856
123 T 0.639 4.860 +- 3.856
124 T 0.639 4.860 +- 3.856
125 G 0.639 4.860 +- 3.856
126 L 0.639 4.860 +- 3.856
127 R 0.639 4.860 +- 3.856
128 L 0.639 4.860 +- 3.856
129 L 0.639 4.860 +- 3.856
130 N 0.639 4.860 +- 3.856
131 P 0.639 4.860 +- 3.856
132 G 0.639 4.860 +- 3.856
133 S 0.639 4.860 +- 3.856
134 P 0.639 4.860 +- 3.856
135 T 0.639 4.860 +- 3.856
136 D 0.639 4.860 +- 3.856
137 R 0.639 4.860 +- 3.856
138 R 0.639 4.860 +- 3.856
139 H 0.639 4.860 +- 3.856
140 Q 0.639 4.860 +- 3.856
141 A 0.639 4.860 +- 3.856
142 F 0.639 4.860 +- 3.856
143 C 0.639 4.860 +- 3.856
144 S 0.639 4.860 +- 3.856
145 Y 0.639 4.860 +- 3.856
146 M 0.639 4.860 +- 3.856
147 T 0.639 4.860 +- 3.856
148 A 0.639 4.860 +- 3.856
149 N 0.639 4.860 +- 3.856
150 V 0.639 4.860 +- 3.856
151 D 0.639 4.860 +- 3.856
152 N 0.639 4.860 +- 3.856
153 G 0.639 4.860 +- 3.856
154 A 0.639 4.860 +- 3.856
155 L 0.639 4.860 +- 3.856
156 T 0.639 4.860 +- 3.856
157 D 0.639 4.860 +- 3.856
158 V 0.639 4.860 +- 3.856
159 V 0.639 4.860 +- 3.856
160 V 0.639 4.860 +- 3.856
161 H 0.639 4.860 +- 3.856
162 P 0.639 4.860 +- 3.856
163 L 0.639 4.860 +- 3.856
164 E 0.639 4.860 +- 3.856
165 K 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:20
Model 1: NearlyNeutral -669.907009 Model 2: PositiveSelection -669.669216 Model 0: one-ratio -669.669203 Model 7: beta -669.90701 Model 8: beta&w>1 -669.669216 Model 0 vs 1 0.4756119999999555 Model 2 vs 1 0.47558600000002116 Model 8 vs 7 0.4755880000000161
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
