--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 10:03:07 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/9res/ML2661/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/9res/ML2661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/9res/ML2661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2246.80         -2249.81
2      -2246.80         -2250.37
--------------------------------------
TOTAL    -2246.80         -2250.13
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/9res/ML2661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/9res/ML2661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/9res/ML2661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.890208    0.084699    0.355545    1.471964    0.864151   1501.00   1501.00    1.000
r(A<->C){all}   0.170928    0.020106    0.000138    0.451983    0.133301    225.15    244.75    1.008
r(A<->G){all}   0.155588    0.017693    0.000004    0.420101    0.120744    161.34    207.74    1.000
r(A<->T){all}   0.161457    0.016932    0.000007    0.416546    0.128970    272.75    324.24    1.000
r(C<->G){all}   0.168088    0.018674    0.000180    0.452220    0.133589    138.05    276.36    1.003
r(C<->T){all}   0.174897    0.020139    0.000016    0.455828    0.140593    320.23    359.73    1.001
r(G<->T){all}   0.169042    0.021805    0.000019    0.471902    0.127777    199.74    204.65    1.002
pi(A){all}      0.189731    0.000091    0.171213    0.208197    0.189592   1262.33   1287.60    1.000
pi(C){all}      0.281591    0.000124    0.260161    0.303064    0.281514   1176.25   1202.62    1.000
pi(G){all}      0.315533    0.000128    0.293178    0.336940    0.315612   1115.70   1180.70    1.000
pi(T){all}      0.213145    0.000103    0.192248    0.232152    0.213184   1294.09   1331.21    1.000
alpha{1,2}      0.419184    0.230296    0.000300    1.385473    0.246502   1345.58   1360.13    1.000
alpha{3}        0.468941    0.241246    0.000258    1.450430    0.306510   1353.03   1427.02    1.000
pinvar{all}     0.999089    0.000001    0.997166    0.999999    0.999414   1034.97   1075.37    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2193.123749
Model 2: PositiveSelection	-2193.123564
Model 0: one-ratio	-2193.123736
Model 7: beta	-2193.123986
Model 8: beta&w>1	-2193.123565


Model 0 vs 1	2.5999999706982635E-5

Model 2 vs 1	3.6999999974796083E-4

Model 8 vs 7	8.420000003752648E-4
>C1
MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
>C2
MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
>C3
MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
>C4
MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
>C5
MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
>C6
MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=548 

C1              MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
C2              MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
C3              MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
C4              MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
C5              MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
C6              MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
                **************************************************

C1              NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
C2              NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
C3              NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
C4              NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
C5              NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
C6              NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
                **************************************************

C1              RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
C2              RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
C3              RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
C4              RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
C5              RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
C6              RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
                **************************************************

C1              WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
C2              WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
C3              WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
C4              WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
C5              WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
C6              WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
                **************************************************

C1              TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
C2              TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
C3              TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
C4              TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
C5              TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
C6              TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
                **************************************************

C1              LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
C2              LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
C3              LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
C4              LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
C5              LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
C6              LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
                **************************************************

C1              TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
C2              TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
C3              TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
C4              TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
C5              TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
C6              TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
                **************************************************

C1              TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
C2              TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
C3              TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
C4              TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
C5              TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
C6              TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
                **************************************************

C1              GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
C2              GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
C3              GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
C4              GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
C5              GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
C6              GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
                **************************************************

C1              SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
C2              SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
C3              SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
C4              SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
C5              SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
C6              SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
                **************************************************

C1              PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
C2              PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
C3              PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
C4              PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
C5              PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
C6              PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
                ************************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  548 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  548 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [16440]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [16440]--->[16440]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.573 Mb, Max= 31.156 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
C2              MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
C3              MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
C4              MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
C5              MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
C6              MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
                **************************************************

C1              NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
C2              NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
C3              NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
C4              NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
C5              NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
C6              NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
                **************************************************

C1              RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
C2              RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
C3              RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
C4              RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
C5              RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
C6              RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
                **************************************************

C1              WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
C2              WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
C3              WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
C4              WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
C5              WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
C6              WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
                **************************************************

C1              TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
C2              TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
C3              TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
C4              TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
C5              TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
C6              TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
                **************************************************

C1              LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
C2              LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
C3              LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
C4              LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
C5              LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
C6              LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
                **************************************************

C1              TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
C2              TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
C3              TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
C4              TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
C5              TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
C6              TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
                **************************************************

C1              TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
C2              TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
C3              TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
C4              TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
C5              TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
C6              TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
                **************************************************

C1              GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
C2              GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
C3              GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
C4              GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
C5              GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
C6              GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
                **************************************************

C1              SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
C2              SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
C3              SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
C4              SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
C5              SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
C6              SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
                **************************************************

C1              PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
C2              PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
C3              PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
C4              PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
C5              PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
C6              PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
                ************************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAAATCGGAGTCGATTACCAGCAGCAGAGCTCCGGTTGAACAGATAGA
C2              ATGAAATCGGAGTCGATTACCAGCAGCAGAGCTCCGGTTGAACAGATAGA
C3              ATGAAATCGGAGTCGATTACCAGCAGCAGAGCTCCGGTTGAACAGATAGA
C4              ATGAAATCGGAGTCGATTACCAGCAGCAGAGCTCCGGTTGAACAGATAGA
C5              ATGAAATCGGAGTCGATTACCAGCAGCAGAGCTCCGGTTGAACAGATAGA
C6              ATGAAATCGGAGTCGATTACCAGCAGCAGAGCTCCGGTTGAACAGATAGA
                **************************************************

C1              TGCGAGGCTGACTGGCCAATTCGAAAGCCCGAGTATCGCCAGCTTGGTCG
C2              TGCGAGGCTGACTGGCCAATTCGAAAGCCCGAGTATCGCCAGCTTGGTCG
C3              TGCGAGGCTGACTGGCCAATTCGAAAGCCCGAGTATCGCCAGCTTGGTCG
C4              TGCGAGGCTGACTGGCCAATTCGAAAGCCCGAGTATCGCCAGCTTGGTCG
C5              TGCGAGGCTGACTGGCCAATTCGAAAGCCCGAGTATCGCCAGCTTGGTCG
C6              TGCGAGGCTGACTGGCCAATTCGAAAGCCCGAGTATCGCCAGCTTGGTCG
                **************************************************

C1              AGGCGGCAGCAATTCGGAATCCAAGCGCGCCAGCGCTTGTCGTGACCGAC
C2              AGGCGGCAGCAATTCGGAATCCAAGCGCGCCAGCGCTTGTCGTGACCGAC
C3              AGGCGGCAGCAATTCGGAATCCAAGCGCGCCAGCGCTTGTCGTGACCGAC
C4              AGGCGGCAGCAATTCGGAATCCAAGCGCGCCAGCGCTTGTCGTGACCGAC
C5              AGGCGGCAGCAATTCGGAATCCAAGCGCGCCAGCGCTTGTCGTGACCGAC
C6              AGGCGGCAGCAATTCGGAATCCAAGCGCGCCAGCGCTTGTCGTGACCGAC
                **************************************************

C1              AATCGCATAGTGGTGAGCTACCGAGATTTGCTCCGACTGGTCGATGATTT
C2              AATCGCATAGTGGTGAGCTACCGAGATTTGCTCCGACTGGTCGATGATTT
C3              AATCGCATAGTGGTGAGCTACCGAGATTTGCTCCGACTGGTCGATGATTT
C4              AATCGCATAGTGGTGAGCTACCGAGATTTGCTCCGACTGGTCGATGATTT
C5              AATCGCATAGTGGTGAGCTACCGAGATTTGCTCCGACTGGTCGATGATTT
C6              AATCGCATAGTGGTGAGCTACCGAGATTTGCTCCGACTGGTCGATGATTT
                **************************************************

C1              GACCGTCCAGCTGGCGCTGGGTGGCCTGCTGCCTGGCGATCGGGTAGCGC
C2              GACCGTCCAGCTGGCGCTGGGTGGCCTGCTGCCTGGCGATCGGGTAGCGC
C3              GACCGTCCAGCTGGCGCTGGGTGGCCTGCTGCCTGGCGATCGGGTAGCGC
C4              GACCGTCCAGCTGGCGCTGGGTGGCCTGCTGCCTGGCGATCGGGTAGCGC
C5              GACCGTCCAGCTGGCGCTGGGTGGCCTGCTGCCTGGCGATCGGGTAGCGC
C6              GACCGTCCAGCTGGCGCTGGGTGGCCTGCTGCCTGGCGATCGGGTAGCGC
                **************************************************

C1              TGTGCGCGGCTAGCAACATTGAATTCGTTGTAGGCTTACTAGCGGCGTCG
C2              TGTGCGCGGCTAGCAACATTGAATTCGTTGTAGGCTTACTAGCGGCGTCG
C3              TGTGCGCGGCTAGCAACATTGAATTCGTTGTAGGCTTACTAGCGGCGTCG
C4              TGTGCGCGGCTAGCAACATTGAATTCGTTGTAGGCTTACTAGCGGCGTCG
C5              TGTGCGCGGCTAGCAACATTGAATTCGTTGTAGGCTTACTAGCGGCGTCG
C6              TGTGCGCGGCTAGCAACATTGAATTCGTTGTAGGCTTACTAGCGGCGTCG
                **************************************************

C1              CGAGCCGGCCTGATTGTGGTGCCGTTAGATCCGGCTCTACCTGTCAATGA
C2              CGAGCCGGCCTGATTGTGGTGCCGTTAGATCCGGCTCTACCTGTCAATGA
C3              CGAGCCGGCCTGATTGTGGTGCCGTTAGATCCGGCTCTACCTGTCAATGA
C4              CGAGCCGGCCTGATTGTGGTGCCGTTAGATCCGGCTCTACCTGTCAATGA
C5              CGAGCCGGCCTGATTGTGGTGCCGTTAGATCCGGCTCTACCTGTCAATGA
C6              CGAGCCGGCCTGATTGTGGTGCCGTTAGATCCGGCTCTACCTGTCAATGA
                **************************************************

C1              GCAATGCATCCGGAGCCAAGCAGCGGGCGTGCGAGTGACATTGGTGGACA
C2              GCAATGCATCCGGAGCCAAGCAGCGGGCGTGCGAGTGACATTGGTGGACA
C3              GCAATGCATCCGGAGCCAAGCAGCGGGCGTGCGAGTGACATTGGTGGACA
C4              GCAATGCATCCGGAGCCAAGCAGCGGGCGTGCGAGTGACATTGGTGGACA
C5              GCAATGCATCCGGAGCCAAGCAGCGGGCGTGCGAGTGACATTGGTGGACA
C6              GCAATGCATCCGGAGCCAAGCAGCGGGCGTGCGAGTGACATTGGTGGACA
                **************************************************

C1              GTCTTGCCCTTGAAGGCGTTAGCGACCAGCGAGCAGCGACGATGCGCTAC
C2              GTCTTGCCCTTGAAGGCGTTAGCGACCAGCGAGCAGCGACGATGCGCTAC
C3              GTCTTGCCCTTGAAGGCGTTAGCGACCAGCGAGCAGCGACGATGCGCTAC
C4              GTCTTGCCCTTGAAGGCGTTAGCGACCAGCGAGCAGCGACGATGCGCTAC
C5              GTCTTGCCCTTGAAGGCGTTAGCGACCAGCGAGCAGCGACGATGCGCTAC
C6              GTCTTGCCCTTGAAGGCGTTAGCGACCAGCGAGCAGCGACGATGCGCTAC
                **************************************************

C1              TGGCCGATTGCGGTTTCCTACGGTAGCGTCACAGGCGCTTCGGAAGGCAG
C2              TGGCCGATTGCGGTTTCCTACGGTAGCGTCACAGGCGCTTCGGAAGGCAG
C3              TGGCCGATTGCGGTTTCCTACGGTAGCGTCACAGGCGCTTCGGAAGGCAG
C4              TGGCCGATTGCGGTTTCCTACGGTAGCGTCACAGGCGCTTCGGAAGGCAG
C5              TGGCCGATTGCGGTTTCCTACGGTAGCGTCACAGGCGCTTCGGAAGGCAG
C6              TGGCCGATTGCGGTTTCCTACGGTAGCGTCACAGGCGCTTCGGAAGGCAG
                **************************************************

C1              CTTGTTGGTCCACCTGGACGACACTGCGGCGTTGCATCCAGTCACTTCGA
C2              CTTGTTGGTCCACCTGGACGACACTGCGGCGTTGCATCCAGTCACTTCGA
C3              CTTGTTGGTCCACCTGGACGACACTGCGGCGTTGCATCCAGTCACTTCGA
C4              CTTGTTGGTCCACCTGGACGACACTGCGGCGTTGCATCCAGTCACTTCGA
C5              CTTGTTGGTCCACCTGGACGACACTGCGGCGTTGCATCCAGTCACTTCGA
C6              CTTGTTGGTCCACCTGGACGACACTGCGGCGTTGCATCCAGTCACTTCGA
                **************************************************

C1              CGCCTGACGGGCTCCGGCACGATGACGCTATGATCATGTTCACTGGAGGA
C2              CGCCTGACGGGCTCCGGCACGATGACGCTATGATCATGTTCACTGGAGGA
C3              CGCCTGACGGGCTCCGGCACGATGACGCTATGATCATGTTCACTGGAGGA
C4              CGCCTGACGGGCTCCGGCACGATGACGCTATGATCATGTTCACTGGAGGA
C5              CGCCTGACGGGCTCCGGCACGATGACGCTATGATCATGTTCACTGGAGGA
C6              CGCCTGACGGGCTCCGGCACGATGACGCTATGATCATGTTCACTGGAGGA
                **************************************************

C1              ACGACGGGTTTGCCGAAGATGGTCCCGTGGACAGACGGGAATATCGCCGG
C2              ACGACGGGTTTGCCGAAGATGGTCCCGTGGACAGACGGGAATATCGCCGG
C3              ACGACGGGTTTGCCGAAGATGGTCCCGTGGACAGACGGGAATATCGCCGG
C4              ACGACGGGTTTGCCGAAGATGGTCCCGTGGACAGACGGGAATATCGCCGG
C5              ACGACGGGTTTGCCGAAGATGGTCCCGTGGACAGACGGGAATATCGCCGG
C6              ACGACGGGTTTGCCGAAGATGGTCCCGTGGACAGACGGGAATATCGCCGG
                **************************************************

C1              TTCCGTTCACGCCATCATTACCGCGTACCAGCTCGGCCCACAGGATGCGA
C2              TTCCGTTCACGCCATCATTACCGCGTACCAGCTCGGCCCACAGGATGCGA
C3              TTCCGTTCACGCCATCATTACCGCGTACCAGCTCGGCCCACAGGATGCGA
C4              TTCCGTTCACGCCATCATTACCGCGTACCAGCTCGGCCCACAGGATGCGA
C5              TTCCGTTCACGCCATCATTACCGCGTACCAGCTCGGCCCACAGGATGCGA
C6              TTCCGTTCACGCCATCATTACCGCGTACCAGCTCGGCCCACAGGATGCGA
                **************************************************

C1              CTGTCGTGGTGATGCCCCTCTACCATGGTCATGGGCTCATTGCTGCGTTG
C2              CTGTCGTGGTGATGCCCCTCTACCATGGTCATGGGCTCATTGCTGCGTTG
C3              CTGTCGTGGTGATGCCCCTCTACCATGGTCATGGGCTCATTGCTGCGTTG
C4              CTGTCGTGGTGATGCCCCTCTACCATGGTCATGGGCTCATTGCTGCGTTG
C5              CTGTCGTGGTGATGCCCCTCTACCATGGTCATGGGCTCATTGCTGCGTTG
C6              CTGTCGTGGTGATGCCCCTCTACCATGGTCATGGGCTCATTGCTGCGTTG
                **************************************************

C1              CTGTCGACCCTGGCATCTGGAGGTGTGGTGTTGCTCCCTGCTCGCGCGCG
C2              CTGTCGACCCTGGCATCTGGAGGTGTGGTGTTGCTCCCTGCTCGCGCGCG
C3              CTGTCGACCCTGGCATCTGGAGGTGTGGTGTTGCTCCCTGCTCGCGCGCG
C4              CTGTCGACCCTGGCATCTGGAGGTGTGGTGTTGCTCCCTGCTCGCGCGCG
C5              CTGTCGACCCTGGCATCTGGAGGTGTGGTGTTGCTCCCTGCTCGCGCGCG
C6              CTGTCGACCCTGGCATCTGGAGGTGTGGTGTTGCTCCCTGCTCGCGCGCG
                **************************************************

C1              GTTCTCGGCGCGCACATTCTGGGACGACATCGATGCCGTTGCGGCTACTT
C2              GTTCTCGGCGCGCACATTCTGGGACGACATCGATGCCGTTGCGGCTACTT
C3              GTTCTCGGCGCGCACATTCTGGGACGACATCGATGCCGTTGCGGCTACTT
C4              GTTCTCGGCGCGCACATTCTGGGACGACATCGATGCCGTTGCGGCTACTT
C5              GTTCTCGGCGCGCACATTCTGGGACGACATCGATGCCGTTGCGGCTACTT
C6              GTTCTCGGCGCGCACATTCTGGGACGACATCGATGCCGTTGCGGCTACTT
                **************************************************

C1              GGTACACGGCCGCGCCGGCGATTCATCGGATCTTGTTGGAACTCGCTTCT
C2              GGTACACGGCCGCGCCGGCGATTCATCGGATCTTGTTGGAACTCGCTTCT
C3              GGTACACGGCCGCGCCGGCGATTCATCGGATCTTGTTGGAACTCGCTTCT
C4              GGTACACGGCCGCGCCGGCGATTCATCGGATCTTGTTGGAACTCGCTTCT
C5              GGTACACGGCCGCGCCGGCGATTCATCGGATCTTGTTGGAACTCGCTTCT
C6              GGTACACGGCCGCGCCGGCGATTCATCGGATCTTGTTGGAACTCGCTTCT
                **************************************************

C1              ACTCAATCTTTCCGGAGTAAGCGAGCCAAACTCCGCTTTATCCGCAGTTG
C2              ACTCAATCTTTCCGGAGTAAGCGAGCCAAACTCCGCTTTATCCGCAGTTG
C3              ACTCAATCTTTCCGGAGTAAGCGAGCCAAACTCCGCTTTATCCGCAGTTG
C4              ACTCAATCTTTCCGGAGTAAGCGAGCCAAACTCCGCTTTATCCGCAGTTG
C5              ACTCAATCTTTCCGGAGTAAGCGAGCCAAACTCCGCTTTATCCGCAGTTG
C6              ACTCAATCTTTCCGGAGTAAGCGAGCCAAACTCCGCTTTATCCGCAGTTG
                **************************************************

C1              CAGTGCGCCCCTTACCCAGGAAACGGCGCAAGCGCTGCGTGAAGAGTTCT
C2              CAGTGCGCCCCTTACCCAGGAAACGGCGCAAGCGCTGCGTGAAGAGTTCT
C3              CAGTGCGCCCCTTACCCAGGAAACGGCGCAAGCGCTGCGTGAAGAGTTCT
C4              CAGTGCGCCCCTTACCCAGGAAACGGCGCAAGCGCTGCGTGAAGAGTTCT
C5              CAGTGCGCCCCTTACCCAGGAAACGGCGCAAGCGCTGCGTGAAGAGTTCT
C6              CAGTGCGCCCCTTACCCAGGAAACGGCGCAAGCGCTGCGTGAAGAGTTCT
                **************************************************

C1              TGGCGCCGGTGATATGTGCTTTCGGCATGACCGAGGCCACTCACCAGGTG
C2              TGGCGCCGGTGATATGTGCTTTCGGCATGACCGAGGCCACTCACCAGGTG
C3              TGGCGCCGGTGATATGTGCTTTCGGCATGACCGAGGCCACTCACCAGGTG
C4              TGGCGCCGGTGATATGTGCTTTCGGCATGACCGAGGCCACTCACCAGGTG
C5              TGGCGCCGGTGATATGTGCTTTCGGCATGACCGAGGCCACTCACCAGGTG
C6              TGGCGCCGGTGATATGTGCTTTCGGCATGACCGAGGCCACTCACCAGGTG
                **************************************************

C1              ACAACCACAAATATAAAATGGTTCGGCCAAGGGGAGAATCCCACCGTAAC
C2              ACAACCACAAATATAAAATGGTTCGGCCAAGGGGAGAATCCCACCGTAAC
C3              ACAACCACAAATATAAAATGGTTCGGCCAAGGGGAGAATCCCACCGTAAC
C4              ACAACCACAAATATAAAATGGTTCGGCCAAGGGGAGAATCCCACCGTAAC
C5              ACAACCACAAATATAAAATGGTTCGGCCAAGGGGAGAATCCCACCGTAAC
C6              ACAACCACAAATATAAAATGGTTCGGCCAAGGGGAGAATCCCACCGTAAC
                **************************************************

C1              AAACGGTCTTGTCGGTCAGTCAACTGGCGTACAGATCCGCATCGTCGGGT
C2              AAACGGTCTTGTCGGTCAGTCAACTGGCGTACAGATCCGCATCGTCGGGT
C3              AAACGGTCTTGTCGGTCAGTCAACTGGCGTACAGATCCGCATCGTCGGGT
C4              AAACGGTCTTGTCGGTCAGTCAACTGGCGTACAGATCCGCATCGTCGGGT
C5              AAACGGTCTTGTCGGTCAGTCAACTGGCGTACAGATCCGCATCGTCGGGT
C6              AAACGGTCTTGTCGGTCAGTCAACTGGCGTACAGATCCGCATCGTCGGGT
                **************************************************

C1              CCGACGGTCAACCCCTCCCCCCGGATACCGTAGGGGAGGTTTGGTTGCGT
C2              CCGACGGTCAACCCCTCCCCCCGGATACCGTAGGGGAGGTTTGGTTGCGT
C3              CCGACGGTCAACCCCTCCCCCCGGATACCGTAGGGGAGGTTTGGTTGCGT
C4              CCGACGGTCAACCCCTCCCCCCGGATACCGTAGGGGAGGTTTGGTTGCGT
C5              CCGACGGTCAACCCCTCCCCCCGGATACCGTAGGGGAGGTTTGGTTGCGT
C6              CCGACGGTCAACCCCTCCCCCCGGATACCGTAGGGGAGGTTTGGTTGCGT
                **************************************************

C1              GGCTCCACAGTGGTGCGTGGGTATCTGGGTGATCCGGCGATAACCGCAGC
C2              GGCTCCACAGTGGTGCGTGGGTATCTGGGTGATCCGGCGATAACCGCAGC
C3              GGCTCCACAGTGGTGCGTGGGTATCTGGGTGATCCGGCGATAACCGCAGC
C4              GGCTCCACAGTGGTGCGTGGGTATCTGGGTGATCCGGCGATAACCGCAGC
C5              GGCTCCACAGTGGTGCGTGGGTATCTGGGTGATCCGGCGATAACCGCAGC
C6              GGCTCCACAGTGGTGCGTGGGTATCTGGGTGATCCGGCGATAACCGCAGC
                **************************************************

C1              GAACTTCACCCACGGATGGTTGCGTACCGGTGATCTGGGGTCACTGTCGG
C2              GAACTTCACCCACGGATGGTTGCGTACCGGTGATCTGGGGTCACTGTCGG
C3              GAACTTCACCCACGGATGGTTGCGTACCGGTGATCTGGGGTCACTGTCGG
C4              GAACTTCACCCACGGATGGTTGCGTACCGGTGATCTGGGGTCACTGTCGG
C5              GAACTTCACCCACGGATGGTTGCGTACCGGTGATCTGGGGTCACTGTCGG
C6              GAACTTCACCCACGGATGGTTGCGTACCGGTGATCTGGGGTCACTGTCGG
                **************************************************

C1              TAACCGGTGACCTGAGGATCCGTGGCCGGATCAAGGAACTCATAAACCGC
C2              TAACCGGTGACCTGAGGATCCGTGGCCGGATCAAGGAACTCATAAACCGC
C3              TAACCGGTGACCTGAGGATCCGTGGCCGGATCAAGGAACTCATAAACCGC
C4              TAACCGGTGACCTGAGGATCCGTGGCCGGATCAAGGAACTCATAAACCGC
C5              TAACCGGTGACCTGAGGATCCGTGGCCGGATCAAGGAACTCATAAACCGC
C6              TAACCGGTGACCTGAGGATCCGTGGCCGGATCAAGGAACTCATAAACCGC
                **************************************************

C1              TCCGGCGAGAAGATCTCGCCGGAGCGCGTCGAAGGTGTATTGGCCAGTCA
C2              TCCGGCGAGAAGATCTCGCCGGAGCGCGTCGAAGGTGTATTGGCCAGTCA
C3              TCCGGCGAGAAGATCTCGCCGGAGCGCGTCGAAGGTGTATTGGCCAGTCA
C4              TCCGGCGAGAAGATCTCGCCGGAGCGCGTCGAAGGTGTATTGGCCAGTCA
C5              TCCGGCGAGAAGATCTCGCCGGAGCGCGTCGAAGGTGTATTGGCCAGTCA
C6              TCCGGCGAGAAGATCTCGCCGGAGCGCGTCGAAGGTGTATTGGCCAGTCA
                **************************************************

C1              CCACAACGTTATGGAGGTAGCGGTATTTGGTGATCCTGACAAGGTGTACG
C2              CCACAACGTTATGGAGGTAGCGGTATTTGGTGATCCTGACAAGGTGTACG
C3              CCACAACGTTATGGAGGTAGCGGTATTTGGTGATCCTGACAAGGTGTACG
C4              CCACAACGTTATGGAGGTAGCGGTATTTGGTGATCCTGACAAGGTGTACG
C5              CCACAACGTTATGGAGGTAGCGGTATTTGGTGATCCTGACAAGGTGTACG
C6              CCACAACGTTATGGAGGTAGCGGTATTTGGTGATCCTGACAAGGTGTACG
                **************************************************

C1              GGGAGACAGTGACCGCAGTGATTGTTCCTCGCGAGGTCATAGCACCGACT
C2              GGGAGACAGTGACCGCAGTGATTGTTCCTCGCGAGGTCATAGCACCGACT
C3              GGGAGACAGTGACCGCAGTGATTGTTCCTCGCGAGGTCATAGCACCGACT
C4              GGGAGACAGTGACCGCAGTGATTGTTCCTCGCGAGGTCATAGCACCGACT
C5              GGGAGACAGTGACCGCAGTGATTGTTCCTCGCGAGGTCATAGCACCGACT
C6              GGGAGACAGTGACCGCAGTGATTGTTCCTCGCGAGGTCATAGCACCGACT
                **************************************************

C1              CCGTCGGAGCTTGCGGTGTTCTGCCGTGATCGGTTGGCGGCCTTCGAAGT
C2              CCGTCGGAGCTTGCGGTGTTCTGCCGTGATCGGTTGGCGGCCTTCGAAGT
C3              CCGTCGGAGCTTGCGGTGTTCTGCCGTGATCGGTTGGCGGCCTTCGAAGT
C4              CCGTCGGAGCTTGCGGTGTTCTGCCGTGATCGGTTGGCGGCCTTCGAAGT
C5              CCGTCGGAGCTTGCGGTGTTCTGCCGTGATCGGTTGGCGGCCTTCGAAGT
C6              CCGTCGGAGCTTGCGGTGTTCTGCCGTGATCGGTTGGCGGCCTTCGAAGT
                **************************************************

C1              GCCCACCAGATTTCAGGAGGCGAGCGCGCTTCCGCACACCGCCAAAGGTT
C2              GCCCACCAGATTTCAGGAGGCGAGCGCGCTTCCGCACACCGCCAAAGGTT
C3              GCCCACCAGATTTCAGGAGGCGAGCGCGCTTCCGCACACCGCCAAAGGTT
C4              GCCCACCAGATTTCAGGAGGCGAGCGCGCTTCCGCACACCGCCAAAGGTT
C5              GCCCACCAGATTTCAGGAGGCGAGCGCGCTTCCGCACACCGCCAAAGGTT
C6              GCCCACCAGATTTCAGGAGGCGAGCGCGCTTCCGCACACCGCCAAAGGTT
                **************************************************

C1              CGCTCGACCGCCGCGCCGTGGCCGAACAGTTCGCTCATCGGGGG
C2              CGCTCGACCGCCGCGCCGTGGCCGAACAGTTCGCTCATCGGGGG
C3              CGCTCGACCGCCGCGCCGTGGCCGAACAGTTCGCTCATCGGGGG
C4              CGCTCGACCGCCGCGCCGTGGCCGAACAGTTCGCTCATCGGGGG
C5              CGCTCGACCGCCGCGCCGTGGCCGAACAGTTCGCTCATCGGGGG
C6              CGCTCGACCGCCGCGCCGTGGCCGAACAGTTCGCTCATCGGGGG
                ********************************************



>C1
ATGAAATCGGAGTCGATTACCAGCAGCAGAGCTCCGGTTGAACAGATAGA
TGCGAGGCTGACTGGCCAATTCGAAAGCCCGAGTATCGCCAGCTTGGTCG
AGGCGGCAGCAATTCGGAATCCAAGCGCGCCAGCGCTTGTCGTGACCGAC
AATCGCATAGTGGTGAGCTACCGAGATTTGCTCCGACTGGTCGATGATTT
GACCGTCCAGCTGGCGCTGGGTGGCCTGCTGCCTGGCGATCGGGTAGCGC
TGTGCGCGGCTAGCAACATTGAATTCGTTGTAGGCTTACTAGCGGCGTCG
CGAGCCGGCCTGATTGTGGTGCCGTTAGATCCGGCTCTACCTGTCAATGA
GCAATGCATCCGGAGCCAAGCAGCGGGCGTGCGAGTGACATTGGTGGACA
GTCTTGCCCTTGAAGGCGTTAGCGACCAGCGAGCAGCGACGATGCGCTAC
TGGCCGATTGCGGTTTCCTACGGTAGCGTCACAGGCGCTTCGGAAGGCAG
CTTGTTGGTCCACCTGGACGACACTGCGGCGTTGCATCCAGTCACTTCGA
CGCCTGACGGGCTCCGGCACGATGACGCTATGATCATGTTCACTGGAGGA
ACGACGGGTTTGCCGAAGATGGTCCCGTGGACAGACGGGAATATCGCCGG
TTCCGTTCACGCCATCATTACCGCGTACCAGCTCGGCCCACAGGATGCGA
CTGTCGTGGTGATGCCCCTCTACCATGGTCATGGGCTCATTGCTGCGTTG
CTGTCGACCCTGGCATCTGGAGGTGTGGTGTTGCTCCCTGCTCGCGCGCG
GTTCTCGGCGCGCACATTCTGGGACGACATCGATGCCGTTGCGGCTACTT
GGTACACGGCCGCGCCGGCGATTCATCGGATCTTGTTGGAACTCGCTTCT
ACTCAATCTTTCCGGAGTAAGCGAGCCAAACTCCGCTTTATCCGCAGTTG
CAGTGCGCCCCTTACCCAGGAAACGGCGCAAGCGCTGCGTGAAGAGTTCT
TGGCGCCGGTGATATGTGCTTTCGGCATGACCGAGGCCACTCACCAGGTG
ACAACCACAAATATAAAATGGTTCGGCCAAGGGGAGAATCCCACCGTAAC
AAACGGTCTTGTCGGTCAGTCAACTGGCGTACAGATCCGCATCGTCGGGT
CCGACGGTCAACCCCTCCCCCCGGATACCGTAGGGGAGGTTTGGTTGCGT
GGCTCCACAGTGGTGCGTGGGTATCTGGGTGATCCGGCGATAACCGCAGC
GAACTTCACCCACGGATGGTTGCGTACCGGTGATCTGGGGTCACTGTCGG
TAACCGGTGACCTGAGGATCCGTGGCCGGATCAAGGAACTCATAAACCGC
TCCGGCGAGAAGATCTCGCCGGAGCGCGTCGAAGGTGTATTGGCCAGTCA
CCACAACGTTATGGAGGTAGCGGTATTTGGTGATCCTGACAAGGTGTACG
GGGAGACAGTGACCGCAGTGATTGTTCCTCGCGAGGTCATAGCACCGACT
CCGTCGGAGCTTGCGGTGTTCTGCCGTGATCGGTTGGCGGCCTTCGAAGT
GCCCACCAGATTTCAGGAGGCGAGCGCGCTTCCGCACACCGCCAAAGGTT
CGCTCGACCGCCGCGCCGTGGCCGAACAGTTCGCTCATCGGGGG
>C2
ATGAAATCGGAGTCGATTACCAGCAGCAGAGCTCCGGTTGAACAGATAGA
TGCGAGGCTGACTGGCCAATTCGAAAGCCCGAGTATCGCCAGCTTGGTCG
AGGCGGCAGCAATTCGGAATCCAAGCGCGCCAGCGCTTGTCGTGACCGAC
AATCGCATAGTGGTGAGCTACCGAGATTTGCTCCGACTGGTCGATGATTT
GACCGTCCAGCTGGCGCTGGGTGGCCTGCTGCCTGGCGATCGGGTAGCGC
TGTGCGCGGCTAGCAACATTGAATTCGTTGTAGGCTTACTAGCGGCGTCG
CGAGCCGGCCTGATTGTGGTGCCGTTAGATCCGGCTCTACCTGTCAATGA
GCAATGCATCCGGAGCCAAGCAGCGGGCGTGCGAGTGACATTGGTGGACA
GTCTTGCCCTTGAAGGCGTTAGCGACCAGCGAGCAGCGACGATGCGCTAC
TGGCCGATTGCGGTTTCCTACGGTAGCGTCACAGGCGCTTCGGAAGGCAG
CTTGTTGGTCCACCTGGACGACACTGCGGCGTTGCATCCAGTCACTTCGA
CGCCTGACGGGCTCCGGCACGATGACGCTATGATCATGTTCACTGGAGGA
ACGACGGGTTTGCCGAAGATGGTCCCGTGGACAGACGGGAATATCGCCGG
TTCCGTTCACGCCATCATTACCGCGTACCAGCTCGGCCCACAGGATGCGA
CTGTCGTGGTGATGCCCCTCTACCATGGTCATGGGCTCATTGCTGCGTTG
CTGTCGACCCTGGCATCTGGAGGTGTGGTGTTGCTCCCTGCTCGCGCGCG
GTTCTCGGCGCGCACATTCTGGGACGACATCGATGCCGTTGCGGCTACTT
GGTACACGGCCGCGCCGGCGATTCATCGGATCTTGTTGGAACTCGCTTCT
ACTCAATCTTTCCGGAGTAAGCGAGCCAAACTCCGCTTTATCCGCAGTTG
CAGTGCGCCCCTTACCCAGGAAACGGCGCAAGCGCTGCGTGAAGAGTTCT
TGGCGCCGGTGATATGTGCTTTCGGCATGACCGAGGCCACTCACCAGGTG
ACAACCACAAATATAAAATGGTTCGGCCAAGGGGAGAATCCCACCGTAAC
AAACGGTCTTGTCGGTCAGTCAACTGGCGTACAGATCCGCATCGTCGGGT
CCGACGGTCAACCCCTCCCCCCGGATACCGTAGGGGAGGTTTGGTTGCGT
GGCTCCACAGTGGTGCGTGGGTATCTGGGTGATCCGGCGATAACCGCAGC
GAACTTCACCCACGGATGGTTGCGTACCGGTGATCTGGGGTCACTGTCGG
TAACCGGTGACCTGAGGATCCGTGGCCGGATCAAGGAACTCATAAACCGC
TCCGGCGAGAAGATCTCGCCGGAGCGCGTCGAAGGTGTATTGGCCAGTCA
CCACAACGTTATGGAGGTAGCGGTATTTGGTGATCCTGACAAGGTGTACG
GGGAGACAGTGACCGCAGTGATTGTTCCTCGCGAGGTCATAGCACCGACT
CCGTCGGAGCTTGCGGTGTTCTGCCGTGATCGGTTGGCGGCCTTCGAAGT
GCCCACCAGATTTCAGGAGGCGAGCGCGCTTCCGCACACCGCCAAAGGTT
CGCTCGACCGCCGCGCCGTGGCCGAACAGTTCGCTCATCGGGGG
>C3
ATGAAATCGGAGTCGATTACCAGCAGCAGAGCTCCGGTTGAACAGATAGA
TGCGAGGCTGACTGGCCAATTCGAAAGCCCGAGTATCGCCAGCTTGGTCG
AGGCGGCAGCAATTCGGAATCCAAGCGCGCCAGCGCTTGTCGTGACCGAC
AATCGCATAGTGGTGAGCTACCGAGATTTGCTCCGACTGGTCGATGATTT
GACCGTCCAGCTGGCGCTGGGTGGCCTGCTGCCTGGCGATCGGGTAGCGC
TGTGCGCGGCTAGCAACATTGAATTCGTTGTAGGCTTACTAGCGGCGTCG
CGAGCCGGCCTGATTGTGGTGCCGTTAGATCCGGCTCTACCTGTCAATGA
GCAATGCATCCGGAGCCAAGCAGCGGGCGTGCGAGTGACATTGGTGGACA
GTCTTGCCCTTGAAGGCGTTAGCGACCAGCGAGCAGCGACGATGCGCTAC
TGGCCGATTGCGGTTTCCTACGGTAGCGTCACAGGCGCTTCGGAAGGCAG
CTTGTTGGTCCACCTGGACGACACTGCGGCGTTGCATCCAGTCACTTCGA
CGCCTGACGGGCTCCGGCACGATGACGCTATGATCATGTTCACTGGAGGA
ACGACGGGTTTGCCGAAGATGGTCCCGTGGACAGACGGGAATATCGCCGG
TTCCGTTCACGCCATCATTACCGCGTACCAGCTCGGCCCACAGGATGCGA
CTGTCGTGGTGATGCCCCTCTACCATGGTCATGGGCTCATTGCTGCGTTG
CTGTCGACCCTGGCATCTGGAGGTGTGGTGTTGCTCCCTGCTCGCGCGCG
GTTCTCGGCGCGCACATTCTGGGACGACATCGATGCCGTTGCGGCTACTT
GGTACACGGCCGCGCCGGCGATTCATCGGATCTTGTTGGAACTCGCTTCT
ACTCAATCTTTCCGGAGTAAGCGAGCCAAACTCCGCTTTATCCGCAGTTG
CAGTGCGCCCCTTACCCAGGAAACGGCGCAAGCGCTGCGTGAAGAGTTCT
TGGCGCCGGTGATATGTGCTTTCGGCATGACCGAGGCCACTCACCAGGTG
ACAACCACAAATATAAAATGGTTCGGCCAAGGGGAGAATCCCACCGTAAC
AAACGGTCTTGTCGGTCAGTCAACTGGCGTACAGATCCGCATCGTCGGGT
CCGACGGTCAACCCCTCCCCCCGGATACCGTAGGGGAGGTTTGGTTGCGT
GGCTCCACAGTGGTGCGTGGGTATCTGGGTGATCCGGCGATAACCGCAGC
GAACTTCACCCACGGATGGTTGCGTACCGGTGATCTGGGGTCACTGTCGG
TAACCGGTGACCTGAGGATCCGTGGCCGGATCAAGGAACTCATAAACCGC
TCCGGCGAGAAGATCTCGCCGGAGCGCGTCGAAGGTGTATTGGCCAGTCA
CCACAACGTTATGGAGGTAGCGGTATTTGGTGATCCTGACAAGGTGTACG
GGGAGACAGTGACCGCAGTGATTGTTCCTCGCGAGGTCATAGCACCGACT
CCGTCGGAGCTTGCGGTGTTCTGCCGTGATCGGTTGGCGGCCTTCGAAGT
GCCCACCAGATTTCAGGAGGCGAGCGCGCTTCCGCACACCGCCAAAGGTT
CGCTCGACCGCCGCGCCGTGGCCGAACAGTTCGCTCATCGGGGG
>C4
ATGAAATCGGAGTCGATTACCAGCAGCAGAGCTCCGGTTGAACAGATAGA
TGCGAGGCTGACTGGCCAATTCGAAAGCCCGAGTATCGCCAGCTTGGTCG
AGGCGGCAGCAATTCGGAATCCAAGCGCGCCAGCGCTTGTCGTGACCGAC
AATCGCATAGTGGTGAGCTACCGAGATTTGCTCCGACTGGTCGATGATTT
GACCGTCCAGCTGGCGCTGGGTGGCCTGCTGCCTGGCGATCGGGTAGCGC
TGTGCGCGGCTAGCAACATTGAATTCGTTGTAGGCTTACTAGCGGCGTCG
CGAGCCGGCCTGATTGTGGTGCCGTTAGATCCGGCTCTACCTGTCAATGA
GCAATGCATCCGGAGCCAAGCAGCGGGCGTGCGAGTGACATTGGTGGACA
GTCTTGCCCTTGAAGGCGTTAGCGACCAGCGAGCAGCGACGATGCGCTAC
TGGCCGATTGCGGTTTCCTACGGTAGCGTCACAGGCGCTTCGGAAGGCAG
CTTGTTGGTCCACCTGGACGACACTGCGGCGTTGCATCCAGTCACTTCGA
CGCCTGACGGGCTCCGGCACGATGACGCTATGATCATGTTCACTGGAGGA
ACGACGGGTTTGCCGAAGATGGTCCCGTGGACAGACGGGAATATCGCCGG
TTCCGTTCACGCCATCATTACCGCGTACCAGCTCGGCCCACAGGATGCGA
CTGTCGTGGTGATGCCCCTCTACCATGGTCATGGGCTCATTGCTGCGTTG
CTGTCGACCCTGGCATCTGGAGGTGTGGTGTTGCTCCCTGCTCGCGCGCG
GTTCTCGGCGCGCACATTCTGGGACGACATCGATGCCGTTGCGGCTACTT
GGTACACGGCCGCGCCGGCGATTCATCGGATCTTGTTGGAACTCGCTTCT
ACTCAATCTTTCCGGAGTAAGCGAGCCAAACTCCGCTTTATCCGCAGTTG
CAGTGCGCCCCTTACCCAGGAAACGGCGCAAGCGCTGCGTGAAGAGTTCT
TGGCGCCGGTGATATGTGCTTTCGGCATGACCGAGGCCACTCACCAGGTG
ACAACCACAAATATAAAATGGTTCGGCCAAGGGGAGAATCCCACCGTAAC
AAACGGTCTTGTCGGTCAGTCAACTGGCGTACAGATCCGCATCGTCGGGT
CCGACGGTCAACCCCTCCCCCCGGATACCGTAGGGGAGGTTTGGTTGCGT
GGCTCCACAGTGGTGCGTGGGTATCTGGGTGATCCGGCGATAACCGCAGC
GAACTTCACCCACGGATGGTTGCGTACCGGTGATCTGGGGTCACTGTCGG
TAACCGGTGACCTGAGGATCCGTGGCCGGATCAAGGAACTCATAAACCGC
TCCGGCGAGAAGATCTCGCCGGAGCGCGTCGAAGGTGTATTGGCCAGTCA
CCACAACGTTATGGAGGTAGCGGTATTTGGTGATCCTGACAAGGTGTACG
GGGAGACAGTGACCGCAGTGATTGTTCCTCGCGAGGTCATAGCACCGACT
CCGTCGGAGCTTGCGGTGTTCTGCCGTGATCGGTTGGCGGCCTTCGAAGT
GCCCACCAGATTTCAGGAGGCGAGCGCGCTTCCGCACACCGCCAAAGGTT
CGCTCGACCGCCGCGCCGTGGCCGAACAGTTCGCTCATCGGGGG
>C5
ATGAAATCGGAGTCGATTACCAGCAGCAGAGCTCCGGTTGAACAGATAGA
TGCGAGGCTGACTGGCCAATTCGAAAGCCCGAGTATCGCCAGCTTGGTCG
AGGCGGCAGCAATTCGGAATCCAAGCGCGCCAGCGCTTGTCGTGACCGAC
AATCGCATAGTGGTGAGCTACCGAGATTTGCTCCGACTGGTCGATGATTT
GACCGTCCAGCTGGCGCTGGGTGGCCTGCTGCCTGGCGATCGGGTAGCGC
TGTGCGCGGCTAGCAACATTGAATTCGTTGTAGGCTTACTAGCGGCGTCG
CGAGCCGGCCTGATTGTGGTGCCGTTAGATCCGGCTCTACCTGTCAATGA
GCAATGCATCCGGAGCCAAGCAGCGGGCGTGCGAGTGACATTGGTGGACA
GTCTTGCCCTTGAAGGCGTTAGCGACCAGCGAGCAGCGACGATGCGCTAC
TGGCCGATTGCGGTTTCCTACGGTAGCGTCACAGGCGCTTCGGAAGGCAG
CTTGTTGGTCCACCTGGACGACACTGCGGCGTTGCATCCAGTCACTTCGA
CGCCTGACGGGCTCCGGCACGATGACGCTATGATCATGTTCACTGGAGGA
ACGACGGGTTTGCCGAAGATGGTCCCGTGGACAGACGGGAATATCGCCGG
TTCCGTTCACGCCATCATTACCGCGTACCAGCTCGGCCCACAGGATGCGA
CTGTCGTGGTGATGCCCCTCTACCATGGTCATGGGCTCATTGCTGCGTTG
CTGTCGACCCTGGCATCTGGAGGTGTGGTGTTGCTCCCTGCTCGCGCGCG
GTTCTCGGCGCGCACATTCTGGGACGACATCGATGCCGTTGCGGCTACTT
GGTACACGGCCGCGCCGGCGATTCATCGGATCTTGTTGGAACTCGCTTCT
ACTCAATCTTTCCGGAGTAAGCGAGCCAAACTCCGCTTTATCCGCAGTTG
CAGTGCGCCCCTTACCCAGGAAACGGCGCAAGCGCTGCGTGAAGAGTTCT
TGGCGCCGGTGATATGTGCTTTCGGCATGACCGAGGCCACTCACCAGGTG
ACAACCACAAATATAAAATGGTTCGGCCAAGGGGAGAATCCCACCGTAAC
AAACGGTCTTGTCGGTCAGTCAACTGGCGTACAGATCCGCATCGTCGGGT
CCGACGGTCAACCCCTCCCCCCGGATACCGTAGGGGAGGTTTGGTTGCGT
GGCTCCACAGTGGTGCGTGGGTATCTGGGTGATCCGGCGATAACCGCAGC
GAACTTCACCCACGGATGGTTGCGTACCGGTGATCTGGGGTCACTGTCGG
TAACCGGTGACCTGAGGATCCGTGGCCGGATCAAGGAACTCATAAACCGC
TCCGGCGAGAAGATCTCGCCGGAGCGCGTCGAAGGTGTATTGGCCAGTCA
CCACAACGTTATGGAGGTAGCGGTATTTGGTGATCCTGACAAGGTGTACG
GGGAGACAGTGACCGCAGTGATTGTTCCTCGCGAGGTCATAGCACCGACT
CCGTCGGAGCTTGCGGTGTTCTGCCGTGATCGGTTGGCGGCCTTCGAAGT
GCCCACCAGATTTCAGGAGGCGAGCGCGCTTCCGCACACCGCCAAAGGTT
CGCTCGACCGCCGCGCCGTGGCCGAACAGTTCGCTCATCGGGGG
>C6
ATGAAATCGGAGTCGATTACCAGCAGCAGAGCTCCGGTTGAACAGATAGA
TGCGAGGCTGACTGGCCAATTCGAAAGCCCGAGTATCGCCAGCTTGGTCG
AGGCGGCAGCAATTCGGAATCCAAGCGCGCCAGCGCTTGTCGTGACCGAC
AATCGCATAGTGGTGAGCTACCGAGATTTGCTCCGACTGGTCGATGATTT
GACCGTCCAGCTGGCGCTGGGTGGCCTGCTGCCTGGCGATCGGGTAGCGC
TGTGCGCGGCTAGCAACATTGAATTCGTTGTAGGCTTACTAGCGGCGTCG
CGAGCCGGCCTGATTGTGGTGCCGTTAGATCCGGCTCTACCTGTCAATGA
GCAATGCATCCGGAGCCAAGCAGCGGGCGTGCGAGTGACATTGGTGGACA
GTCTTGCCCTTGAAGGCGTTAGCGACCAGCGAGCAGCGACGATGCGCTAC
TGGCCGATTGCGGTTTCCTACGGTAGCGTCACAGGCGCTTCGGAAGGCAG
CTTGTTGGTCCACCTGGACGACACTGCGGCGTTGCATCCAGTCACTTCGA
CGCCTGACGGGCTCCGGCACGATGACGCTATGATCATGTTCACTGGAGGA
ACGACGGGTTTGCCGAAGATGGTCCCGTGGACAGACGGGAATATCGCCGG
TTCCGTTCACGCCATCATTACCGCGTACCAGCTCGGCCCACAGGATGCGA
CTGTCGTGGTGATGCCCCTCTACCATGGTCATGGGCTCATTGCTGCGTTG
CTGTCGACCCTGGCATCTGGAGGTGTGGTGTTGCTCCCTGCTCGCGCGCG
GTTCTCGGCGCGCACATTCTGGGACGACATCGATGCCGTTGCGGCTACTT
GGTACACGGCCGCGCCGGCGATTCATCGGATCTTGTTGGAACTCGCTTCT
ACTCAATCTTTCCGGAGTAAGCGAGCCAAACTCCGCTTTATCCGCAGTTG
CAGTGCGCCCCTTACCCAGGAAACGGCGCAAGCGCTGCGTGAAGAGTTCT
TGGCGCCGGTGATATGTGCTTTCGGCATGACCGAGGCCACTCACCAGGTG
ACAACCACAAATATAAAATGGTTCGGCCAAGGGGAGAATCCCACCGTAAC
AAACGGTCTTGTCGGTCAGTCAACTGGCGTACAGATCCGCATCGTCGGGT
CCGACGGTCAACCCCTCCCCCCGGATACCGTAGGGGAGGTTTGGTTGCGT
GGCTCCACAGTGGTGCGTGGGTATCTGGGTGATCCGGCGATAACCGCAGC
GAACTTCACCCACGGATGGTTGCGTACCGGTGATCTGGGGTCACTGTCGG
TAACCGGTGACCTGAGGATCCGTGGCCGGATCAAGGAACTCATAAACCGC
TCCGGCGAGAAGATCTCGCCGGAGCGCGTCGAAGGTGTATTGGCCAGTCA
CCACAACGTTATGGAGGTAGCGGTATTTGGTGATCCTGACAAGGTGTACG
GGGAGACAGTGACCGCAGTGATTGTTCCTCGCGAGGTCATAGCACCGACT
CCGTCGGAGCTTGCGGTGTTCTGCCGTGATCGGTTGGCGGCCTTCGAAGT
GCCCACCAGATTTCAGGAGGCGAGCGCGCTTCCGCACACCGCCAAAGGTT
CGCTCGACCGCCGCGCCGTGGCCGAACAGTTCGCTCATCGGGGG
>C1
MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
>C2
MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
>C3
MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
>C4
MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
>C5
MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG
>C6
MKSESITSSRAPVEQIDARLTGQFESPSIASLVEAAAIRNPSAPALVVTD
NRIVVSYRDLLRLVDDLTVQLALGGLLPGDRVALCAASNIEFVVGLLAAS
RAGLIVVPLDPALPVNEQCIRSQAAGVRVTLVDSLALEGVSDQRAATMRY
WPIAVSYGSVTGASEGSLLVHLDDTAALHPVTSTPDGLRHDDAMIMFTGG
TTGLPKMVPWTDGNIAGSVHAIITAYQLGPQDATVVVMPLYHGHGLIAAL
LSTLASGGVVLLPARARFSARTFWDDIDAVAATWYTAAPAIHRILLELAS
TQSFRSKRAKLRFIRSCSAPLTQETAQALREEFLAPVICAFGMTEATHQV
TTTNIKWFGQGENPTVTNGLVGQSTGVQIRIVGSDGQPLPPDTVGEVWLR
GSTVVRGYLGDPAITAANFTHGWLRTGDLGSLSVTGDLRIRGRIKELINR
SGEKISPERVEGVLASHHNVMEVAVFGDPDKVYGETVTAVIVPREVIAPT
PSELAVFCRDRLAAFEVPTRFQEASALPHTAKGSLDRRAVAEQFAHRG


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/9res/ML2661/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1644 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579860101
      Setting output file names to "/data/9res/ML2661/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1148438239
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5267521139
      Seed = 2146816902
      Swapseed = 1579860101
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3679.350810 -- -24.965149
         Chain 2 -- -3679.350598 -- -24.965149
         Chain 3 -- -3679.350810 -- -24.965149
         Chain 4 -- -3679.350810 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3679.350598 -- -24.965149
         Chain 2 -- -3679.350250 -- -24.965149
         Chain 3 -- -3679.350598 -- -24.965149
         Chain 4 -- -3679.350810 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3679.351] (-3679.351) (-3679.351) (-3679.351) * [-3679.351] (-3679.350) (-3679.351) (-3679.351) 
        500 -- (-2254.141) (-2261.319) (-2262.235) [-2259.233] * [-2265.196] (-2259.134) (-2267.234) (-2280.498) -- 0:00:00
       1000 -- (-2257.976) [-2260.904] (-2254.859) (-2256.652) * [-2258.538] (-2256.298) (-2266.274) (-2258.167) -- 0:00:00
       1500 -- (-2259.531) (-2256.259) (-2261.380) [-2255.969] * (-2254.751) [-2261.624] (-2255.757) (-2264.900) -- 0:00:00
       2000 -- (-2251.039) (-2256.680) [-2252.114] (-2258.894) * (-2261.585) (-2254.014) [-2253.648] (-2255.564) -- 0:00:00
       2500 -- (-2260.084) [-2253.380] (-2251.927) (-2256.856) * (-2257.919) [-2251.530] (-2262.357) (-2262.107) -- 0:00:00
       3000 -- (-2255.900) [-2256.391] (-2256.271) (-2252.273) * (-2256.295) [-2256.029] (-2254.103) (-2259.384) -- 0:00:00
       3500 -- [-2252.652] (-2253.027) (-2262.453) (-2264.069) * (-2259.163) (-2263.265) (-2256.841) [-2261.841] -- 0:00:00
       4000 -- [-2256.176] (-2258.450) (-2257.649) (-2253.756) * (-2262.942) (-2259.928) (-2255.906) [-2255.674] -- 0:00:00
       4500 -- (-2255.322) (-2255.198) [-2263.687] (-2257.945) * (-2258.877) (-2260.150) (-2258.072) [-2257.163] -- 0:00:00
       5000 -- (-2260.445) [-2257.434] (-2254.042) (-2263.759) * (-2254.086) [-2254.217] (-2257.102) (-2256.694) -- 0:00:00

      Average standard deviation of split frequencies: 0.075151

       5500 -- [-2252.113] (-2253.254) (-2255.230) (-2262.061) * (-2256.773) (-2256.831) (-2256.898) [-2254.251] -- 0:00:00
       6000 -- (-2253.561) [-2255.432] (-2257.199) (-2255.110) * [-2250.625] (-2257.380) (-2254.508) (-2262.236) -- 0:02:45
       6500 -- (-2254.716) (-2260.067) [-2254.658] (-2259.890) * [-2249.856] (-2253.201) (-2260.402) (-2262.154) -- 0:02:32
       7000 -- (-2253.647) (-2262.306) [-2250.477] (-2273.293) * (-2260.322) [-2253.892] (-2260.945) (-2256.499) -- 0:02:21
       7500 -- (-2253.091) [-2258.680] (-2249.746) (-2254.413) * (-2259.325) [-2262.467] (-2263.897) (-2253.450) -- 0:02:12
       8000 -- (-2255.446) (-2260.103) [-2254.868] (-2260.943) * (-2264.230) (-2256.413) [-2255.875] (-2255.654) -- 0:02:04
       8500 -- (-2259.590) [-2259.559] (-2253.916) (-2259.646) * [-2250.464] (-2255.969) (-2251.854) (-2256.273) -- 0:01:56
       9000 -- (-2254.857) [-2255.161] (-2255.965) (-2256.626) * [-2265.741] (-2256.967) (-2261.106) (-2253.683) -- 0:01:50
       9500 -- (-2257.516) [-2253.667] (-2253.226) (-2254.120) * (-2259.420) [-2255.581] (-2255.962) (-2255.040) -- 0:01:44
      10000 -- (-2256.220) (-2256.203) (-2251.935) [-2255.357] * (-2259.496) (-2253.044) (-2253.877) [-2249.614] -- 0:01:39

      Average standard deviation of split frequencies: 0.074432

      10500 -- (-2254.602) [-2258.950] (-2261.009) (-2260.381) * (-2259.791) (-2256.628) (-2254.086) [-2255.796] -- 0:01:34
      11000 -- [-2257.421] (-2258.001) (-2257.162) (-2258.922) * (-2261.624) (-2245.744) [-2251.003] (-2259.083) -- 0:01:29
      11500 -- (-2259.784) [-2257.147] (-2261.638) (-2264.012) * (-2257.311) (-2245.338) [-2254.576] (-2256.945) -- 0:01:25
      12000 -- (-2263.451) [-2255.527] (-2253.574) (-2255.230) * [-2253.336] (-2245.272) (-2260.556) (-2253.308) -- 0:01:22
      12500 -- (-2251.538) (-2251.373) [-2255.144] (-2252.200) * (-2253.577) [-2245.296] (-2251.045) (-2255.332) -- 0:01:19
      13000 -- (-2248.190) (-2258.593) [-2254.552] (-2248.721) * (-2259.331) [-2245.375] (-2255.145) (-2262.148) -- 0:01:15
      13500 -- (-2248.147) (-2256.857) (-2252.294) [-2248.021] * [-2260.408] (-2246.325) (-2259.438) (-2257.181) -- 0:01:13
      14000 -- [-2250.063] (-2262.718) (-2265.038) (-2247.523) * [-2254.977] (-2246.413) (-2264.957) (-2260.314) -- 0:01:10
      14500 -- (-2250.079) (-2252.111) [-2257.460] (-2248.209) * (-2258.544) (-2249.878) (-2259.151) [-2257.401] -- 0:01:07
      15000 -- (-2246.295) [-2252.986] (-2264.698) (-2247.678) * (-2255.276) (-2251.420) (-2256.378) [-2252.300] -- 0:01:05

      Average standard deviation of split frequencies: 0.067764

      15500 -- [-2246.370] (-2259.096) (-2253.853) (-2246.848) * [-2264.079] (-2251.244) (-2261.869) (-2258.250) -- 0:01:03
      16000 -- (-2247.234) (-2259.051) (-2263.879) [-2248.322] * [-2253.546] (-2256.222) (-2254.865) (-2259.811) -- 0:01:01
      16500 -- [-2247.208] (-2256.274) (-2258.543) (-2249.192) * (-2261.969) (-2249.293) (-2254.175) [-2249.350] -- 0:00:59
      17000 -- [-2246.800] (-2258.549) (-2247.031) (-2247.221) * [-2254.441] (-2249.849) (-2257.571) (-2264.925) -- 0:01:55
      17500 -- [-2246.949] (-2254.969) (-2248.885) (-2247.583) * (-2257.314) [-2251.505] (-2258.076) (-2260.588) -- 0:01:52
      18000 -- (-2247.224) (-2261.700) (-2250.738) [-2246.978] * (-2255.823) [-2252.425] (-2252.775) (-2265.092) -- 0:01:49
      18500 -- [-2249.242] (-2257.586) (-2248.641) (-2254.836) * [-2255.438] (-2248.810) (-2251.918) (-2263.794) -- 0:01:46
      19000 -- [-2248.247] (-2259.878) (-2246.633) (-2248.047) * (-2254.893) (-2248.165) [-2255.308] (-2254.514) -- 0:01:43
      19500 -- (-2247.043) [-2252.643] (-2245.722) (-2248.189) * [-2252.744] (-2247.775) (-2249.815) (-2258.454) -- 0:01:40
      20000 -- [-2249.778] (-2257.120) (-2245.559) (-2248.538) * (-2258.391) [-2248.527] (-2252.547) (-2257.869) -- 0:01:38

      Average standard deviation of split frequencies: 0.054490

      20500 -- (-2247.876) [-2253.434] (-2245.358) (-2247.823) * (-2260.194) [-2247.447] (-2247.738) (-2257.665) -- 0:01:35
      21000 -- (-2248.035) (-2257.621) [-2247.925] (-2247.008) * (-2254.669) (-2246.446) (-2249.538) [-2251.973] -- 0:01:33
      21500 -- [-2247.136] (-2253.402) (-2247.052) (-2246.793) * (-2259.803) (-2246.234) [-2247.270] (-2257.089) -- 0:01:31
      22000 -- (-2247.341) [-2255.666] (-2250.511) (-2248.770) * (-2259.705) (-2248.752) (-2246.339) [-2255.235] -- 0:01:28
      22500 -- (-2249.984) [-2253.875] (-2248.676) (-2250.373) * (-2257.726) (-2246.629) (-2246.574) [-2255.457] -- 0:01:26
      23000 -- (-2248.795) [-2253.796] (-2247.794) (-2249.535) * (-2252.379) [-2246.139] (-2247.240) (-2258.324) -- 0:01:24
      23500 -- (-2247.766) (-2260.266) (-2250.260) [-2250.611] * (-2253.406) [-2246.419] (-2247.314) (-2253.056) -- 0:01:23
      24000 -- (-2249.469) [-2252.158] (-2248.883) (-2249.781) * [-2254.838] (-2248.452) (-2248.269) (-2253.338) -- 0:01:21
      24500 -- (-2248.217) (-2256.718) [-2248.073] (-2247.488) * [-2255.895] (-2248.984) (-2252.932) (-2252.942) -- 0:01:19
      25000 -- (-2246.741) [-2254.124] (-2249.014) (-2246.002) * (-2256.426) (-2247.996) [-2247.944] (-2257.570) -- 0:01:18

      Average standard deviation of split frequencies: 0.044421

      25500 -- (-2246.690) (-2270.391) (-2246.643) [-2247.983] * (-2265.761) [-2245.998] (-2247.679) (-2259.944) -- 0:01:54
      26000 -- (-2247.342) (-2258.389) [-2246.122] (-2250.038) * (-2251.894) [-2246.504] (-2246.217) (-2254.122) -- 0:01:52
      26500 -- (-2247.180) [-2252.683] (-2253.700) (-2247.550) * (-2264.693) (-2246.364) (-2245.860) [-2256.456] -- 0:01:50
      27000 -- (-2246.823) [-2251.549] (-2252.116) (-2246.417) * [-2255.589] (-2246.344) (-2246.724) (-2257.076) -- 0:01:48
      27500 -- (-2248.966) (-2256.905) (-2246.719) [-2245.703] * (-2253.172) [-2247.594] (-2246.724) (-2261.878) -- 0:01:46
      28000 -- [-2249.099] (-2255.949) (-2246.719) (-2246.498) * (-2257.175) (-2246.122) [-2246.810] (-2259.466) -- 0:01:44
      28500 -- (-2248.167) [-2255.226] (-2247.516) (-2246.453) * (-2253.497) [-2246.697] (-2247.717) (-2257.006) -- 0:01:42
      29000 -- [-2247.818] (-2256.825) (-2249.411) (-2246.051) * (-2265.585) (-2249.704) (-2246.039) [-2254.961] -- 0:01:40
      29500 -- [-2248.009] (-2251.290) (-2249.050) (-2248.041) * (-2256.715) (-2248.442) (-2245.840) [-2265.446] -- 0:01:38
      30000 -- (-2251.291) [-2257.973] (-2248.252) (-2246.322) * (-2255.378) (-2247.756) (-2245.811) [-2257.367] -- 0:01:37

      Average standard deviation of split frequencies: 0.049044

      30500 -- (-2252.591) [-2251.481] (-2248.166) (-2249.299) * [-2258.354] (-2247.584) (-2248.505) (-2256.184) -- 0:01:35
      31000 -- (-2254.332) (-2258.486) (-2247.241) [-2249.235] * (-2260.496) (-2247.885) (-2247.399) [-2253.852] -- 0:01:33
      31500 -- (-2246.442) (-2254.986) (-2247.124) [-2249.972] * [-2264.898] (-2248.145) (-2246.805) (-2255.139) -- 0:01:32
      32000 -- [-2247.760] (-2255.175) (-2247.813) (-2249.601) * (-2262.576) (-2249.459) (-2247.196) [-2257.743] -- 0:01:30
      32500 -- (-2246.503) (-2255.722) [-2248.325] (-2251.502) * (-2253.646) (-2248.900) (-2247.622) [-2255.300] -- 0:01:29
      33000 -- [-2246.594] (-2257.453) (-2247.147) (-2246.267) * (-2261.417) [-2248.639] (-2248.423) (-2255.828) -- 0:01:27
      33500 -- (-2246.779) (-2260.954) (-2245.853) [-2247.973] * (-2262.273) (-2247.736) [-2247.229] (-2260.997) -- 0:01:26
      34000 -- (-2247.440) (-2259.661) (-2247.749) [-2247.977] * [-2257.323] (-2247.775) (-2245.546) (-2260.074) -- 0:01:25
      34500 -- (-2247.576) (-2262.797) (-2250.538) [-2249.813] * [-2260.920] (-2246.730) (-2245.542) (-2256.211) -- 0:01:23
      35000 -- (-2247.576) [-2256.932] (-2246.264) (-2248.118) * (-2258.912) (-2246.242) [-2245.534] (-2256.162) -- 0:01:22

      Average standard deviation of split frequencies: 0.043867

      35500 -- (-2247.280) [-2253.597] (-2246.193) (-2249.457) * (-2253.799) [-2246.617] (-2247.733) (-2259.284) -- 0:01:21
      36000 -- (-2247.621) [-2254.465] (-2248.027) (-2249.414) * (-2258.609) [-2245.518] (-2247.687) (-2260.050) -- 0:01:20
      36500 -- (-2248.261) (-2254.699) [-2247.532] (-2247.559) * (-2271.395) (-2245.501) [-2250.538] (-2251.893) -- 0:01:19
      37000 -- [-2250.803] (-2263.768) (-2247.757) (-2250.141) * [-2262.951] (-2245.516) (-2246.413) (-2253.715) -- 0:01:18
      37500 -- (-2250.841) [-2255.703] (-2247.927) (-2250.340) * (-2250.786) [-2245.756] (-2247.871) (-2255.717) -- 0:01:17
      38000 -- (-2249.512) [-2259.120] (-2245.870) (-2252.847) * (-2256.015) (-2249.406) (-2246.194) [-2254.096] -- 0:01:15
      38500 -- (-2247.346) [-2256.899] (-2246.245) (-2249.337) * [-2255.220] (-2249.264) (-2245.995) (-2256.698) -- 0:01:39
      39000 -- (-2247.416) [-2267.373] (-2245.818) (-2248.498) * (-2255.233) (-2249.265) (-2245.729) [-2254.258] -- 0:01:38
      39500 -- (-2247.353) [-2260.737] (-2247.299) (-2247.488) * [-2251.457] (-2247.594) (-2247.560) (-2255.157) -- 0:01:37
      40000 -- [-2247.333] (-2255.987) (-2246.715) (-2246.285) * [-2258.174] (-2249.536) (-2248.380) (-2255.816) -- 0:01:36

      Average standard deviation of split frequencies: 0.043470

      40500 -- (-2247.332) (-2257.369) [-2247.009] (-2247.795) * (-2254.687) (-2246.289) (-2245.497) [-2259.939] -- 0:01:34
      41000 -- (-2246.983) (-2256.137) [-2247.214] (-2245.982) * (-2255.230) [-2245.875] (-2245.433) (-2262.078) -- 0:01:33
      41500 -- (-2246.697) (-2261.020) (-2247.996) [-2248.740] * (-2265.003) (-2249.912) (-2247.205) [-2258.644] -- 0:01:32
      42000 -- [-2246.451] (-2252.343) (-2246.530) (-2249.444) * (-2260.881) [-2247.634] (-2247.205) (-2264.816) -- 0:01:31
      42500 -- (-2248.921) [-2252.368] (-2248.028) (-2246.322) * (-2263.755) (-2247.639) (-2246.252) [-2254.448] -- 0:01:30
      43000 -- (-2249.227) (-2257.534) (-2246.698) [-2246.972] * (-2261.148) [-2250.000] (-2253.575) (-2256.921) -- 0:01:29
      43500 -- (-2249.308) (-2251.881) [-2248.608] (-2246.565) * (-2256.567) (-2250.505) [-2246.864] (-2258.702) -- 0:01:27
      44000 -- [-2246.781] (-2258.562) (-2249.536) (-2246.893) * [-2252.514] (-2251.308) (-2248.395) (-2257.772) -- 0:01:26
      44500 -- (-2247.351) [-2260.939] (-2247.645) (-2246.872) * (-2258.176) (-2245.703) [-2247.125] (-2255.923) -- 0:01:25
      45000 -- (-2249.154) (-2258.245) (-2248.977) [-2245.926] * (-2257.928) (-2246.852) [-2246.409] (-2251.790) -- 0:01:24

      Average standard deviation of split frequencies: 0.037088

      45500 -- (-2247.667) [-2257.796] (-2254.485) (-2247.049) * (-2261.300) (-2247.019) (-2247.958) [-2260.555] -- 0:01:23
      46000 -- (-2247.224) [-2256.068] (-2247.696) (-2247.187) * [-2253.364] (-2255.549) (-2253.350) (-2265.330) -- 0:01:22
      46500 -- [-2246.292] (-2260.853) (-2247.246) (-2246.240) * (-2255.819) (-2256.649) (-2253.685) [-2256.639] -- 0:01:22
      47000 -- (-2253.574) [-2253.948] (-2246.164) (-2247.687) * (-2261.890) [-2246.604] (-2249.259) (-2254.548) -- 0:01:21
      47500 -- (-2253.645) (-2258.912) [-2247.569] (-2250.231) * (-2257.856) (-2246.082) (-2247.880) [-2252.085] -- 0:01:20
      48000 -- [-2253.776] (-2259.184) (-2248.323) (-2246.727) * [-2253.794] (-2247.148) (-2246.935) (-2262.181) -- 0:01:19
      48500 -- (-2252.565) (-2260.190) [-2246.868] (-2249.038) * (-2250.959) (-2246.697) [-2246.643] (-2264.284) -- 0:01:18
      49000 -- [-2249.080] (-2259.653) (-2249.937) (-2246.467) * (-2257.336) (-2245.537) (-2246.430) [-2253.211] -- 0:01:17
      49500 -- (-2247.156) [-2251.308] (-2250.441) (-2246.383) * (-2256.682) [-2246.115] (-2246.832) (-2257.279) -- 0:01:16
      50000 -- (-2249.261) [-2251.361] (-2246.691) (-2246.884) * (-2258.059) (-2246.655) [-2246.825] (-2271.398) -- 0:01:16

      Average standard deviation of split frequencies: 0.034890

      50500 -- (-2248.837) (-2254.449) [-2246.271] (-2247.144) * (-2257.693) (-2246.219) [-2246.848] (-2257.867) -- 0:01:15
      51000 -- (-2249.387) [-2251.337] (-2248.062) (-2247.157) * (-2258.628) (-2245.771) [-2248.831] (-2260.627) -- 0:01:14
      51500 -- [-2245.562] (-2252.514) (-2248.001) (-2247.983) * (-2259.754) (-2245.997) (-2248.536) [-2255.810] -- 0:01:13
      52000 -- (-2245.574) [-2258.664] (-2250.943) (-2246.701) * (-2255.645) (-2245.997) (-2246.877) [-2256.774] -- 0:01:12
      52500 -- (-2246.593) (-2254.526) (-2245.801) [-2246.321] * [-2264.129] (-2247.414) (-2246.903) (-2261.290) -- 0:01:12
      53000 -- [-2249.880] (-2259.379) (-2246.864) (-2248.505) * [-2252.732] (-2247.392) (-2245.439) (-2257.018) -- 0:01:29
      53500 -- (-2249.557) (-2251.463) (-2246.327) [-2248.486] * (-2256.041) (-2246.844) [-2246.950] (-2267.194) -- 0:01:28
      54000 -- (-2246.568) (-2261.280) [-2246.640] (-2247.507) * [-2255.967] (-2247.556) (-2247.328) (-2263.687) -- 0:01:27
      54500 -- (-2247.303) (-2258.937) (-2245.953) [-2246.388] * (-2255.012) [-2247.070] (-2247.589) (-2253.858) -- 0:01:26
      55000 -- [-2246.834] (-2262.079) (-2246.622) (-2246.213) * (-2254.370) (-2246.812) [-2247.522] (-2252.843) -- 0:01:25

      Average standard deviation of split frequencies: 0.030398

      55500 -- (-2246.004) (-2255.912) [-2245.419] (-2248.361) * [-2251.137] (-2246.893) (-2248.967) (-2251.915) -- 0:01:25
      56000 -- (-2247.384) [-2258.414] (-2245.703) (-2247.406) * (-2264.782) (-2247.268) [-2252.638] (-2247.742) -- 0:01:24
      56500 -- [-2246.879] (-2255.348) (-2245.687) (-2249.433) * [-2257.638] (-2247.269) (-2251.762) (-2247.868) -- 0:01:23
      57000 -- [-2245.864] (-2252.618) (-2246.082) (-2247.143) * (-2258.160) (-2247.394) (-2247.723) [-2247.307] -- 0:01:22
      57500 -- [-2245.563] (-2262.937) (-2248.160) (-2246.705) * (-2255.236) [-2246.285] (-2245.743) (-2247.257) -- 0:01:21
      58000 -- [-2245.974] (-2256.761) (-2248.364) (-2245.765) * (-2260.878) (-2246.427) [-2245.847] (-2249.005) -- 0:01:21
      58500 -- (-2245.342) (-2251.128) (-2246.950) [-2245.850] * (-2253.499) (-2246.258) (-2249.220) [-2246.126] -- 0:01:20
      59000 -- (-2246.297) [-2252.784] (-2246.268) (-2245.536) * (-2254.189) [-2246.466] (-2247.714) (-2246.926) -- 0:01:19
      59500 -- (-2248.563) (-2254.020) (-2247.701) [-2246.063] * (-2260.137) [-2245.807] (-2247.641) (-2247.118) -- 0:01:19
      60000 -- [-2248.016] (-2253.931) (-2247.333) (-2246.260) * (-2260.193) (-2246.942) [-2248.741] (-2247.357) -- 0:01:18

      Average standard deviation of split frequencies: 0.032636

      60500 -- (-2247.284) (-2250.070) [-2246.142] (-2248.040) * (-2267.911) [-2247.615] (-2253.187) (-2248.972) -- 0:01:17
      61000 -- [-2246.350] (-2261.750) (-2245.954) (-2246.587) * [-2254.987] (-2249.915) (-2252.750) (-2247.017) -- 0:01:16
      61500 -- (-2246.552) (-2261.191) [-2246.254] (-2247.556) * (-2260.609) [-2248.233] (-2248.023) (-2248.130) -- 0:01:16
      62000 -- (-2246.280) (-2258.210) [-2248.877] (-2247.414) * [-2253.687] (-2246.188) (-2249.447) (-2248.982) -- 0:01:15
      62500 -- (-2247.413) (-2254.895) [-2248.171] (-2246.917) * (-2252.140) (-2247.871) [-2246.812] (-2248.666) -- 0:01:15
      63000 -- (-2249.241) (-2262.378) [-2247.808] (-2247.390) * (-2260.614) [-2250.740] (-2246.718) (-2249.798) -- 0:01:14
      63500 -- (-2248.323) (-2261.778) (-2247.843) [-2247.513] * (-2253.432) (-2246.277) [-2245.544] (-2248.389) -- 0:01:13
      64000 -- (-2248.984) (-2261.747) (-2247.063) [-2246.479] * (-2254.488) (-2253.093) [-2247.148] (-2249.055) -- 0:01:13
      64500 -- (-2247.439) [-2255.478] (-2247.577) (-2246.227) * (-2252.438) [-2246.970] (-2246.590) (-2249.629) -- 0:01:12
      65000 -- [-2248.130] (-2256.711) (-2245.610) (-2246.336) * [-2254.111] (-2248.459) (-2246.796) (-2253.304) -- 0:01:11

      Average standard deviation of split frequencies: 0.026784

      65500 -- (-2249.416) (-2259.323) [-2246.286] (-2246.725) * (-2251.095) (-2247.120) (-2248.818) [-2248.888] -- 0:01:11
      66000 -- [-2249.187] (-2260.144) (-2247.749) (-2247.333) * (-2257.693) [-2245.610] (-2250.560) (-2253.090) -- 0:01:10
      66500 -- [-2249.604] (-2262.182) (-2246.854) (-2246.519) * [-2260.099] (-2250.044) (-2251.453) (-2249.623) -- 0:01:10
      67000 -- (-2247.842) [-2251.960] (-2246.851) (-2250.774) * (-2255.705) (-2248.018) (-2251.814) [-2246.493] -- 0:01:09
      67500 -- (-2248.028) (-2258.382) [-2247.357] (-2250.322) * [-2256.795] (-2247.048) (-2246.656) (-2249.399) -- 0:01:09
      68000 -- (-2251.232) (-2255.314) [-2249.232] (-2247.124) * [-2254.419] (-2248.056) (-2248.226) (-2249.369) -- 0:01:22
      68500 -- [-2251.988] (-2266.261) (-2246.641) (-2248.697) * (-2263.226) [-2247.140] (-2246.341) (-2246.494) -- 0:01:21
      69000 -- (-2250.594) [-2260.938] (-2247.047) (-2248.672) * (-2257.167) [-2253.589] (-2246.367) (-2246.400) -- 0:01:20
      69500 -- [-2248.054] (-2261.371) (-2247.216) (-2251.347) * [-2259.049] (-2250.118) (-2246.367) (-2246.367) -- 0:01:20
      70000 -- (-2251.183) (-2255.761) [-2247.131] (-2249.224) * (-2261.624) (-2247.683) (-2246.398) [-2247.294] -- 0:01:19

      Average standard deviation of split frequencies: 0.023348

      70500 -- (-2250.013) (-2251.311) (-2248.440) [-2251.456] * (-2257.591) (-2247.497) (-2245.499) [-2249.325] -- 0:01:19
      71000 -- [-2247.576] (-2251.749) (-2251.791) (-2250.511) * (-2253.148) (-2247.066) [-2247.626] (-2249.053) -- 0:01:18
      71500 -- (-2248.500) (-2256.511) (-2247.506) [-2248.382] * (-2257.436) (-2248.470) [-2245.760] (-2249.065) -- 0:01:17
      72000 -- (-2249.627) [-2254.125] (-2249.243) (-2248.774) * (-2258.271) (-2248.195) [-2246.411] (-2249.096) -- 0:01:17
      72500 -- (-2249.698) (-2259.631) [-2246.138] (-2247.691) * [-2255.340] (-2254.050) (-2245.593) (-2249.640) -- 0:01:16
      73000 -- (-2251.658) [-2255.187] (-2247.637) (-2247.109) * (-2253.620) (-2247.746) (-2245.780) [-2252.355] -- 0:01:16
      73500 -- (-2246.114) (-2252.956) (-2250.862) [-2245.731] * (-2261.010) (-2248.420) [-2245.600] (-2249.849) -- 0:01:15
      74000 -- (-2251.942) (-2253.457) [-2250.242] (-2246.587) * (-2255.540) (-2246.431) [-2247.027] (-2250.950) -- 0:01:15
      74500 -- [-2250.175] (-2253.577) (-2246.768) (-2245.857) * (-2257.877) (-2247.358) [-2245.817] (-2248.982) -- 0:01:14
      75000 -- [-2248.324] (-2257.959) (-2246.748) (-2245.836) * (-2254.285) (-2247.395) [-2246.280] (-2249.631) -- 0:01:14

      Average standard deviation of split frequencies: 0.018298

      75500 -- (-2247.219) (-2253.246) (-2247.252) [-2245.877] * (-2261.428) (-2249.453) (-2249.183) [-2246.364] -- 0:01:13
      76000 -- (-2247.203) (-2254.840) (-2246.435) [-2249.766] * (-2258.843) [-2246.159] (-2245.946) (-2246.695) -- 0:01:12
      76500 -- (-2246.014) [-2255.315] (-2247.034) (-2249.300) * [-2259.309] (-2246.301) (-2246.530) (-2245.657) -- 0:01:12
      77000 -- (-2247.560) (-2254.610) [-2247.399] (-2247.454) * (-2254.402) (-2247.007) (-2250.273) [-2245.769] -- 0:01:11
      77500 -- [-2247.263] (-2251.814) (-2246.587) (-2247.240) * (-2267.820) (-2247.048) (-2248.088) [-2246.052] -- 0:01:11
      78000 -- (-2250.516) (-2256.763) [-2246.151] (-2247.181) * [-2253.815] (-2247.004) (-2248.088) (-2247.472) -- 0:01:10
      78500 -- (-2249.335) [-2252.159] (-2245.623) (-2247.179) * [-2255.953] (-2247.986) (-2247.962) (-2247.256) -- 0:01:10
      79000 -- (-2249.049) (-2257.909) (-2248.627) [-2247.854] * [-2253.656] (-2247.231) (-2249.096) (-2249.893) -- 0:01:09
      79500 -- (-2250.176) (-2256.201) (-2245.873) [-2247.356] * [-2254.893] (-2245.966) (-2247.800) (-2249.778) -- 0:01:09
      80000 -- (-2247.748) [-2259.581] (-2248.402) (-2247.542) * (-2250.128) (-2246.031) [-2247.531] (-2247.321) -- 0:01:09

      Average standard deviation of split frequencies: 0.019377

      80500 -- (-2247.626) (-2256.063) [-2246.147] (-2248.315) * [-2253.051] (-2245.950) (-2247.016) (-2246.362) -- 0:01:08
      81000 -- (-2247.138) (-2251.152) [-2245.750] (-2247.513) * (-2252.612) (-2247.002) (-2251.215) [-2247.604] -- 0:01:08
      81500 -- [-2247.781] (-2257.992) (-2245.850) (-2246.273) * [-2249.925] (-2247.100) (-2251.727) (-2252.104) -- 0:01:07
      82000 -- [-2247.546] (-2257.736) (-2246.510) (-2246.707) * [-2251.413] (-2245.794) (-2246.415) (-2251.748) -- 0:01:07
      82500 -- (-2247.449) (-2259.922) [-2246.880] (-2247.108) * [-2259.373] (-2245.764) (-2247.239) (-2256.462) -- 0:01:17
      83000 -- (-2246.448) (-2257.969) [-2245.382] (-2247.440) * [-2259.664] (-2247.541) (-2247.089) (-2254.881) -- 0:01:17
      83500 -- (-2247.855) (-2255.609) [-2247.241] (-2247.196) * [-2250.575] (-2247.317) (-2248.575) (-2251.468) -- 0:01:16
      84000 -- [-2247.854] (-2258.443) (-2245.890) (-2248.636) * [-2254.495] (-2246.478) (-2248.304) (-2248.431) -- 0:01:16
      84500 -- (-2248.500) (-2255.503) [-2245.287] (-2246.766) * [-2253.307] (-2246.517) (-2249.692) (-2247.242) -- 0:01:15
      85000 -- [-2249.609] (-2251.144) (-2245.410) (-2246.769) * (-2254.508) (-2248.453) (-2246.580) [-2252.455] -- 0:01:15

      Average standard deviation of split frequencies: 0.015896

      85500 -- (-2247.093) (-2259.498) (-2246.110) [-2246.286] * (-2254.515) [-2251.911] (-2247.305) (-2248.644) -- 0:01:14
      86000 -- (-2245.894) (-2260.655) [-2246.018] (-2248.191) * [-2250.021] (-2250.329) (-2247.319) (-2247.627) -- 0:01:14
      86500 -- (-2247.363) (-2268.572) [-2246.007] (-2252.680) * (-2258.640) (-2246.920) (-2249.626) [-2247.628] -- 0:01:13
      87000 -- (-2247.462) (-2252.334) [-2245.478] (-2247.851) * (-2258.777) (-2246.650) (-2247.369) [-2245.739] -- 0:01:13
      87500 -- (-2247.955) (-2257.585) (-2245.478) [-2248.533] * (-2258.637) (-2245.452) [-2247.856] (-2245.583) -- 0:01:13
      88000 -- (-2247.422) (-2248.542) [-2246.964] (-2250.953) * (-2260.429) (-2246.957) (-2247.540) [-2252.264] -- 0:01:12
      88500 -- [-2247.345] (-2247.601) (-2246.105) (-2250.364) * (-2257.581) (-2245.575) (-2249.177) [-2253.230] -- 0:01:12
      89000 -- [-2249.739] (-2245.143) (-2249.315) (-2247.191) * [-2254.789] (-2247.461) (-2250.271) (-2249.366) -- 0:01:11
      89500 -- (-2249.271) (-2246.117) (-2249.299) [-2246.875] * [-2251.452] (-2249.062) (-2254.610) (-2245.550) -- 0:01:11
      90000 -- (-2249.973) (-2246.445) [-2246.791] (-2246.818) * [-2254.813] (-2249.135) (-2248.301) (-2247.352) -- 0:01:10

      Average standard deviation of split frequencies: 0.017513

      90500 -- (-2249.551) [-2247.885] (-2247.389) (-2246.806) * (-2257.826) [-2247.781] (-2251.159) (-2246.419) -- 0:01:10
      91000 -- (-2247.514) [-2252.642] (-2249.510) (-2251.684) * (-2253.687) (-2248.727) [-2250.547] (-2246.728) -- 0:01:09
      91500 -- [-2245.527] (-2249.016) (-2250.439) (-2247.027) * (-2256.605) [-2249.318] (-2253.189) (-2245.352) -- 0:01:09
      92000 -- (-2246.337) (-2249.678) [-2248.894] (-2245.744) * [-2255.563] (-2249.158) (-2250.587) (-2245.471) -- 0:01:09
      92500 -- [-2247.047] (-2247.682) (-2248.498) (-2246.063) * (-2255.103) (-2248.367) [-2252.590] (-2248.838) -- 0:01:08
      93000 -- (-2249.295) (-2252.151) (-2247.165) [-2246.064] * [-2251.465] (-2250.040) (-2249.819) (-2249.788) -- 0:01:08
      93500 -- (-2255.688) (-2254.261) [-2248.976] (-2246.334) * (-2256.951) (-2248.829) (-2248.823) [-2249.818] -- 0:01:07
      94000 -- (-2250.806) (-2250.619) [-2249.237] (-2247.539) * (-2268.047) (-2251.139) (-2250.038) [-2251.193] -- 0:01:07
      94500 -- [-2246.663] (-2246.869) (-2246.223) (-2246.604) * (-2264.557) (-2250.703) (-2250.144) [-2247.442] -- 0:01:07
      95000 -- (-2245.739) (-2246.602) (-2246.249) [-2245.941] * [-2260.202] (-2248.284) (-2250.095) (-2249.136) -- 0:01:06

      Average standard deviation of split frequencies: 0.017057

      95500 -- [-2245.498] (-2246.741) (-2247.076) (-2246.570) * (-2255.358) (-2250.111) (-2248.126) [-2248.109] -- 0:01:06
      96000 -- (-2247.730) [-2249.466] (-2250.381) (-2246.977) * (-2269.509) [-2247.521] (-2248.364) (-2246.442) -- 0:01:05
      96500 -- (-2248.623) [-2246.752] (-2248.419) (-2247.980) * (-2251.996) (-2247.493) (-2249.276) [-2246.294] -- 0:01:05
      97000 -- (-2247.331) (-2247.003) (-2245.783) [-2250.120] * (-2256.130) [-2247.336] (-2248.187) (-2246.295) -- 0:01:05
      97500 -- (-2248.498) (-2249.785) (-2246.354) [-2250.082] * (-2256.588) [-2247.600] (-2249.699) (-2246.769) -- 0:01:14
      98000 -- (-2248.504) (-2249.143) [-2246.176] (-2248.635) * [-2252.825] (-2247.099) (-2248.270) (-2248.369) -- 0:01:13
      98500 -- (-2247.468) (-2249.786) [-2245.383] (-2251.519) * (-2257.988) [-2247.099] (-2250.639) (-2246.845) -- 0:01:13
      99000 -- (-2247.691) (-2249.954) (-2246.755) [-2249.555] * [-2255.086] (-2247.138) (-2245.852) (-2246.083) -- 0:01:12
      99500 -- [-2248.783] (-2249.659) (-2248.953) (-2248.825) * [-2252.356] (-2250.225) (-2246.249) (-2246.396) -- 0:01:12
      100000 -- (-2247.742) (-2250.098) [-2245.908] (-2248.968) * (-2260.171) [-2247.050] (-2246.725) (-2248.985) -- 0:01:12

      Average standard deviation of split frequencies: 0.018731

      100500 -- [-2249.478] (-2250.010) (-2245.414) (-2247.512) * (-2263.759) (-2246.465) [-2249.068] (-2246.479) -- 0:01:11
      101000 -- (-2249.727) [-2251.133] (-2246.973) (-2246.809) * (-2255.803) [-2248.840] (-2251.784) (-2246.118) -- 0:01:11
      101500 -- (-2255.019) (-2251.788) [-2248.247] (-2246.787) * (-2262.387) [-2248.172] (-2249.168) (-2251.962) -- 0:01:10
      102000 -- (-2248.393) (-2249.971) [-2246.884] (-2247.675) * (-2260.405) (-2248.358) [-2249.216] (-2250.337) -- 0:01:10
      102500 -- (-2249.344) [-2249.888] (-2246.879) (-2247.156) * (-2256.114) [-2247.432] (-2245.689) (-2250.651) -- 0:01:10
      103000 -- (-2249.163) (-2248.639) [-2246.882] (-2246.115) * (-2261.112) (-2246.213) (-2246.852) [-2250.261] -- 0:01:09
      103500 -- [-2253.066] (-2249.061) (-2247.152) (-2246.661) * (-2260.995) (-2248.158) (-2247.537) [-2247.318] -- 0:01:09
      104000 -- [-2250.112] (-2246.362) (-2248.245) (-2247.582) * (-2258.744) (-2246.221) [-2247.630] (-2248.180) -- 0:01:08
      104500 -- [-2250.045] (-2245.589) (-2248.318) (-2248.703) * (-2257.196) (-2246.528) [-2247.398] (-2247.496) -- 0:01:08
      105000 -- (-2247.737) (-2246.546) (-2248.628) [-2248.233] * (-2257.014) [-2246.658] (-2247.912) (-2247.234) -- 0:01:08

      Average standard deviation of split frequencies: 0.017566

      105500 -- (-2245.667) [-2246.701] (-2247.924) (-2248.765) * (-2262.511) (-2247.834) (-2249.204) [-2247.225] -- 0:01:07
      106000 -- (-2245.846) [-2246.968] (-2248.477) (-2248.011) * (-2259.316) (-2248.703) [-2251.235] (-2247.540) -- 0:01:07
      106500 -- [-2246.061] (-2245.670) (-2248.261) (-2246.195) * (-2260.564) (-2248.612) (-2250.305) [-2247.302] -- 0:01:07
      107000 -- (-2246.784) (-2246.729) [-2246.995] (-2245.756) * [-2258.458] (-2246.247) (-2247.429) (-2247.966) -- 0:01:06
      107500 -- (-2248.792) (-2246.386) (-2248.104) [-2245.853] * (-2265.310) [-2245.864] (-2247.904) (-2249.200) -- 0:01:06
      108000 -- (-2248.112) [-2248.272] (-2248.095) (-2245.642) * [-2255.101] (-2246.695) (-2247.253) (-2251.386) -- 0:01:06
      108500 -- (-2246.391) [-2245.567] (-2248.317) (-2247.145) * (-2261.968) (-2246.419) (-2254.134) [-2254.084] -- 0:01:05
      109000 -- (-2246.495) [-2248.550] (-2248.412) (-2248.835) * (-2256.523) [-2246.795] (-2249.834) (-2249.549) -- 0:01:05
      109500 -- (-2247.539) (-2248.678) (-2252.467) [-2246.794] * (-2262.012) [-2247.591] (-2250.294) (-2247.925) -- 0:01:05
      110000 -- [-2247.982] (-2247.393) (-2247.374) (-2251.983) * (-2251.925) (-2247.281) [-2250.554] (-2247.045) -- 0:01:04

      Average standard deviation of split frequencies: 0.018317

      110500 -- (-2245.419) (-2247.753) (-2246.702) [-2246.640] * (-2255.394) [-2245.856] (-2247.355) (-2248.647) -- 0:01:04
      111000 -- (-2248.043) (-2250.557) (-2247.500) [-2245.965] * (-2252.616) (-2247.478) (-2246.925) [-2248.593] -- 0:01:04
      111500 -- (-2249.363) [-2248.548] (-2247.513) (-2245.991) * (-2258.340) [-2246.789] (-2247.966) (-2248.713) -- 0:01:03
      112000 -- (-2247.928) (-2246.365) (-2247.502) [-2246.545] * (-2264.785) (-2247.796) (-2246.663) [-2248.081] -- 0:01:03
      112500 -- (-2249.199) (-2248.631) [-2247.217] (-2245.835) * [-2255.183] (-2245.761) (-2246.164) (-2248.290) -- 0:01:11
      113000 -- (-2248.344) [-2250.673] (-2246.845) (-2250.646) * (-2258.295) (-2245.323) [-2245.457] (-2248.178) -- 0:01:10
      113500 -- (-2246.321) (-2248.676) [-2246.648] (-2246.507) * (-2263.383) (-2245.274) (-2245.999) [-2247.015] -- 0:01:10
      114000 -- (-2246.573) (-2248.956) [-2246.390] (-2246.496) * (-2250.939) (-2245.327) (-2250.201) [-2248.632] -- 0:01:09
      114500 -- (-2251.169) (-2247.925) [-2246.382] (-2246.184) * (-2262.648) [-2245.398] (-2246.210) (-2250.444) -- 0:01:09
      115000 -- (-2249.089) (-2247.732) (-2250.294) [-2245.407] * (-2251.494) (-2246.838) (-2245.702) [-2245.872] -- 0:01:09

      Average standard deviation of split frequencies: 0.016052

      115500 -- (-2249.337) [-2250.475] (-2249.740) (-2245.385) * (-2253.616) (-2246.846) (-2247.931) [-2245.706] -- 0:01:08
      116000 -- (-2247.876) (-2252.476) (-2247.235) [-2245.913] * [-2254.062] (-2246.816) (-2247.070) (-2245.718) -- 0:01:08
      116500 -- (-2247.961) (-2249.626) [-2246.148] (-2246.228) * (-2257.493) (-2248.585) [-2248.678] (-2249.486) -- 0:01:08
      117000 -- (-2247.246) (-2248.391) [-2246.863] (-2249.873) * [-2252.452] (-2248.147) (-2247.506) (-2247.883) -- 0:01:07
      117500 -- [-2246.437] (-2247.433) (-2246.313) (-2248.905) * (-2255.085) (-2247.454) (-2247.471) [-2247.988] -- 0:01:07
      118000 -- [-2247.613] (-2247.734) (-2246.375) (-2247.418) * (-2260.037) (-2247.455) (-2245.567) [-2251.259] -- 0:01:07
      118500 -- [-2247.885] (-2247.734) (-2246.375) (-2247.295) * [-2255.373] (-2247.442) (-2246.218) (-2249.768) -- 0:01:06
      119000 -- [-2246.855] (-2247.619) (-2247.294) (-2247.521) * (-2252.703) [-2247.082] (-2245.807) (-2249.645) -- 0:01:06
      119500 -- (-2247.438) (-2246.343) [-2246.191] (-2248.122) * (-2258.409) (-2248.810) (-2246.554) [-2249.631] -- 0:01:06
      120000 -- (-2248.205) [-2245.464] (-2247.075) (-2250.710) * (-2256.526) [-2246.785] (-2245.787) (-2250.026) -- 0:01:06

      Average standard deviation of split frequencies: 0.016408

      120500 -- (-2248.028) (-2246.436) [-2247.075] (-2249.488) * (-2259.154) (-2248.056) (-2246.475) [-2248.270] -- 0:01:05
      121000 -- [-2247.069] (-2245.275) (-2248.630) (-2250.413) * (-2256.402) (-2247.195) (-2246.475) [-2247.526] -- 0:01:05
      121500 -- (-2247.265) (-2246.363) [-2246.380] (-2251.063) * (-2255.097) (-2246.696) [-2247.715] (-2247.826) -- 0:01:05
      122000 -- [-2247.055] (-2245.714) (-2245.949) (-2251.840) * (-2269.684) (-2246.846) [-2247.294] (-2249.431) -- 0:01:04
      122500 -- [-2246.987] (-2246.458) (-2246.063) (-2250.597) * (-2260.969) (-2247.101) [-2247.978] (-2247.701) -- 0:01:04
      123000 -- (-2249.071) [-2248.053] (-2246.591) (-2247.866) * (-2254.306) (-2246.123) (-2245.735) [-2247.520] -- 0:01:04
      123500 -- (-2248.034) (-2248.601) [-2246.612] (-2247.667) * (-2249.371) (-2248.927) (-2248.990) [-2246.450] -- 0:01:03
      124000 -- (-2248.180) (-2250.665) [-2247.854] (-2247.637) * [-2252.373] (-2245.858) (-2247.569) (-2246.609) -- 0:01:03
      124500 -- (-2249.489) (-2250.344) [-2248.527] (-2247.868) * [-2257.497] (-2245.835) (-2248.494) (-2246.844) -- 0:01:03
      125000 -- [-2249.661] (-2249.362) (-2249.209) (-2250.551) * (-2257.484) (-2245.539) (-2248.810) [-2245.842] -- 0:01:03

      Average standard deviation of split frequencies: 0.015901

      125500 -- (-2251.233) (-2247.221) [-2248.251] (-2251.681) * [-2257.875] (-2245.369) (-2247.076) (-2245.920) -- 0:01:02
      126000 -- (-2247.929) (-2248.063) [-2247.595] (-2251.390) * (-2252.105) (-2245.369) [-2246.991] (-2245.895) -- 0:01:02
      126500 -- (-2246.532) [-2249.022] (-2248.286) (-2249.205) * (-2257.795) (-2245.293) (-2246.927) [-2245.765] -- 0:01:02
      127000 -- (-2246.384) [-2247.197] (-2247.728) (-2246.042) * (-2263.295) (-2245.957) (-2249.823) [-2246.527] -- 0:01:01
      127500 -- (-2246.578) (-2249.840) (-2249.663) [-2246.296] * (-2255.227) [-2247.344] (-2247.177) (-2246.816) -- 0:01:08
      128000 -- (-2247.100) (-2246.151) (-2247.360) [-2247.152] * (-2251.183) (-2247.344) [-2248.503] (-2250.780) -- 0:01:08
      128500 -- (-2245.742) (-2246.932) [-2249.230] (-2249.171) * (-2254.530) (-2249.273) [-2246.053] (-2250.750) -- 0:01:07
      129000 -- [-2245.782] (-2246.812) (-2250.132) (-2248.274) * (-2261.500) (-2247.268) (-2247.473) [-2252.370] -- 0:01:07
      129500 -- (-2245.697) (-2248.040) (-2251.306) [-2245.995] * (-2253.401) (-2248.456) [-2247.000] (-2251.542) -- 0:01:07
      130000 -- [-2245.484] (-2249.385) (-2246.885) (-2247.198) * (-2255.458) (-2248.111) (-2246.997) [-2250.358] -- 0:01:06

      Average standard deviation of split frequencies: 0.015570

      130500 -- [-2248.471] (-2249.083) (-2248.764) (-2249.352) * [-2254.639] (-2253.274) (-2247.289) (-2249.575) -- 0:01:06
      131000 -- (-2248.471) [-2246.386] (-2247.277) (-2248.469) * [-2261.246] (-2250.515) (-2247.717) (-2248.633) -- 0:01:06
      131500 -- [-2248.520] (-2246.605) (-2248.622) (-2248.559) * [-2257.908] (-2245.985) (-2248.112) (-2247.735) -- 0:01:06
      132000 -- (-2246.564) (-2247.714) (-2249.482) [-2248.573] * (-2256.569) (-2248.159) [-2246.294] (-2248.648) -- 0:01:05
      132500 -- (-2245.968) (-2246.563) (-2249.133) [-2250.296] * [-2255.766] (-2247.164) (-2247.676) (-2246.943) -- 0:01:05
      133000 -- (-2245.961) [-2246.701] (-2249.431) (-2249.043) * (-2258.477) (-2247.164) [-2247.016] (-2246.393) -- 0:01:05
      133500 -- (-2250.114) (-2246.330) [-2248.612] (-2249.017) * (-2259.802) (-2251.325) [-2247.635] (-2245.382) -- 0:01:04
      134000 -- (-2248.645) (-2247.108) (-2247.986) [-2250.204] * [-2254.702] (-2249.587) (-2247.944) (-2245.610) -- 0:01:04
      134500 -- (-2249.044) [-2249.113] (-2247.590) (-2249.587) * [-2255.605] (-2250.962) (-2245.800) (-2245.929) -- 0:01:04
      135000 -- (-2248.305) [-2249.802] (-2247.675) (-2248.979) * (-2253.109) (-2250.661) (-2249.101) [-2247.439] -- 0:01:04

      Average standard deviation of split frequencies: 0.015251

      135500 -- (-2248.865) [-2248.449] (-2248.469) (-2246.618) * (-2256.181) (-2247.084) [-2249.400] (-2246.275) -- 0:01:03
      136000 -- [-2247.898] (-2248.240) (-2250.825) (-2246.544) * (-2253.104) (-2247.642) (-2250.679) [-2245.730] -- 0:01:03
      136500 -- [-2247.954] (-2248.328) (-2247.524) (-2247.208) * (-2256.127) (-2247.156) (-2249.033) [-2247.150] -- 0:01:03
      137000 -- [-2247.806] (-2248.644) (-2247.762) (-2247.497) * (-2265.564) (-2246.603) (-2246.425) [-2246.318] -- 0:01:02
      137500 -- (-2247.915) [-2248.811] (-2253.705) (-2246.711) * (-2253.452) (-2247.382) [-2246.294] (-2248.328) -- 0:01:02
      138000 -- (-2246.919) [-2246.840] (-2248.527) (-2247.607) * (-2252.901) (-2246.018) [-2246.159] (-2248.231) -- 0:01:02
      138500 -- (-2248.070) (-2246.797) [-2248.546] (-2247.688) * (-2254.707) (-2245.402) [-2246.228] (-2247.474) -- 0:01:02
      139000 -- (-2248.506) [-2246.654] (-2247.254) (-2246.735) * (-2252.271) [-2245.806] (-2247.419) (-2249.466) -- 0:01:01
      139500 -- (-2247.398) (-2246.561) (-2250.077) [-2245.913] * (-2259.761) [-2246.035] (-2249.961) (-2248.270) -- 0:01:01
      140000 -- [-2247.480] (-2247.156) (-2247.588) (-2245.955) * [-2260.497] (-2246.119) (-2252.420) (-2246.956) -- 0:01:01

      Average standard deviation of split frequencies: 0.015345

      140500 -- [-2247.958] (-2247.885) (-2249.893) (-2245.943) * (-2256.376) (-2251.439) [-2247.138] (-2247.476) -- 0:01:01
      141000 -- [-2247.958] (-2246.839) (-2246.986) (-2245.867) * [-2253.674] (-2246.284) (-2248.319) (-2247.102) -- 0:01:00
      141500 -- [-2249.018] (-2246.283) (-2246.766) (-2247.164) * (-2256.473) [-2245.816] (-2249.350) (-2247.238) -- 0:01:00
      142000 -- [-2250.871] (-2246.117) (-2247.006) (-2247.165) * (-2255.630) (-2246.326) (-2249.424) [-2247.251] -- 0:01:00
      142500 -- (-2250.665) (-2246.042) [-2245.507] (-2247.330) * (-2249.877) (-2249.268) (-2246.974) [-2248.731] -- 0:01:06
      143000 -- [-2250.532] (-2248.964) (-2245.794) (-2247.351) * (-2250.744) (-2247.165) (-2249.399) [-2248.872] -- 0:01:05
      143500 -- (-2249.163) (-2250.289) (-2245.756) [-2247.596] * (-2251.162) [-2247.747] (-2247.057) (-2248.413) -- 0:01:05
      144000 -- (-2246.261) (-2251.108) [-2246.412] (-2246.920) * (-2248.941) (-2247.887) [-2249.660] (-2247.731) -- 0:01:05
      144500 -- (-2246.768) (-2249.793) (-2249.694) [-2247.173] * (-2251.020) [-2247.501] (-2251.844) (-2247.890) -- 0:01:05
      145000 -- (-2246.807) (-2251.279) [-2247.962] (-2246.884) * (-2245.896) (-2246.720) [-2248.552] (-2248.088) -- 0:01:04

      Average standard deviation of split frequencies: 0.015498

      145500 -- [-2246.333] (-2251.285) (-2248.993) (-2246.372) * [-2248.012] (-2247.602) (-2248.699) (-2247.262) -- 0:01:04
      146000 -- (-2247.143) (-2251.070) (-2248.685) [-2245.947] * (-2246.435) (-2250.609) [-2246.729] (-2247.208) -- 0:01:04
      146500 -- [-2246.537] (-2252.334) (-2248.277) (-2246.113) * (-2246.571) (-2249.083) (-2247.715) [-2249.589] -- 0:01:04
      147000 -- [-2247.588] (-2249.623) (-2246.883) (-2246.149) * (-2246.494) (-2250.345) (-2246.802) [-2247.047] -- 0:01:03
      147500 -- (-2247.370) (-2247.907) (-2248.840) [-2246.735] * [-2246.200] (-2248.225) (-2246.812) (-2248.220) -- 0:01:03
      148000 -- [-2246.209] (-2247.059) (-2249.234) (-2249.749) * [-2247.148] (-2248.467) (-2247.882) (-2247.212) -- 0:01:03
      148500 -- (-2246.449) (-2247.100) (-2248.030) [-2248.686] * (-2246.723) (-2247.127) [-2253.403] (-2247.422) -- 0:01:03
      149000 -- (-2247.904) (-2247.501) [-2246.015] (-2246.846) * (-2247.402) (-2246.290) (-2249.753) [-2246.734] -- 0:01:02
      149500 -- (-2247.310) (-2247.033) [-2247.012] (-2250.567) * (-2250.944) [-2246.143] (-2251.070) (-2246.948) -- 0:01:02
      150000 -- (-2249.517) (-2248.169) [-2246.727] (-2247.347) * (-2249.958) [-2247.077] (-2251.277) (-2249.035) -- 0:01:02

      Average standard deviation of split frequencies: 0.013454

      150500 -- (-2247.096) (-2248.438) (-2247.991) [-2247.605] * (-2246.275) (-2253.896) (-2248.104) [-2247.507] -- 0:01:02
      151000 -- (-2250.693) [-2251.084] (-2249.426) (-2252.775) * (-2246.580) (-2251.148) (-2247.462) [-2249.075] -- 0:01:01
      151500 -- (-2249.575) (-2249.032) (-2246.947) [-2247.312] * [-2245.726] (-2248.950) (-2250.259) (-2247.293) -- 0:01:01
      152000 -- (-2251.132) (-2251.517) [-2246.947] (-2246.621) * [-2245.726] (-2247.633) (-2247.610) (-2246.644) -- 0:01:01
      152500 -- (-2251.553) [-2248.309] (-2247.005) (-2247.123) * (-2247.598) [-2248.550] (-2247.435) (-2246.377) -- 0:01:01
      153000 -- (-2247.928) (-2248.180) [-2247.217] (-2247.113) * (-2247.289) (-2249.730) (-2251.300) [-2247.205] -- 0:01:00
      153500 -- (-2246.605) [-2247.000] (-2249.084) (-2247.371) * [-2247.351] (-2247.984) (-2246.940) (-2247.304) -- 0:01:00
      154000 -- [-2246.904] (-2246.618) (-2251.008) (-2246.324) * (-2246.361) (-2248.235) [-2247.118] (-2245.525) -- 0:01:00
      154500 -- (-2253.556) (-2250.965) (-2250.789) [-2246.834] * (-2245.565) [-2246.319] (-2245.829) (-2245.901) -- 0:01:00
      155000 -- [-2248.677] (-2249.108) (-2248.708) (-2248.636) * (-2248.568) (-2247.135) (-2245.986) [-2245.805] -- 0:00:59

      Average standard deviation of split frequencies: 0.014203

      155500 -- (-2246.346) (-2249.963) [-2247.970] (-2248.325) * (-2249.338) (-2247.889) (-2248.658) [-2246.221] -- 0:00:59
      156000 -- [-2247.324] (-2251.744) (-2247.942) (-2251.243) * (-2245.846) [-2249.280] (-2248.747) (-2249.361) -- 0:00:59
      156500 -- (-2246.424) [-2245.694] (-2248.519) (-2248.963) * [-2245.885] (-2247.706) (-2249.873) (-2245.882) -- 0:00:59
      157000 -- (-2246.015) (-2245.695) [-2250.274] (-2247.337) * (-2246.260) (-2247.612) (-2251.185) [-2246.000] -- 0:00:59
      157500 -- [-2247.804] (-2247.598) (-2250.567) (-2246.874) * (-2246.361) [-2247.706] (-2247.226) (-2246.580) -- 0:01:04
      158000 -- (-2246.351) (-2250.053) (-2247.626) [-2246.615] * [-2247.098] (-2246.722) (-2248.589) (-2247.158) -- 0:01:03
      158500 -- [-2246.604] (-2246.438) (-2247.989) (-2246.989) * (-2247.098) (-2247.087) (-2248.682) [-2247.358] -- 0:01:03
      159000 -- (-2247.398) [-2247.434] (-2246.560) (-2249.460) * (-2246.595) [-2246.561] (-2249.227) (-2247.673) -- 0:01:03
      159500 -- [-2249.933] (-2247.529) (-2252.727) (-2248.918) * (-2246.244) (-2246.681) (-2252.348) [-2247.073] -- 0:01:03
      160000 -- (-2249.563) [-2246.834] (-2249.086) (-2248.489) * (-2246.138) [-2247.706] (-2250.976) (-2247.563) -- 0:01:02

      Average standard deviation of split frequencies: 0.014524

      160500 -- (-2246.632) (-2252.832) [-2247.634] (-2247.654) * (-2245.738) [-2248.388] (-2248.625) (-2246.857) -- 0:01:02
      161000 -- (-2246.917) [-2249.126] (-2247.480) (-2246.462) * (-2246.211) (-2251.276) (-2247.170) [-2248.366] -- 0:01:02
      161500 -- (-2247.492) (-2246.940) [-2247.575] (-2246.525) * (-2248.003) [-2247.264] (-2250.696) (-2248.325) -- 0:01:02
      162000 -- [-2250.142] (-2254.372) (-2252.459) (-2247.156) * (-2248.003) (-2247.872) (-2247.746) [-2247.250] -- 0:01:02
      162500 -- (-2249.441) (-2254.689) (-2247.383) [-2248.553] * (-2247.924) (-2248.673) [-2247.388] (-2247.250) -- 0:01:01
      163000 -- (-2247.459) (-2249.326) (-2252.192) [-2251.803] * (-2249.631) (-2248.680) [-2248.270] (-2247.160) -- 0:01:01
      163500 -- (-2246.530) [-2247.171] (-2250.475) (-2249.520) * (-2249.039) (-2251.675) (-2246.591) [-2245.523] -- 0:01:01
      164000 -- (-2246.338) [-2247.220] (-2246.918) (-2253.275) * (-2248.769) (-2252.063) [-2246.538] (-2245.664) -- 0:01:01
      164500 -- (-2247.520) [-2245.576] (-2247.818) (-2249.094) * (-2248.695) (-2252.399) (-2246.927) [-2246.727] -- 0:01:00
      165000 -- [-2247.388] (-2247.963) (-2248.647) (-2251.740) * (-2250.232) (-2249.480) [-2246.439] (-2251.313) -- 0:01:00

      Average standard deviation of split frequencies: 0.013489

      165500 -- [-2248.277] (-2246.956) (-2259.697) (-2251.323) * (-2250.280) (-2247.130) [-2249.099] (-2247.158) -- 0:01:00
      166000 -- (-2248.286) [-2245.849] (-2251.118) (-2252.458) * (-2249.001) [-2246.866] (-2247.634) (-2245.801) -- 0:01:00
      166500 -- [-2246.749] (-2246.414) (-2248.976) (-2252.385) * (-2247.850) (-2249.958) (-2252.133) [-2248.623] -- 0:01:00
      167000 -- (-2251.829) [-2246.872] (-2250.312) (-2251.518) * (-2248.050) (-2251.628) (-2249.684) [-2249.098] -- 0:00:59
      167500 -- (-2246.872) (-2246.290) (-2248.500) [-2246.538] * (-2249.105) (-2249.496) [-2246.707] (-2255.017) -- 0:00:59
      168000 -- [-2246.277] (-2250.996) (-2247.076) (-2246.536) * (-2247.822) (-2249.775) [-2246.620] (-2250.407) -- 0:00:59
      168500 -- (-2246.386) (-2250.634) [-2246.894] (-2246.594) * [-2245.402] (-2253.759) (-2247.230) (-2249.888) -- 0:00:59
      169000 -- [-2246.304] (-2247.697) (-2246.092) (-2247.711) * (-2246.784) [-2246.780] (-2247.565) (-2248.527) -- 0:00:59
      169500 -- [-2246.809] (-2249.174) (-2250.656) (-2247.642) * (-2246.784) (-2247.684) (-2248.152) [-2249.602] -- 0:00:58
      170000 -- [-2247.970] (-2245.149) (-2249.906) (-2247.235) * (-2247.789) [-2247.000] (-2245.912) (-2250.165) -- 0:00:58

      Average standard deviation of split frequencies: 0.012982

      170500 -- (-2246.595) [-2245.149] (-2248.613) (-2248.147) * (-2248.241) (-2246.828) (-2248.228) [-2246.922] -- 0:00:58
      171000 -- (-2247.353) [-2247.282] (-2251.743) (-2248.405) * (-2248.664) (-2246.932) [-2245.955] (-2246.577) -- 0:00:58
      171500 -- (-2247.911) (-2246.959) [-2251.132] (-2248.799) * (-2247.520) [-2246.329] (-2245.917) (-2246.157) -- 0:00:57
      172000 -- (-2246.372) (-2251.896) [-2248.281] (-2249.231) * [-2247.200] (-2246.948) (-2248.954) (-2248.097) -- 0:00:57
      172500 -- [-2246.233] (-2248.166) (-2247.765) (-2246.193) * (-2248.837) [-2247.139] (-2246.672) (-2251.770) -- 0:01:02
      173000 -- (-2246.500) (-2247.453) [-2245.787] (-2246.268) * [-2248.421] (-2246.572) (-2246.506) (-2250.288) -- 0:01:02
      173500 -- [-2246.427] (-2246.851) (-2246.323) (-2247.174) * [-2245.815] (-2246.421) (-2245.945) (-2257.294) -- 0:01:01
      174000 -- (-2246.740) (-2245.420) (-2245.667) [-2249.008] * (-2245.783) [-2246.170] (-2246.726) (-2257.057) -- 0:01:01
      174500 -- (-2246.699) [-2246.327] (-2246.835) (-2247.889) * [-2245.799] (-2251.029) (-2245.506) (-2249.243) -- 0:01:01
      175000 -- (-2250.181) [-2246.445] (-2247.798) (-2245.678) * (-2246.133) (-2247.337) [-2247.416] (-2247.938) -- 0:01:01

      Average standard deviation of split frequencies: 0.012723

      175500 -- (-2250.339) [-2245.288] (-2245.620) (-2247.542) * [-2245.814] (-2256.885) (-2246.922) (-2247.557) -- 0:01:01
      176000 -- (-2252.921) [-2245.519] (-2248.683) (-2254.228) * [-2246.267] (-2250.192) (-2249.357) (-2247.651) -- 0:01:00
      176500 -- [-2249.048] (-2245.455) (-2245.888) (-2247.344) * [-2246.137] (-2255.650) (-2252.660) (-2246.850) -- 0:01:00
      177000 -- (-2245.973) [-2245.235] (-2246.955) (-2246.871) * [-2246.372] (-2249.492) (-2251.511) (-2247.924) -- 0:01:00
      177500 -- (-2246.011) [-2245.931] (-2246.606) (-2246.647) * (-2246.719) [-2246.390] (-2249.083) (-2248.467) -- 0:01:00
      178000 -- (-2246.959) (-2247.951) (-2250.589) [-2250.577] * (-2251.777) (-2246.243) [-2246.860] (-2246.274) -- 0:01:00
      178500 -- (-2246.937) (-2249.296) (-2247.142) [-2248.418] * (-2249.199) (-2246.706) (-2246.424) [-2247.684] -- 0:00:59
      179000 -- (-2245.687) (-2250.849) (-2247.173) [-2247.074] * (-2247.448) (-2245.721) (-2247.481) [-2246.669] -- 0:00:59
      179500 -- (-2248.747) [-2245.816] (-2246.738) (-2246.285) * (-2247.419) (-2246.738) [-2248.204] (-2246.575) -- 0:00:59
      180000 -- [-2245.926] (-2245.683) (-2246.861) (-2247.237) * [-2247.235] (-2246.204) (-2246.196) (-2247.818) -- 0:00:59

      Average standard deviation of split frequencies: 0.011742

      180500 -- (-2246.827) (-2245.514) (-2245.426) [-2246.909] * (-2246.295) [-2246.712] (-2246.484) (-2246.877) -- 0:00:59
      181000 -- [-2246.544] (-2245.578) (-2245.627) (-2247.656) * (-2246.847) (-2252.003) [-2245.667] (-2248.131) -- 0:00:58
      181500 -- (-2246.368) (-2247.589) (-2245.629) [-2248.662] * [-2245.920] (-2247.845) (-2245.695) (-2250.291) -- 0:00:58
      182000 -- (-2246.736) [-2247.340] (-2246.067) (-2249.183) * (-2247.324) [-2247.041] (-2247.201) (-2247.893) -- 0:00:58
      182500 -- (-2246.703) (-2245.685) [-2245.933] (-2247.983) * (-2247.316) (-2247.965) [-2248.855] (-2248.706) -- 0:00:58
      183000 -- (-2247.217) (-2245.808) (-2245.933) [-2248.888] * [-2246.627] (-2245.995) (-2248.620) (-2248.325) -- 0:00:58
      183500 -- (-2246.506) (-2245.808) (-2246.048) [-2249.004] * (-2246.083) [-2245.419] (-2246.622) (-2247.619) -- 0:00:57
      184000 -- [-2246.158] (-2247.840) (-2249.280) (-2247.475) * (-2246.203) [-2245.853] (-2247.961) (-2247.825) -- 0:00:57
      184500 -- (-2250.003) (-2246.623) [-2247.046] (-2246.585) * [-2245.874] (-2245.904) (-2247.994) (-2249.997) -- 0:00:57
      185000 -- [-2246.233] (-2247.357) (-2246.265) (-2246.936) * (-2246.385) (-2245.927) (-2246.451) [-2246.882] -- 0:00:57

      Average standard deviation of split frequencies: 0.013396

      185500 -- (-2247.668) (-2252.624) (-2246.420) [-2248.819] * (-2246.304) (-2248.749) [-2245.428] (-2247.117) -- 0:00:57
      186000 -- (-2248.063) (-2246.137) (-2248.267) [-2248.152] * (-2250.074) (-2248.725) [-2245.930] (-2246.521) -- 0:00:56
      186500 -- (-2247.882) (-2246.770) [-2247.136] (-2249.584) * (-2249.257) [-2248.954] (-2248.045) (-2246.567) -- 0:00:56
      187000 -- [-2245.808] (-2247.046) (-2252.633) (-2248.477) * (-2247.294) (-2248.954) [-2246.060] (-2246.396) -- 0:00:56
      187500 -- (-2249.606) [-2246.530] (-2245.923) (-2249.862) * (-2249.071) [-2247.839] (-2246.313) (-2245.828) -- 0:00:56
      188000 -- (-2252.161) [-2247.569] (-2247.282) (-2253.112) * [-2255.001] (-2250.269) (-2246.313) (-2246.374) -- 0:01:00
      188500 -- (-2247.365) [-2248.473] (-2246.647) (-2250.305) * [-2246.645] (-2248.197) (-2251.994) (-2245.517) -- 0:01:00
      189000 -- (-2246.141) [-2248.473] (-2246.910) (-2254.189) * (-2246.526) (-2247.951) (-2249.402) [-2248.599] -- 0:01:00
      189500 -- (-2246.521) [-2248.964] (-2247.341) (-2254.061) * [-2246.749] (-2248.100) (-2245.965) (-2246.969) -- 0:00:59
      190000 -- [-2246.935] (-2248.299) (-2249.631) (-2249.914) * [-2249.502] (-2249.193) (-2247.392) (-2246.937) -- 0:00:59

      Average standard deviation of split frequencies: 0.013657

      190500 -- (-2248.014) [-2247.169] (-2251.628) (-2250.275) * (-2247.967) (-2248.184) [-2246.351] (-2246.983) -- 0:00:59
      191000 -- (-2247.362) (-2248.148) (-2246.649) [-2250.301] * (-2249.783) (-2247.848) (-2245.904) [-2245.865] -- 0:00:59
      191500 -- (-2246.625) (-2249.905) (-2246.386) [-2248.761] * (-2249.506) [-2248.469] (-2246.361) (-2251.970) -- 0:00:59
      192000 -- (-2250.796) [-2246.696] (-2246.389) (-2246.729) * (-2246.769) [-2250.016] (-2246.399) (-2245.485) -- 0:00:58
      192500 -- (-2246.338) (-2250.438) [-2246.904] (-2246.957) * (-2248.934) (-2249.461) (-2250.585) [-2245.456] -- 0:00:58
      193000 -- (-2246.291) [-2248.364] (-2250.070) (-2247.780) * (-2246.082) (-2248.413) (-2248.208) [-2245.597] -- 0:00:58
      193500 -- [-2245.383] (-2247.222) (-2248.365) (-2246.854) * (-2245.581) (-2245.873) [-2247.923] (-2245.597) -- 0:00:58
      194000 -- (-2245.318) [-2247.745] (-2247.327) (-2246.321) * [-2245.375] (-2245.901) (-2246.491) (-2245.480) -- 0:00:58
      194500 -- (-2245.415) (-2247.395) (-2253.144) [-2245.661] * [-2245.630] (-2246.426) (-2246.441) (-2246.752) -- 0:00:57
      195000 -- (-2246.213) (-2248.032) (-2246.728) [-2245.654] * (-2251.425) (-2246.099) [-2248.017] (-2247.574) -- 0:00:57

      Average standard deviation of split frequencies: 0.012266

      195500 -- (-2248.080) (-2247.822) (-2251.924) [-2246.231] * (-2250.650) [-2246.864] (-2255.211) (-2246.400) -- 0:00:57
      196000 -- [-2247.163] (-2246.848) (-2251.653) (-2246.595) * [-2248.989] (-2247.164) (-2253.720) (-2247.696) -- 0:00:57
      196500 -- (-2247.253) (-2245.543) (-2250.130) [-2247.012] * (-2247.773) (-2248.261) [-2248.234] (-2247.696) -- 0:00:57
      197000 -- [-2247.970] (-2246.205) (-2245.993) (-2247.139) * (-2247.728) (-2246.142) (-2246.391) [-2248.124] -- 0:00:57
      197500 -- (-2248.075) (-2252.889) (-2247.887) [-2251.537] * (-2248.130) (-2246.133) (-2246.726) [-2249.452] -- 0:00:56
      198000 -- [-2249.625] (-2246.747) (-2246.633) (-2251.018) * (-2249.487) (-2246.383) [-2246.081] (-2251.569) -- 0:00:56
      198500 -- [-2245.850] (-2247.592) (-2245.825) (-2250.843) * (-2246.849) (-2246.150) [-2248.717] (-2252.524) -- 0:00:56
      199000 -- (-2246.056) (-2248.581) [-2245.684] (-2246.998) * (-2250.538) (-2246.583) [-2247.645] (-2252.382) -- 0:00:56
      199500 -- (-2246.406) (-2247.047) (-2246.718) [-2247.044] * (-2251.700) [-2247.275] (-2249.386) (-2250.273) -- 0:00:56
      200000 -- (-2245.617) (-2246.938) (-2245.526) [-2251.563] * (-2250.369) [-2247.521] (-2248.631) (-2249.663) -- 0:00:55

      Average standard deviation of split frequencies: 0.012921

      200500 -- (-2245.737) (-2248.907) (-2247.865) [-2248.365] * [-2251.557] (-2247.402) (-2248.735) (-2246.855) -- 0:00:55
      201000 -- (-2246.650) [-2246.360] (-2248.069) (-2248.032) * (-2253.259) (-2246.935) (-2247.113) [-2246.856] -- 0:00:55
      201500 -- (-2254.165) (-2249.536) (-2246.664) [-2246.937] * (-2248.983) (-2247.432) (-2246.956) [-2245.922] -- 0:00:55
      202000 -- [-2249.062] (-2250.828) (-2247.034) (-2247.606) * [-2248.826] (-2247.593) (-2247.176) (-2246.962) -- 0:00:55
      202500 -- (-2249.470) [-2246.312] (-2247.062) (-2247.486) * (-2249.021) [-2246.510] (-2247.027) (-2247.612) -- 0:00:59
      203000 -- [-2249.052] (-2246.896) (-2249.043) (-2247.631) * (-2250.020) [-2247.903] (-2247.205) (-2249.143) -- 0:00:58
      203500 -- (-2248.523) [-2249.615] (-2245.431) (-2247.865) * (-2247.825) (-2248.604) (-2246.087) [-2248.278] -- 0:00:58
      204000 -- (-2250.772) [-2248.927] (-2245.507) (-2247.067) * (-2248.747) (-2248.293) [-2246.735] (-2248.010) -- 0:00:58
      204500 -- [-2246.748] (-2245.486) (-2248.534) (-2247.732) * (-2247.918) (-2249.145) (-2249.034) [-2246.198] -- 0:00:58
      205000 -- [-2250.435] (-2245.932) (-2249.849) (-2249.286) * (-2249.843) (-2249.145) (-2245.606) [-2246.012] -- 0:00:58

      Average standard deviation of split frequencies: 0.012767

      205500 -- [-2247.151] (-2249.130) (-2251.202) (-2249.940) * (-2249.125) (-2252.062) [-2245.239] (-2249.057) -- 0:00:57
      206000 -- [-2250.848] (-2245.999) (-2247.600) (-2247.222) * (-2249.047) (-2248.831) (-2247.845) [-2248.905] -- 0:00:57
      206500 -- [-2250.709] (-2249.084) (-2245.848) (-2247.288) * [-2249.544] (-2250.999) (-2248.396) (-2248.963) -- 0:00:57
      207000 -- (-2245.799) (-2249.062) (-2246.781) [-2250.669] * (-2248.723) (-2249.690) [-2248.109] (-2248.451) -- 0:00:57
      207500 -- (-2248.664) [-2245.773] (-2247.126) (-2247.126) * (-2250.799) (-2247.298) [-2245.480] (-2247.195) -- 0:00:57
      208000 -- (-2245.251) (-2247.208) (-2247.314) [-2246.730] * (-2251.103) [-2249.944] (-2246.756) (-2246.367) -- 0:00:57
      208500 -- [-2245.434] (-2248.077) (-2251.535) (-2248.609) * (-2251.170) (-2246.388) (-2247.550) [-2247.204] -- 0:00:56
      209000 -- [-2245.537] (-2246.510) (-2248.185) (-2249.827) * (-2246.889) (-2256.698) [-2248.059] (-2246.965) -- 0:00:56
      209500 -- (-2246.168) (-2247.932) (-2248.728) [-2248.169] * [-2248.632] (-2248.487) (-2249.684) (-2247.101) -- 0:00:56
      210000 -- (-2245.717) (-2245.493) (-2249.595) [-2247.078] * (-2248.315) (-2248.488) [-2247.864] (-2253.394) -- 0:00:56

      Average standard deviation of split frequencies: 0.012955

      210500 -- [-2245.620] (-2245.693) (-2245.756) (-2246.909) * [-2247.460] (-2248.298) (-2248.237) (-2253.068) -- 0:00:56
      211000 -- [-2246.264] (-2246.226) (-2245.783) (-2246.683) * [-2247.982] (-2246.681) (-2247.992) (-2246.209) -- 0:00:56
      211500 -- (-2245.681) [-2246.747] (-2251.209) (-2247.105) * (-2246.231) [-2247.260] (-2246.637) (-2245.896) -- 0:00:55
      212000 -- (-2245.693) (-2247.652) (-2246.425) [-2248.309] * (-2246.231) (-2246.419) [-2245.856] (-2248.852) -- 0:00:55
      212500 -- (-2246.649) (-2248.819) (-2246.792) [-2248.230] * [-2246.959] (-2253.527) (-2247.738) (-2246.775) -- 0:00:55
      213000 -- (-2248.031) (-2255.954) [-2247.208] (-2248.201) * (-2246.908) (-2254.142) (-2248.392) [-2247.159] -- 0:00:55
      213500 -- (-2245.381) (-2249.166) [-2245.643] (-2247.736) * (-2247.524) (-2252.457) (-2247.785) [-2247.164] -- 0:00:55
      214000 -- (-2249.375) [-2247.964] (-2247.917) (-2247.163) * [-2246.633] (-2254.077) (-2246.091) (-2245.411) -- 0:00:55
      214500 -- [-2247.456] (-2249.213) (-2250.777) (-2246.819) * [-2247.654] (-2247.614) (-2246.048) (-2248.871) -- 0:00:54
      215000 -- (-2245.555) (-2247.961) (-2245.915) [-2252.401] * (-2247.947) (-2246.677) (-2245.871) [-2246.466] -- 0:00:54

      Average standard deviation of split frequencies: 0.012176

      215500 -- (-2248.720) (-2246.800) (-2245.473) [-2246.476] * (-2247.580) (-2248.688) (-2252.468) [-2247.087] -- 0:00:54
      216000 -- (-2246.182) [-2246.034] (-2246.233) (-2246.199) * (-2250.579) (-2252.321) (-2247.634) [-2247.045] -- 0:00:54
      216500 -- (-2246.476) (-2245.550) (-2246.190) [-2246.704] * (-2249.402) [-2248.333] (-2248.126) (-2246.697) -- 0:00:54
      217000 -- (-2246.246) (-2245.329) [-2249.299] (-2246.317) * [-2250.126] (-2248.272) (-2248.116) (-2249.738) -- 0:00:54
      217500 -- (-2245.773) (-2245.386) (-2246.869) [-2245.239] * (-2248.171) (-2248.252) (-2247.535) [-2248.958] -- 0:00:57
      218000 -- (-2245.625) (-2246.433) [-2246.580] (-2245.206) * (-2249.134) [-2250.835] (-2250.477) (-2250.950) -- 0:00:57
      218500 -- (-2246.219) (-2245.733) [-2246.193] (-2245.219) * (-2248.340) (-2245.868) (-2248.112) [-2250.489] -- 0:00:57
      219000 -- (-2249.225) [-2245.304] (-2249.827) (-2246.014) * (-2250.515) [-2248.982] (-2247.432) (-2246.445) -- 0:00:57
      219500 -- (-2246.623) (-2246.584) (-2249.659) [-2247.683] * (-2252.139) [-2247.800] (-2247.145) (-2248.694) -- 0:00:56
      220000 -- (-2245.730) [-2247.037] (-2248.440) (-2245.180) * (-2247.836) (-2246.942) [-2247.584] (-2247.161) -- 0:00:56

      Average standard deviation of split frequencies: 0.013380

      220500 -- [-2245.792] (-2248.148) (-2249.033) (-2248.685) * (-2247.417) (-2250.139) [-2248.244] (-2249.905) -- 0:00:56
      221000 -- (-2248.132) [-2249.706] (-2247.821) (-2249.081) * (-2247.181) [-2249.754] (-2247.003) (-2246.678) -- 0:00:56
      221500 -- (-2248.556) (-2248.698) [-2246.376] (-2249.558) * (-2245.839) (-2246.986) [-2247.118] (-2247.104) -- 0:00:56
      222000 -- (-2247.114) (-2246.490) [-2246.494] (-2248.170) * (-2247.656) (-2248.363) [-2249.757] (-2248.776) -- 0:00:56
      222500 -- (-2247.047) (-2246.490) [-2247.920] (-2248.546) * (-2249.016) (-2250.347) (-2247.417) [-2246.123] -- 0:00:55
      223000 -- (-2247.790) (-2248.514) (-2247.349) [-2246.803] * (-2249.081) (-2250.329) (-2247.126) [-2245.934] -- 0:00:55
      223500 -- [-2247.276] (-2247.150) (-2245.688) (-2246.343) * (-2250.584) (-2248.204) (-2247.028) [-2247.639] -- 0:00:55
      224000 -- (-2249.231) [-2249.767] (-2246.615) (-2247.027) * (-2252.247) [-2246.905] (-2250.419) (-2248.644) -- 0:00:55
      224500 -- [-2247.352] (-2249.724) (-2246.575) (-2245.492) * (-2254.424) [-2247.237] (-2247.197) (-2247.122) -- 0:00:55
      225000 -- [-2249.032] (-2253.186) (-2247.235) (-2247.243) * (-2251.308) (-2246.947) [-2247.022] (-2245.883) -- 0:00:55

      Average standard deviation of split frequencies: 0.012625

      225500 -- [-2253.045] (-2247.860) (-2246.480) (-2252.737) * (-2250.801) [-2250.218] (-2248.756) (-2246.484) -- 0:00:54
      226000 -- (-2248.565) (-2249.385) [-2247.988] (-2249.410) * (-2249.342) [-2250.322] (-2248.474) (-2246.226) -- 0:00:54
      226500 -- (-2246.957) (-2247.462) (-2250.174) [-2248.007] * (-2251.255) (-2249.046) [-2248.829] (-2246.111) -- 0:00:54
      227000 -- (-2247.241) (-2252.740) (-2248.721) [-2248.896] * (-2249.322) (-2246.152) (-2248.873) [-2246.175] -- 0:00:54
      227500 -- (-2248.331) (-2249.992) [-2245.779] (-2247.262) * (-2249.815) (-2248.417) (-2246.788) [-2246.922] -- 0:00:54
      228000 -- (-2248.949) (-2248.526) (-2248.380) [-2246.968] * [-2247.193] (-2247.883) (-2248.371) (-2248.132) -- 0:00:54
      228500 -- (-2246.302) (-2249.255) (-2247.965) [-2246.875] * (-2250.011) (-2248.198) [-2248.178] (-2246.682) -- 0:00:54
      229000 -- (-2246.715) [-2252.581] (-2248.960) (-2247.441) * (-2248.375) (-2249.345) [-2249.766] (-2248.439) -- 0:00:53
      229500 -- (-2246.715) [-2248.885] (-2253.268) (-2246.473) * (-2250.916) (-2250.219) [-2247.115] (-2248.115) -- 0:00:53
      230000 -- [-2248.291] (-2248.041) (-2252.947) (-2246.945) * (-2249.266) (-2251.275) [-2247.088] (-2249.955) -- 0:00:53

      Average standard deviation of split frequencies: 0.013445

      230500 -- (-2253.263) (-2247.749) [-2248.647] (-2249.848) * [-2249.564] (-2249.582) (-2247.891) (-2248.522) -- 0:00:53
      231000 -- (-2248.077) (-2249.297) (-2246.332) [-2247.455] * (-2248.456) [-2246.781] (-2248.612) (-2247.664) -- 0:00:53
      231500 -- (-2247.717) (-2248.396) (-2246.336) [-2247.916] * (-2249.059) [-2246.830] (-2249.001) (-2250.338) -- 0:00:53
      232000 -- (-2252.613) (-2246.794) (-2248.848) [-2248.170] * (-2248.521) (-2246.800) [-2248.786] (-2246.937) -- 0:00:52
      232500 -- (-2250.329) [-2245.739] (-2247.640) (-2248.062) * [-2248.534] (-2249.464) (-2249.119) (-2245.943) -- 0:00:56
      233000 -- (-2248.890) (-2247.223) [-2249.695] (-2248.883) * (-2248.865) (-2249.495) (-2249.434) [-2245.464] -- 0:00:55
      233500 -- [-2249.087] (-2245.486) (-2246.692) (-2247.245) * (-2247.382) (-2246.976) [-2247.342] (-2249.675) -- 0:00:55
      234000 -- (-2247.808) (-2247.103) [-2251.329] (-2247.262) * (-2252.300) (-2248.189) (-2247.697) [-2249.519] -- 0:00:55
      234500 -- (-2251.845) (-2249.638) (-2248.463) [-2246.645] * (-2251.332) (-2246.628) [-2251.230] (-2251.108) -- 0:00:55
      235000 -- (-2249.830) [-2249.240] (-2250.015) (-2246.645) * (-2247.252) [-2246.552] (-2249.658) (-2252.749) -- 0:00:55

      Average standard deviation of split frequencies: 0.014087

      235500 -- (-2246.291) (-2248.936) (-2248.886) [-2249.009] * (-2251.408) (-2246.154) (-2250.709) [-2248.404] -- 0:00:55
      236000 -- [-2248.461] (-2247.241) (-2246.514) (-2246.688) * (-2248.817) [-2246.793] (-2251.242) (-2248.718) -- 0:00:55
      236500 -- [-2249.052] (-2246.960) (-2246.260) (-2249.440) * (-2248.864) [-2248.255] (-2251.137) (-2252.567) -- 0:00:54
      237000 -- (-2250.323) [-2248.109] (-2246.454) (-2252.140) * (-2248.742) [-2247.742] (-2250.682) (-2258.251) -- 0:00:54
      237500 -- (-2246.537) [-2251.808] (-2246.997) (-2248.027) * (-2246.122) (-2250.216) (-2249.093) [-2246.940] -- 0:00:54
      238000 -- (-2248.559) (-2248.369) (-2251.993) [-2249.630] * (-2248.184) [-2245.761] (-2248.805) (-2249.691) -- 0:00:54
      238500 -- (-2246.893) (-2248.489) [-2248.563] (-2249.767) * [-2247.412] (-2245.891) (-2247.809) (-2249.480) -- 0:00:54
      239000 -- (-2246.827) (-2247.675) [-2249.491] (-2246.836) * (-2245.830) (-2248.396) (-2247.222) [-2249.737] -- 0:00:54
      239500 -- (-2247.994) (-2245.911) [-2248.852] (-2250.601) * (-2247.201) (-2250.283) [-2246.774] (-2249.376) -- 0:00:53
      240000 -- [-2248.859] (-2246.356) (-2246.163) (-2251.307) * [-2245.736] (-2253.489) (-2245.355) (-2246.343) -- 0:00:53

      Average standard deviation of split frequencies: 0.013276

      240500 -- (-2250.980) (-2246.294) [-2249.398] (-2247.434) * (-2246.597) (-2249.041) (-2251.201) [-2249.601] -- 0:00:53
      241000 -- (-2251.553) [-2246.613] (-2247.432) (-2248.045) * [-2247.077] (-2250.577) (-2250.276) (-2247.385) -- 0:00:53
      241500 -- (-2250.415) (-2246.613) (-2249.958) [-2248.005] * (-2246.735) [-2249.097] (-2249.473) (-2246.861) -- 0:00:53
      242000 -- (-2250.083) (-2245.911) (-2247.400) [-2251.380] * [-2250.092] (-2249.776) (-2249.767) (-2245.780) -- 0:00:53
      242500 -- (-2249.925) (-2247.869) [-2247.021] (-2250.277) * (-2250.393) (-2247.174) (-2255.586) [-2245.954] -- 0:00:53
      243000 -- (-2250.265) (-2246.933) (-2246.919) [-2245.713] * (-2249.379) (-2248.208) (-2254.689) [-2245.928] -- 0:00:52
      243500 -- (-2246.722) [-2246.421] (-2246.946) (-2247.623) * (-2254.370) (-2246.901) (-2251.659) [-2246.101] -- 0:00:52
      244000 -- (-2247.108) (-2246.299) [-2248.000] (-2246.204) * (-2247.958) (-2249.363) [-2245.623] (-2247.686) -- 0:00:52
      244500 -- [-2246.735] (-2252.059) (-2247.396) (-2246.538) * (-2246.738) (-2252.878) [-2245.509] (-2248.036) -- 0:00:52
      245000 -- (-2246.807) (-2252.934) (-2247.162) [-2245.397] * [-2245.927] (-2253.088) (-2246.307) (-2247.671) -- 0:00:52

      Average standard deviation of split frequencies: 0.012305

      245500 -- [-2247.097] (-2249.248) (-2247.054) (-2246.444) * (-2247.638) (-2249.403) [-2246.669] (-2248.126) -- 0:00:52
      246000 -- (-2247.829) [-2247.257] (-2248.283) (-2252.518) * (-2246.693) (-2251.964) [-2246.900] (-2253.516) -- 0:00:52
      246500 -- (-2248.437) [-2247.887] (-2248.370) (-2247.447) * (-2248.612) (-2248.375) [-2246.156] (-2252.567) -- 0:00:51
      247000 -- (-2252.769) (-2247.441) [-2245.832] (-2251.222) * [-2250.026] (-2251.746) (-2248.159) (-2248.795) -- 0:00:51
      247500 -- (-2247.630) (-2249.575) [-2246.438] (-2247.729) * (-2247.678) (-2251.390) [-2248.055] (-2248.305) -- 0:00:54
      248000 -- (-2246.511) (-2247.345) [-2248.661] (-2246.742) * (-2247.966) (-2250.404) (-2248.761) [-2247.961] -- 0:00:54
      248500 -- [-2245.307] (-2248.960) (-2248.758) (-2252.943) * (-2247.910) (-2246.108) [-2248.586] (-2247.847) -- 0:00:54
      249000 -- [-2246.176] (-2247.327) (-2250.524) (-2253.291) * [-2248.081] (-2246.967) (-2249.335) (-2247.599) -- 0:00:54
      249500 -- (-2246.207) (-2247.319) [-2249.478] (-2252.350) * (-2250.621) (-2248.690) [-2248.626] (-2247.599) -- 0:00:54
      250000 -- (-2249.680) (-2246.911) [-2251.106] (-2247.560) * (-2254.064) (-2248.258) (-2251.214) [-2249.689] -- 0:00:54

      Average standard deviation of split frequencies: 0.011482

      250500 -- (-2249.318) (-2248.289) [-2249.960] (-2248.262) * [-2246.974] (-2246.324) (-2250.816) (-2249.695) -- 0:00:53
      251000 -- [-2249.392] (-2246.629) (-2250.235) (-2246.193) * (-2246.541) (-2246.218) [-2246.224] (-2246.732) -- 0:00:53
      251500 -- (-2248.541) (-2247.030) [-2248.376] (-2248.450) * (-2246.632) (-2249.813) (-2247.503) [-2246.601] -- 0:00:53
      252000 -- [-2248.694] (-2246.201) (-2251.680) (-2245.968) * (-2248.845) [-2247.709] (-2250.591) (-2246.661) -- 0:00:53
      252500 -- [-2252.924] (-2247.182) (-2247.654) (-2246.201) * [-2247.951] (-2247.693) (-2246.351) (-2246.402) -- 0:00:53
      253000 -- (-2253.032) (-2245.749) (-2249.140) [-2246.847] * (-2247.340) [-2247.769] (-2247.051) (-2247.343) -- 0:00:53
      253500 -- (-2246.844) (-2245.934) [-2246.401] (-2246.598) * [-2248.561] (-2247.424) (-2248.671) (-2250.638) -- 0:00:53
      254000 -- (-2247.947) [-2248.628] (-2245.711) (-2246.922) * (-2248.577) (-2247.741) (-2246.186) [-2250.327] -- 0:00:52
      254500 -- [-2247.300] (-2248.647) (-2247.207) (-2246.485) * [-2247.285] (-2249.328) (-2246.164) (-2247.440) -- 0:00:52
      255000 -- [-2248.230] (-2249.270) (-2247.138) (-2247.359) * (-2247.329) [-2248.093] (-2249.072) (-2246.281) -- 0:00:52

      Average standard deviation of split frequencies: 0.010026

      255500 -- (-2248.785) [-2246.422] (-2248.191) (-2246.433) * (-2248.154) (-2247.247) (-2247.945) [-2245.449] -- 0:00:52
      256000 -- [-2246.482] (-2246.497) (-2251.221) (-2246.434) * (-2249.193) (-2249.418) [-2249.524] (-2246.482) -- 0:00:52
      256500 -- (-2247.278) (-2246.856) [-2249.812] (-2246.847) * (-2248.679) (-2246.420) [-2246.227] (-2248.683) -- 0:00:52
      257000 -- (-2252.072) (-2246.355) [-2247.802] (-2247.717) * (-2247.359) [-2248.978] (-2247.000) (-2252.678) -- 0:00:52
      257500 -- [-2245.819] (-2246.155) (-2253.501) (-2248.420) * [-2247.327] (-2247.251) (-2246.733) (-2249.451) -- 0:00:51
      258000 -- (-2245.512) (-2246.875) (-2248.234) [-2247.870] * (-2249.315) (-2247.816) (-2248.774) [-2246.347] -- 0:00:51
      258500 -- (-2246.833) (-2245.581) (-2250.831) [-2247.582] * (-2246.275) [-2246.350] (-2248.701) (-2247.607) -- 0:00:51
      259000 -- (-2247.304) (-2249.310) (-2250.113) [-2247.587] * [-2246.191] (-2247.853) (-2246.556) (-2247.499) -- 0:00:51
      259500 -- [-2246.089] (-2245.626) (-2249.358) (-2247.619) * [-2249.785] (-2251.244) (-2253.544) (-2251.699) -- 0:00:51
      260000 -- [-2247.787] (-2246.898) (-2249.874) (-2250.665) * (-2251.630) [-2249.325] (-2248.264) (-2253.928) -- 0:00:51

      Average standard deviation of split frequencies: 0.010650

      260500 -- (-2252.138) (-2247.356) (-2248.505) [-2247.942] * [-2249.182] (-2248.786) (-2249.917) (-2252.700) -- 0:00:51
      261000 -- [-2251.728] (-2252.119) (-2248.583) (-2247.786) * (-2247.597) (-2248.233) [-2249.801] (-2247.800) -- 0:00:50
      261500 -- [-2253.114] (-2249.474) (-2247.610) (-2248.454) * [-2250.227] (-2249.374) (-2247.158) (-2248.413) -- 0:00:50
      262000 -- (-2254.410) (-2247.310) [-2247.997] (-2248.312) * (-2247.681) (-2249.648) (-2248.322) [-2248.275] -- 0:00:50
      262500 -- (-2252.119) (-2246.256) (-2246.716) [-2247.136] * (-2247.621) [-2250.029] (-2246.897) (-2247.875) -- 0:00:53
      263000 -- (-2251.848) (-2250.654) [-2249.401] (-2247.296) * [-2246.234] (-2248.407) (-2246.939) (-2247.399) -- 0:00:53
      263500 -- [-2246.977] (-2246.912) (-2247.552) (-2247.130) * (-2246.800) (-2247.058) (-2246.917) [-2247.707] -- 0:00:53
      264000 -- (-2247.899) (-2247.714) (-2246.764) [-2247.016] * [-2247.929] (-2248.253) (-2246.990) (-2248.483) -- 0:00:52
      264500 -- (-2247.090) (-2250.843) (-2247.495) [-2250.239] * (-2249.129) (-2246.016) (-2245.957) [-2245.879] -- 0:00:52
      265000 -- (-2247.157) (-2249.792) [-2247.288] (-2250.094) * (-2249.841) (-2246.016) [-2247.277] (-2246.707) -- 0:00:52

      Average standard deviation of split frequencies: 0.010732

      265500 -- (-2245.990) [-2249.672] (-2246.500) (-2250.446) * (-2248.910) [-2246.343] (-2246.563) (-2246.935) -- 0:00:52
      266000 -- (-2248.952) (-2247.023) (-2246.117) [-2252.251] * (-2248.604) [-2250.052] (-2246.697) (-2247.442) -- 0:00:52
      266500 -- [-2249.883] (-2248.740) (-2245.751) (-2250.235) * (-2246.793) (-2245.505) (-2249.338) [-2247.503] -- 0:00:52
      267000 -- [-2249.836] (-2249.802) (-2246.605) (-2249.582) * (-2246.954) (-2247.996) [-2247.176] (-2251.436) -- 0:00:52
      267500 -- (-2249.970) (-2248.588) (-2247.944) [-2248.028] * (-2247.213) (-2247.989) (-2246.619) [-2248.836] -- 0:00:52
      268000 -- (-2246.649) (-2250.555) (-2246.374) [-2248.152] * (-2247.126) (-2247.296) (-2247.613) [-2246.176] -- 0:00:51
      268500 -- (-2246.719) [-2249.182] (-2246.633) (-2245.649) * (-2251.307) (-2256.091) (-2246.291) [-2245.825] -- 0:00:51
      269000 -- [-2246.737] (-2247.576) (-2245.610) (-2245.869) * (-2250.068) (-2252.746) [-2246.287] (-2246.579) -- 0:00:51
      269500 -- (-2249.175) (-2250.693) [-2245.552] (-2248.829) * [-2248.827] (-2249.408) (-2248.956) (-2246.579) -- 0:00:51
      270000 -- [-2247.186] (-2250.285) (-2246.467) (-2248.070) * (-2248.361) (-2249.961) (-2248.721) [-2245.374] -- 0:00:51

      Average standard deviation of split frequencies: 0.009966

      270500 -- (-2247.272) (-2246.483) (-2245.480) [-2246.683] * (-2248.371) (-2250.320) (-2247.493) [-2246.468] -- 0:00:51
      271000 -- (-2251.176) (-2245.842) [-2245.419] (-2246.923) * [-2247.520] (-2248.979) (-2249.924) (-2246.436) -- 0:00:51
      271500 -- [-2246.289] (-2246.260) (-2245.435) (-2247.702) * [-2247.692] (-2245.568) (-2249.873) (-2246.339) -- 0:00:50
      272000 -- (-2248.313) [-2249.007] (-2246.247) (-2248.993) * (-2246.685) (-2246.262) (-2250.966) [-2246.395] -- 0:00:50
      272500 -- [-2248.231] (-2247.849) (-2245.439) (-2247.758) * (-2246.865) (-2247.101) [-2248.020] (-2245.967) -- 0:00:50
      273000 -- (-2247.520) (-2246.410) (-2248.963) [-2246.729] * (-2247.204) [-2247.079] (-2248.761) (-2246.450) -- 0:00:50
      273500 -- [-2249.978] (-2248.259) (-2248.670) (-2247.096) * (-2249.259) [-2246.669] (-2246.755) (-2247.057) -- 0:00:50
      274000 -- (-2247.554) (-2253.022) (-2245.567) [-2246.018] * (-2246.292) (-2251.157) (-2248.176) [-2246.202] -- 0:00:50
      274500 -- (-2247.537) [-2248.711] (-2247.226) (-2248.260) * (-2246.545) (-2249.817) (-2246.028) [-2245.367] -- 0:00:50
      275000 -- (-2247.728) (-2249.850) [-2245.699] (-2248.217) * (-2245.926) (-2248.943) [-2247.921] (-2246.394) -- 0:00:50

      Average standard deviation of split frequencies: 0.009645

      275500 -- (-2248.308) [-2248.554] (-2245.815) (-2248.606) * [-2247.141] (-2246.589) (-2247.064) (-2246.206) -- 0:00:49
      276000 -- (-2249.547) (-2252.462) (-2245.968) [-2249.014] * (-2247.141) [-2249.323] (-2247.634) (-2251.033) -- 0:00:49
      276500 -- (-2246.946) (-2247.513) [-2247.231] (-2247.594) * (-2250.040) [-2248.336] (-2245.477) (-2248.035) -- 0:00:49
      277000 -- (-2247.853) [-2246.171] (-2246.427) (-2252.270) * (-2251.253) [-2247.606] (-2245.617) (-2248.444) -- 0:00:49
      277500 -- (-2247.626) (-2248.760) (-2246.421) [-2246.341] * (-2248.911) [-2248.338] (-2246.275) (-2246.443) -- 0:00:52
      278000 -- [-2246.169] (-2247.199) (-2249.323) (-2247.852) * (-2248.379) (-2246.830) (-2245.268) [-2245.757] -- 0:00:51
      278500 -- [-2246.056] (-2250.498) (-2245.618) (-2247.179) * (-2248.197) (-2246.293) [-2246.217] (-2247.725) -- 0:00:51
      279000 -- (-2246.211) (-2247.613) [-2245.618] (-2248.386) * (-2246.990) (-2251.171) (-2246.520) [-2247.249] -- 0:00:51
      279500 -- (-2251.770) (-2246.455) (-2245.368) [-2246.361] * [-2248.376] (-2248.850) (-2246.622) (-2246.122) -- 0:00:51
      280000 -- (-2248.878) (-2245.788) [-2245.778] (-2246.257) * (-2247.757) (-2249.527) (-2246.312) [-2247.857] -- 0:00:51

      Average standard deviation of split frequencies: 0.009133

      280500 -- (-2248.834) (-2246.342) [-2245.946] (-2247.813) * (-2246.402) [-2251.655] (-2245.438) (-2248.656) -- 0:00:51
      281000 -- (-2246.036) (-2250.084) (-2245.946) [-2247.191] * [-2245.568] (-2250.626) (-2245.499) (-2248.253) -- 0:00:51
      281500 -- (-2248.086) (-2249.964) [-2245.985] (-2250.916) * [-2248.366] (-2251.371) (-2247.693) (-2247.965) -- 0:00:51
      282000 -- [-2247.317] (-2249.170) (-2248.044) (-2250.247) * [-2250.337] (-2246.536) (-2249.855) (-2247.522) -- 0:00:50
      282500 -- (-2248.038) [-2248.950] (-2249.042) (-2249.404) * (-2247.875) [-2245.845] (-2249.008) (-2246.504) -- 0:00:50
      283000 -- (-2246.879) (-2249.617) [-2247.328] (-2248.566) * (-2246.943) (-2247.266) (-2250.806) [-2247.991] -- 0:00:50
      283500 -- (-2248.829) (-2248.738) [-2248.074] (-2246.364) * (-2247.151) [-2246.725] (-2246.098) (-2247.648) -- 0:00:50
      284000 -- (-2251.114) (-2247.923) [-2247.093] (-2246.117) * (-2246.439) [-2246.697] (-2246.794) (-2249.150) -- 0:00:50
      284500 -- [-2249.185] (-2247.777) (-2248.674) (-2246.726) * (-2248.484) (-2250.308) (-2247.620) [-2249.107] -- 0:00:50
      285000 -- (-2245.983) (-2246.120) [-2247.464] (-2247.511) * (-2246.279) (-2246.849) [-2248.684] (-2248.177) -- 0:00:50

      Average standard deviation of split frequencies: 0.009432

      285500 -- (-2246.929) (-2247.129) (-2246.287) [-2246.913] * (-2248.560) [-2246.815] (-2247.063) (-2247.152) -- 0:00:50
      286000 -- (-2252.311) (-2251.300) (-2246.714) [-2246.354] * (-2247.375) (-2247.056) [-2251.560] (-2245.816) -- 0:00:49
      286500 -- (-2252.360) [-2246.218] (-2247.879) (-2247.134) * (-2246.140) [-2246.368] (-2249.921) (-2246.115) -- 0:00:49
      287000 -- (-2253.690) [-2246.441] (-2248.820) (-2249.428) * [-2245.846] (-2247.627) (-2250.129) (-2251.149) -- 0:00:49
      287500 -- [-2250.832] (-2246.399) (-2247.395) (-2249.473) * (-2248.637) (-2253.454) [-2251.440] (-2248.494) -- 0:00:49
      288000 -- (-2250.250) (-2253.393) [-2247.255] (-2248.193) * (-2248.264) (-2253.384) [-2247.057] (-2247.162) -- 0:00:49
      288500 -- (-2249.883) [-2247.801] (-2245.387) (-2245.381) * (-2247.255) [-2248.185] (-2252.646) (-2247.401) -- 0:00:49
      289000 -- (-2253.631) [-2246.585] (-2246.729) (-2246.288) * (-2249.252) (-2247.507) (-2246.847) [-2251.094] -- 0:00:49
      289500 -- [-2251.047] (-2246.232) (-2249.574) (-2246.682) * (-2248.766) (-2247.764) [-2245.256] (-2250.265) -- 0:00:49
      290000 -- (-2247.983) (-2246.120) (-2249.144) [-2246.682] * (-2253.018) (-2247.653) [-2245.420] (-2247.349) -- 0:00:48

      Average standard deviation of split frequencies: 0.010001

      290500 -- (-2247.716) (-2247.851) (-2250.287) [-2246.582] * (-2247.753) [-2247.680] (-2247.094) (-2246.783) -- 0:00:48
      291000 -- (-2247.816) (-2249.191) (-2251.958) [-2246.955] * (-2248.972) [-2247.471] (-2247.769) (-2246.029) -- 0:00:48
      291500 -- [-2245.947] (-2247.579) (-2248.263) (-2247.617) * (-2250.016) [-2247.465] (-2247.102) (-2247.215) -- 0:00:48
      292000 -- (-2246.522) [-2248.639] (-2247.806) (-2247.104) * [-2248.813] (-2247.092) (-2246.023) (-2246.049) -- 0:00:48
      292500 -- (-2246.564) [-2247.726] (-2246.697) (-2250.765) * (-2248.479) [-2247.566] (-2246.596) (-2247.445) -- 0:00:48
      293000 -- (-2249.543) [-2246.979] (-2246.696) (-2251.110) * (-2247.967) (-2247.295) (-2247.810) [-2251.891] -- 0:00:50
      293500 -- (-2249.510) (-2247.361) [-2247.340] (-2248.286) * (-2247.287) (-2246.998) (-2248.183) [-2245.975] -- 0:00:50
      294000 -- (-2249.518) [-2248.490] (-2246.736) (-2246.075) * (-2248.274) (-2246.537) [-2246.105] (-2246.738) -- 0:00:50
      294500 -- [-2251.255] (-2247.996) (-2248.516) (-2246.739) * (-2248.927) [-2246.239] (-2246.641) (-2246.960) -- 0:00:50
      295000 -- (-2249.381) [-2249.448] (-2249.598) (-2247.838) * [-2247.636] (-2249.900) (-2246.263) (-2247.414) -- 0:00:50

      Average standard deviation of split frequencies: 0.008298

      295500 -- (-2246.501) (-2248.319) [-2249.120] (-2247.029) * (-2248.351) (-2248.913) [-2247.095] (-2245.921) -- 0:00:50
      296000 -- (-2246.856) (-2251.016) [-2246.985] (-2246.086) * (-2246.606) [-2249.570] (-2246.814) (-2245.776) -- 0:00:49
      296500 -- (-2246.465) (-2248.112) [-2247.437] (-2248.737) * (-2246.571) (-2246.079) [-2246.134] (-2251.069) -- 0:00:49
      297000 -- (-2246.839) (-2246.584) (-2247.461) [-2248.910] * (-2247.725) [-2248.047] (-2246.365) (-2245.813) -- 0:00:49
      297500 -- [-2246.866] (-2246.318) (-2247.602) (-2247.646) * (-2247.708) [-2248.070] (-2246.608) (-2246.418) -- 0:00:49
      298000 -- [-2249.165] (-2247.156) (-2249.390) (-2246.814) * (-2248.780) (-2248.637) [-2246.382] (-2248.684) -- 0:00:49
      298500 -- [-2246.400] (-2247.156) (-2247.116) (-2246.925) * (-2247.034) (-2249.642) (-2246.418) [-2245.243] -- 0:00:49
      299000 -- (-2250.904) (-2248.151) [-2247.455] (-2248.294) * [-2245.550] (-2247.768) (-2246.520) (-2248.252) -- 0:00:49
      299500 -- (-2246.586) (-2249.551) (-2247.942) [-2249.633] * (-2249.637) (-2246.829) (-2246.093) [-2250.996] -- 0:00:49
      300000 -- (-2247.339) (-2247.207) (-2248.690) [-2248.827] * [-2250.083] (-2248.485) (-2250.141) (-2245.330) -- 0:00:48

      Average standard deviation of split frequencies: 0.009407

      300500 -- [-2246.424] (-2245.412) (-2249.438) (-2246.054) * (-2249.914) (-2249.756) (-2249.378) [-2246.460] -- 0:00:48
      301000 -- [-2249.725] (-2247.495) (-2247.984) (-2246.071) * [-2249.006] (-2246.440) (-2248.634) (-2245.333) -- 0:00:48
      301500 -- [-2245.910] (-2247.390) (-2247.694) (-2248.036) * (-2246.586) (-2246.824) (-2246.653) [-2245.977] -- 0:00:48
      302000 -- (-2246.454) (-2246.822) (-2247.824) [-2246.919] * (-2248.936) (-2246.500) [-2247.619] (-2246.335) -- 0:00:48
      302500 -- (-2248.174) (-2246.196) [-2247.783] (-2249.275) * [-2250.185] (-2246.774) (-2247.619) (-2245.302) -- 0:00:48
      303000 -- (-2247.242) [-2246.358] (-2248.987) (-2247.678) * [-2247.443] (-2248.086) (-2245.938) (-2246.304) -- 0:00:48
      303500 -- (-2249.103) [-2246.342] (-2247.557) (-2247.049) * [-2247.415] (-2250.882) (-2249.389) (-2246.766) -- 0:00:48
      304000 -- [-2245.726] (-2246.986) (-2247.166) (-2250.155) * [-2246.194] (-2250.093) (-2248.182) (-2245.470) -- 0:00:48
      304500 -- (-2248.268) [-2248.052] (-2246.645) (-2249.810) * (-2249.032) (-2247.969) [-2246.569] (-2246.923) -- 0:00:47
      305000 -- (-2246.655) (-2246.600) (-2247.853) [-2247.280] * (-2250.564) (-2248.225) [-2246.599] (-2245.912) -- 0:00:47

      Average standard deviation of split frequencies: 0.010938

      305500 -- [-2247.615] (-2251.170) (-2248.579) (-2248.015) * [-2246.924] (-2248.678) (-2245.868) (-2245.874) -- 0:00:47
      306000 -- (-2245.430) (-2247.368) (-2246.696) [-2246.581] * (-2245.940) (-2247.830) [-2245.594] (-2247.951) -- 0:00:47
      306500 -- [-2245.706] (-2250.894) (-2247.139) (-2247.762) * [-2246.091] (-2245.917) (-2246.840) (-2249.469) -- 0:00:47
      307000 -- (-2246.989) (-2248.693) [-2246.815] (-2251.182) * (-2249.843) (-2245.800) [-2246.424] (-2248.859) -- 0:00:47
      307500 -- [-2245.264] (-2251.256) (-2247.370) (-2251.391) * [-2247.349] (-2245.364) (-2249.175) (-2247.464) -- 0:00:49
      308000 -- (-2246.825) (-2250.247) [-2247.635] (-2245.878) * [-2247.229] (-2245.373) (-2246.421) (-2247.709) -- 0:00:49
      308500 -- (-2246.399) [-2247.835] (-2248.675) (-2246.251) * [-2247.978] (-2247.020) (-2247.112) (-2248.369) -- 0:00:49
      309000 -- (-2245.596) [-2247.869] (-2248.062) (-2246.089) * [-2249.440] (-2247.095) (-2246.974) (-2255.369) -- 0:00:49
      309500 -- (-2247.238) [-2251.812] (-2248.086) (-2245.988) * (-2249.432) (-2249.075) [-2248.254] (-2247.257) -- 0:00:49
      310000 -- (-2247.365) (-2248.962) (-2248.062) [-2247.768] * [-2248.220] (-2249.075) (-2246.822) (-2250.282) -- 0:00:48

      Average standard deviation of split frequencies: 0.011660

      310500 -- (-2251.359) [-2247.229] (-2249.894) (-2252.721) * [-2247.650] (-2245.822) (-2247.850) (-2254.552) -- 0:00:48
      311000 -- (-2246.371) [-2248.094] (-2248.209) (-2248.015) * (-2247.694) (-2248.189) (-2247.145) [-2248.526] -- 0:00:48
      311500 -- (-2247.879) (-2248.128) [-2246.461] (-2247.444) * (-2247.686) (-2245.952) [-2246.949] (-2253.339) -- 0:00:48
      312000 -- [-2245.745] (-2250.233) (-2246.293) (-2246.689) * (-2248.951) (-2248.222) (-2246.861) [-2252.065] -- 0:00:48
      312500 -- (-2246.245) (-2248.325) [-2246.821] (-2247.087) * (-2249.009) [-2247.796] (-2245.892) (-2253.307) -- 0:00:48
      313000 -- (-2246.834) (-2247.481) [-2247.168] (-2249.511) * (-2248.158) (-2249.966) (-2246.640) [-2246.983] -- 0:00:48
      313500 -- (-2246.463) (-2249.753) [-2246.624] (-2246.992) * (-2248.222) (-2248.547) [-2246.806] (-2251.078) -- 0:00:48
      314000 -- [-2245.897] (-2246.359) (-2249.306) (-2250.665) * [-2249.433] (-2249.802) (-2248.003) (-2250.674) -- 0:00:48
      314500 -- [-2247.057] (-2247.212) (-2251.951) (-2249.464) * (-2247.084) [-2248.258] (-2248.007) (-2249.476) -- 0:00:47
      315000 -- [-2247.789] (-2247.618) (-2251.361) (-2247.963) * (-2248.446) [-2249.643] (-2250.596) (-2254.488) -- 0:00:47

      Average standard deviation of split frequencies: 0.011851

      315500 -- (-2249.301) [-2247.125] (-2248.521) (-2248.381) * (-2246.679) (-2247.034) [-2249.821] (-2246.596) -- 0:00:47
      316000 -- [-2246.577] (-2249.944) (-2249.177) (-2251.295) * [-2246.996] (-2248.293) (-2249.219) (-2247.174) -- 0:00:47
      316500 -- (-2247.779) [-2248.521] (-2254.086) (-2247.285) * (-2246.615) [-2247.572] (-2250.613) (-2252.695) -- 0:00:47
      317000 -- (-2246.698) (-2246.892) [-2246.153] (-2247.914) * [-2246.615] (-2247.152) (-2247.987) (-2250.677) -- 0:00:47
      317500 -- (-2248.801) [-2245.788] (-2246.077) (-2248.200) * (-2246.992) (-2252.893) [-2250.914] (-2248.672) -- 0:00:47
      318000 -- (-2248.716) (-2247.600) (-2247.280) [-2248.441] * (-2247.004) (-2250.151) (-2250.524) [-2250.165] -- 0:00:47
      318500 -- [-2250.209] (-2249.730) (-2246.804) (-2250.559) * (-2247.170) (-2247.309) [-2250.643] (-2246.536) -- 0:00:47
      319000 -- (-2248.232) (-2250.076) [-2247.248] (-2250.916) * [-2246.669] (-2247.080) (-2248.567) (-2246.536) -- 0:00:46
      319500 -- [-2250.131] (-2247.449) (-2247.619) (-2250.531) * (-2247.560) [-2248.759] (-2251.959) (-2248.116) -- 0:00:46
      320000 -- [-2248.932] (-2247.664) (-2249.724) (-2252.540) * [-2247.564] (-2247.694) (-2248.131) (-2246.486) -- 0:00:46

      Average standard deviation of split frequencies: 0.011679

      320500 -- (-2247.844) [-2247.478] (-2249.496) (-2246.483) * (-2247.968) (-2247.103) (-2247.834) [-2246.936] -- 0:00:46
      321000 -- (-2246.726) (-2246.690) (-2246.397) [-2246.422] * (-2249.076) (-2248.545) (-2248.551) [-2247.501] -- 0:00:46
      321500 -- (-2246.067) (-2246.733) (-2246.270) [-2245.912] * [-2250.726] (-2247.285) (-2245.408) (-2247.501) -- 0:00:46
      322000 -- (-2248.107) (-2246.152) [-2246.333] (-2246.648) * (-2249.943) [-2248.172] (-2247.835) (-2246.736) -- 0:00:46
      322500 -- (-2246.441) (-2246.150) (-2246.246) [-2249.397] * (-2249.663) (-2248.325) [-2246.294] (-2245.870) -- 0:00:48
      323000 -- (-2246.929) (-2250.594) [-2246.334] (-2249.724) * [-2249.148] (-2246.793) (-2246.176) (-2248.035) -- 0:00:48
      323500 -- (-2247.749) (-2246.874) [-2247.519] (-2246.996) * [-2248.042] (-2248.808) (-2245.796) (-2249.588) -- 0:00:48
      324000 -- [-2247.879] (-2248.985) (-2248.468) (-2246.441) * (-2248.949) (-2249.160) [-2250.265] (-2249.602) -- 0:00:47
      324500 -- (-2249.734) (-2249.928) (-2249.508) [-2246.888] * (-2249.657) [-2246.317] (-2249.157) (-2246.271) -- 0:00:47
      325000 -- [-2247.166] (-2246.977) (-2250.387) (-2246.154) * (-2250.201) (-2245.939) (-2246.796) [-2248.188] -- 0:00:47

      Average standard deviation of split frequencies: 0.011167

      325500 -- (-2246.730) (-2247.527) (-2249.995) [-2246.165] * (-2250.977) (-2247.086) [-2245.423] (-2248.177) -- 0:00:47
      326000 -- [-2246.902] (-2248.710) (-2248.025) (-2246.048) * (-2250.313) [-2245.734] (-2246.265) (-2247.829) -- 0:00:47
      326500 -- (-2248.643) (-2250.014) [-2247.013] (-2246.997) * (-2249.279) (-2248.335) [-2247.998] (-2249.288) -- 0:00:47
      327000 -- [-2246.589] (-2247.685) (-2252.380) (-2248.187) * (-22