--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 12:24:46 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/ML2664/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1048.54 -1052.35
2 -1048.36 -1052.96
--------------------------------------
TOTAL -1048.44 -1052.70
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882020 0.086527 0.322637 1.447854 0.850960 1501.00 1501.00 1.002
r(A<->C){all} 0.164480 0.018826 0.000015 0.432994 0.129208 239.24 280.18 1.000
r(A<->G){all} 0.200859 0.024351 0.000190 0.499666 0.162464 109.08 120.31 1.018
r(A<->T){all} 0.168791 0.019816 0.000035 0.450054 0.131825 254.71 278.25 1.000
r(C<->G){all} 0.142895 0.016164 0.000151 0.403968 0.106227 140.78 201.31 1.004
r(C<->T){all} 0.167274 0.021554 0.000157 0.461951 0.127983 239.62 294.87 1.001
r(G<->T){all} 0.155700 0.019968 0.000041 0.437048 0.113003 173.88 251.06 1.004
pi(A){all} 0.207961 0.000210 0.181667 0.239358 0.207673 1276.66 1354.05 1.000
pi(C){all} 0.293996 0.000259 0.263044 0.325815 0.293898 1259.37 1278.65 1.000
pi(G){all} 0.286237 0.000255 0.253865 0.315040 0.285845 1170.86 1227.26 1.000
pi(T){all} 0.211805 0.000213 0.184571 0.240662 0.211681 1407.11 1409.80 1.000
alpha{1,2} 0.385696 0.202676 0.000112 1.293237 0.236710 857.77 1002.27 1.000
alpha{3} 0.419209 0.224495 0.000288 1.411156 0.244980 1078.75 1239.18 1.000
pinvar{all} 0.995784 0.000014 0.988635 0.999928 0.996819 1108.32 1245.01 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1014.333469
Model 2: PositiveSelection -1008.806523
Model 0: one-ratio -1013.866804
Model 7: beta -1014.537508
Model 8: beta&w>1 -1008.806522
Model 0 vs 1 0.933330000000069
Model 2 vs 1 11.053892000000133
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)
Pr(w>1) post mean +- SE for w
189 G 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)
Pr(w>1) post mean +- SE for w
189 G 0.921 6.688 +- 2.925
Model 8 vs 7 11.46197200000006
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)
Pr(w>1) post mean +- SE for w
189 G 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)
Pr(w>1) post mean +- SE for w
189 G 0.967* 6.592 +- 2.756
>C1
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C2
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C3
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C4
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C5
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C6
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=251
C1 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C2 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C3 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C4 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C5 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C6 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
**************************************************
C1 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C2 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C3 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C4 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C5 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C6 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
**************************************************
C1 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C2 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C3 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C4 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C5 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C6 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
**************************************************
C1 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
C2 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
C3 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
C4 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
C5 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
C6 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
************************************** ***********
C1 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C2 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C3 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C4 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C5 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C6 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
**************************************************
C1 A
C2 A
C3 A
C4 A
C5 A
C6 A
*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 251 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 251 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7530]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7530]--->[7530]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.494 Mb, Max= 30.804 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C2 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C3 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C4 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C5 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C6 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
**************************************************
C1 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C2 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C3 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C4 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C5 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C6 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
**************************************************
C1 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C2 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C3 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C4 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C5 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C6 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
**************************************************
C1 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
C2 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
C3 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
C4 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
C5 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
C6 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
************************************** ***********
C1 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C2 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C3 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C4 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C5 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C6 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
**************************************************
C1 A
C2 A
C3 A
C4 A
C5 A
C6 A
*
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 99.60 C1 C3 99.60
TOP 2 0 99.60 C3 C1 99.60
BOT 0 3 99.60 C1 C4 99.60
TOP 3 0 99.60 C4 C1 99.60
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 99.60 C2 C3 99.60
TOP 2 1 99.60 C3 C2 99.60
BOT 1 3 99.60 C2 C4 99.60
TOP 3 1 99.60 C4 C2 99.60
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 99.60 C3 C5 99.60
TOP 4 2 99.60 C5 C3 99.60
BOT 2 5 99.60 C3 C6 99.60
TOP 5 2 99.60 C6 C3 99.60
BOT 3 4 99.60 C4 C5 99.60
TOP 4 3 99.60 C5 C4 99.60
BOT 3 5 99.60 C4 C6 99.60
TOP 5 3 99.60 C6 C4 99.60
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.84
AVG 1 C2 * 99.84
AVG 2 C3 * 99.68
AVG 3 C4 * 99.68
AVG 4 C5 * 99.84
AVG 5 C6 * 99.84
TOT TOT * 99.79
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
C2 ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
C3 ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
C4 ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
C5 ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
C6 ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
**************************************************
C1 GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
C2 GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
C3 GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
C4 GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
C5 GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
C6 GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
**************************************************
C1 AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
C2 AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
C3 AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
C4 AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
C5 AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
C6 AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
**************************************************
C1 GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
C2 GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
C3 GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
C4 GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
C5 GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
C6 GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
**************************************************
C1 CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
C2 CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
C3 CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
C4 CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
C5 CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
C6 CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
**************************************************
C1 GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
C2 GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
C3 GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
C4 GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
C5 GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
C6 GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
**************************************************
C1 TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
C2 TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
C3 TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
C4 TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
C5 TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
C6 TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
**************************************************
C1 GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
C2 GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
C3 GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
C4 GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
C5 GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
C6 GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
**************************************************
C1 ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
C2 ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
C3 ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
C4 ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
C5 ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
C6 ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
**************************************************
C1 TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
C2 TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
C3 TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
C4 TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
C5 TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
C6 TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
**************************************************
C1 GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
C2 GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
C3 GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
C4 GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
C5 GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
C6 GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
**************************************************
C1 TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
C2 TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
C3 TAAATTCTCCCGAAGAGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
C4 TAAATTCTCCCGAAGAGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
C5 TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
C6 TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
***************.**********************************
C1 ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
C2 ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
C3 ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
C4 ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
C5 ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
C6 ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
**************************************************
C1 GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
C2 GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
C3 GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
C4 GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
C5 GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
C6 GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
**************************************************
C1 CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
C2 CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
C3 CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
C4 CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
C5 CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
C6 CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
**************************************************
C1 GCC
C2 GCC
C3 GCC
C4 GCC
C5 GCC
C6 GCC
***
>C1
ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
GCC
>C2
ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
GCC
>C3
ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
TAAATTCTCCCGAAGAGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
GCC
>C4
ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
TAAATTCTCCCGAAGAGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
GCC
>C5
ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
GCC
>C6
ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
GCC
>C1
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C2
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C3
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C4
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C5
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C6
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 753 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579782192
Setting output file names to "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 339120909
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9217139409
Seed = 906931531
Swapseed = 1579782192
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1691.921940 -- -24.965149
Chain 2 -- -1688.615690 -- -24.965149
Chain 3 -- -1691.283654 -- -24.965149
Chain 4 -- -1691.283750 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1691.263791 -- -24.965149
Chain 2 -- -1691.921940 -- -24.965149
Chain 3 -- -1691.283750 -- -24.965149
Chain 4 -- -1691.283654 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1691.922] (-1688.616) (-1691.284) (-1691.284) * [-1691.264] (-1691.922) (-1691.284) (-1691.284)
500 -- (-1064.477) (-1069.427) [-1049.795] (-1054.909) * (-1069.867) (-1052.905) (-1052.822) [-1051.490] -- 0:00:00
1000 -- (-1058.758) (-1064.289) (-1051.222) [-1048.653] * (-1057.217) (-1053.310) [-1052.280] (-1046.934) -- 0:00:00
1500 -- (-1053.930) [-1052.938] (-1053.185) (-1054.451) * (-1047.608) [-1054.705] (-1054.681) (-1051.272) -- 0:00:00
2000 -- (-1057.882) (-1052.305) (-1061.788) [-1054.062] * [-1049.171] (-1055.700) (-1063.598) (-1061.362) -- 0:00:00
2500 -- (-1053.782) [-1055.195] (-1047.750) (-1063.952) * (-1063.071) (-1060.959) (-1060.923) [-1049.456] -- 0:00:00
3000 -- (-1049.967) [-1057.513] (-1054.393) (-1051.435) * (-1053.217) (-1055.909) (-1055.256) [-1054.442] -- 0:00:00
3500 -- (-1053.369) (-1050.819) [-1052.790] (-1053.662) * (-1056.638) (-1052.054) (-1055.646) [-1048.519] -- 0:04:44
4000 -- [-1050.684] (-1053.349) (-1050.199) (-1061.555) * (-1056.652) (-1054.578) [-1053.935] (-1062.521) -- 0:04:09
4500 -- (-1057.125) (-1051.283) (-1053.421) [-1050.145] * [-1047.807] (-1056.730) (-1056.879) (-1055.835) -- 0:03:41
5000 -- (-1059.234) (-1049.495) [-1056.983] (-1047.336) * [-1047.103] (-1062.257) (-1050.703) (-1052.956) -- 0:03:19
Average standard deviation of split frequencies: 0.114280
5500 -- [-1054.902] (-1055.673) (-1051.014) (-1057.106) * (-1056.987) (-1057.045) (-1054.103) [-1054.520] -- 0:03:00
6000 -- (-1055.327) [-1052.281] (-1051.069) (-1068.205) * (-1052.333) [-1059.019] (-1053.261) (-1053.361) -- 0:02:45
6500 -- (-1057.390) (-1056.157) (-1051.179) [-1052.327] * (-1060.305) (-1048.205) [-1048.621] (-1053.612) -- 0:02:32
7000 -- (-1048.681) (-1056.510) (-1051.723) [-1047.224] * (-1054.609) (-1056.224) [-1056.169] (-1055.506) -- 0:02:21
7500 -- (-1060.211) (-1059.171) [-1049.462] (-1051.310) * [-1051.013] (-1050.815) (-1047.783) (-1052.841) -- 0:02:12
8000 -- (-1053.511) [-1052.075] (-1050.440) (-1055.717) * (-1058.480) (-1054.001) [-1051.754] (-1051.967) -- 0:02:04
8500 -- (-1055.960) [-1060.156] (-1067.614) (-1054.452) * (-1052.982) (-1051.497) (-1052.394) [-1050.638] -- 0:01:56
9000 -- [-1052.632] (-1060.134) (-1065.860) (-1056.571) * [-1056.163] (-1058.025) (-1055.895) (-1059.685) -- 0:01:50
9500 -- (-1052.261) [-1058.664] (-1058.070) (-1048.371) * [-1054.085] (-1058.072) (-1056.674) (-1049.334) -- 0:01:44
10000 -- [-1053.374] (-1052.945) (-1056.486) (-1051.920) * (-1062.294) (-1047.999) (-1051.315) [-1050.664] -- 0:01:39
Average standard deviation of split frequencies: 0.080353
10500 -- (-1054.095) (-1054.015) (-1059.857) [-1052.113] * (-1054.195) (-1057.169) (-1057.336) [-1055.645] -- 0:01:34
11000 -- (-1061.003) [-1053.980] (-1057.456) (-1054.416) * (-1059.391) [-1049.832] (-1051.593) (-1054.362) -- 0:01:29
11500 -- (-1050.855) (-1057.918) (-1054.805) [-1049.357] * (-1063.304) (-1048.294) (-1055.378) [-1050.931] -- 0:01:25
12000 -- (-1060.341) [-1054.600] (-1056.889) (-1053.638) * (-1056.183) (-1064.760) [-1052.663] (-1048.187) -- 0:01:22
12500 -- (-1053.756) (-1052.168) (-1064.856) [-1050.905] * (-1060.791) (-1058.141) [-1053.970] (-1051.766) -- 0:01:19
13000 -- [-1057.061] (-1052.603) (-1057.921) (-1049.845) * (-1055.524) [-1059.279] (-1056.284) (-1055.035) -- 0:01:15
13500 -- (-1061.214) (-1053.808) (-1068.146) [-1049.451] * (-1048.610) (-1059.368) [-1055.041] (-1050.511) -- 0:01:13
14000 -- (-1053.406) [-1053.904] (-1056.399) (-1050.970) * (-1052.753) (-1062.247) [-1053.310] (-1053.760) -- 0:01:10
14500 -- (-1062.222) (-1059.661) (-1059.119) [-1055.159] * (-1051.825) (-1061.516) [-1052.365] (-1070.365) -- 0:01:07
15000 -- (-1048.994) [-1049.028] (-1063.839) (-1053.453) * [-1049.848] (-1052.960) (-1053.444) (-1050.373) -- 0:01:05
Average standard deviation of split frequencies: 0.077675
15500 -- (-1055.340) (-1053.426) [-1055.164] (-1052.509) * [-1048.120] (-1057.420) (-1054.832) (-1059.020) -- 0:01:03
16000 -- [-1052.523] (-1053.999) (-1053.732) (-1045.736) * (-1051.259) (-1048.975) (-1070.879) [-1050.247] -- 0:01:01
16500 -- (-1050.855) (-1054.737) (-1054.251) [-1059.594] * [-1047.274] (-1049.724) (-1055.357) (-1051.524) -- 0:00:59
17000 -- (-1049.377) (-1051.322) (-1047.043) [-1052.938] * (-1050.432) (-1051.363) (-1051.036) [-1050.350] -- 0:00:57
17500 -- [-1054.410] (-1059.569) (-1056.845) (-1054.476) * [-1053.413] (-1053.682) (-1052.609) (-1050.139) -- 0:00:56
18000 -- (-1060.119) (-1059.775) (-1054.370) [-1069.386] * (-1050.810) [-1051.524] (-1050.476) (-1049.770) -- 0:01:49
18500 -- (-1050.227) [-1055.150] (-1065.739) (-1054.825) * (-1049.430) [-1049.445] (-1057.936) (-1050.980) -- 0:01:46
19000 -- [-1048.327] (-1055.687) (-1052.388) (-1053.386) * (-1047.055) (-1048.615) [-1053.739] (-1049.281) -- 0:01:43
19500 -- [-1048.782] (-1058.994) (-1060.606) (-1055.267) * (-1053.382) (-1049.747) (-1060.362) [-1048.470] -- 0:01:40
20000 -- [-1052.251] (-1062.612) (-1057.124) (-1048.098) * (-1051.431) [-1051.180] (-1056.451) (-1046.412) -- 0:01:38
Average standard deviation of split frequencies: 0.058062
20500 -- (-1048.042) [-1055.068] (-1057.815) (-1050.274) * [-1047.147] (-1049.824) (-1055.056) (-1046.372) -- 0:01:35
21000 -- (-1056.999) [-1055.541] (-1058.234) (-1053.582) * (-1051.767) (-1050.071) [-1055.711] (-1047.578) -- 0:01:33
21500 -- [-1050.002] (-1056.070) (-1062.885) (-1056.636) * (-1050.745) (-1050.515) [-1057.070] (-1050.637) -- 0:01:31
22000 -- (-1054.023) (-1058.106) (-1057.483) [-1062.285] * [-1048.631] (-1048.915) (-1059.653) (-1048.413) -- 0:01:28
22500 -- [-1050.635] (-1053.862) (-1049.687) (-1051.913) * [-1048.877] (-1050.333) (-1055.187) (-1051.684) -- 0:01:26
23000 -- [-1051.289] (-1059.713) (-1056.908) (-1056.642) * (-1048.440) (-1049.868) [-1048.838] (-1050.194) -- 0:01:24
23500 -- (-1052.921) [-1054.191] (-1053.867) (-1051.504) * (-1047.379) (-1048.701) [-1056.416] (-1048.884) -- 0:01:23
24000 -- (-1052.385) (-1055.188) (-1052.762) [-1050.883] * (-1051.667) (-1049.556) (-1055.362) [-1048.043] -- 0:01:21
24500 -- (-1060.175) (-1053.995) (-1056.346) [-1048.217] * (-1052.712) (-1046.251) (-1050.703) [-1047.948] -- 0:01:19
25000 -- (-1052.563) (-1059.718) [-1060.352] (-1059.713) * (-1049.818) (-1049.458) (-1057.098) [-1046.451] -- 0:01:18
Average standard deviation of split frequencies: 0.037657
25500 -- (-1056.287) (-1051.787) [-1057.401] (-1060.823) * (-1049.412) (-1052.072) (-1053.510) [-1049.589] -- 0:01:16
26000 -- (-1048.282) (-1053.143) (-1064.327) [-1050.703] * (-1049.071) [-1048.372] (-1057.337) (-1052.858) -- 0:01:14
26500 -- (-1052.327) (-1056.641) [-1065.002] (-1060.998) * (-1051.672) [-1048.972] (-1047.337) (-1047.710) -- 0:01:13
27000 -- (-1051.381) (-1053.106) (-1065.255) [-1050.515] * (-1054.108) [-1052.457] (-1066.166) (-1052.020) -- 0:01:12
27500 -- [-1049.078] (-1049.182) (-1049.135) (-1049.832) * (-1052.721) (-1050.620) (-1055.621) [-1049.393] -- 0:01:10
28000 -- (-1052.027) (-1053.104) (-1048.687) [-1051.179] * (-1050.331) (-1051.382) [-1049.632] (-1048.124) -- 0:01:09
28500 -- (-1054.557) (-1048.298) (-1049.346) [-1054.097] * (-1050.841) (-1050.005) [-1051.597] (-1049.292) -- 0:01:08
29000 -- [-1048.884] (-1051.855) (-1046.596) (-1053.658) * (-1049.850) (-1046.732) [-1064.158] (-1049.733) -- 0:01:06
29500 -- [-1052.791] (-1060.000) (-1051.666) (-1054.453) * (-1051.682) [-1051.069] (-1057.849) (-1048.073) -- 0:01:05
30000 -- (-1052.266) (-1055.962) (-1058.255) [-1054.546] * [-1051.964] (-1047.524) (-1054.866) (-1049.570) -- 0:01:04
Average standard deviation of split frequencies: 0.052028
30500 -- (-1064.517) [-1062.226] (-1049.544) (-1058.033) * (-1051.650) (-1049.305) (-1050.662) [-1049.020] -- 0:01:03
31000 -- (-1053.810) (-1053.097) (-1049.345) [-1047.503] * (-1049.764) [-1048.234] (-1049.474) (-1050.334) -- 0:01:02
31500 -- (-1051.706) (-1064.607) [-1044.922] (-1060.951) * (-1051.611) (-1050.295) [-1050.793] (-1049.034) -- 0:01:01
32000 -- (-1054.231) (-1051.504) (-1049.447) [-1050.896] * (-1048.846) (-1051.467) [-1050.447] (-1055.364) -- 0:01:00
32500 -- [-1050.252] (-1059.308) (-1047.714) (-1053.120) * [-1051.075] (-1050.714) (-1050.942) (-1054.061) -- 0:00:59
33000 -- (-1051.729) (-1060.251) (-1051.504) [-1051.154] * (-1048.342) (-1049.781) (-1049.078) [-1047.417] -- 0:01:27
33500 -- (-1054.781) (-1056.833) (-1051.807) [-1052.997] * (-1050.430) [-1050.706] (-1054.339) (-1051.332) -- 0:01:26
34000 -- [-1056.605] (-1054.764) (-1049.567) (-1054.564) * (-1048.422) [-1050.768] (-1049.930) (-1054.747) -- 0:01:25
34500 -- (-1052.869) (-1062.691) [-1048.332] (-1054.755) * (-1048.713) (-1049.014) (-1050.551) [-1052.638] -- 0:01:23
35000 -- (-1053.386) (-1065.730) (-1047.430) [-1050.704] * (-1051.233) [-1050.440] (-1048.389) (-1049.181) -- 0:01:22
Average standard deviation of split frequencies: 0.061108
35500 -- (-1056.383) [-1050.318] (-1053.791) (-1055.605) * (-1049.536) [-1048.952] (-1049.238) (-1050.274) -- 0:01:21
36000 -- (-1052.820) (-1050.709) [-1049.982] (-1056.429) * (-1049.823) (-1052.395) [-1049.161] (-1053.588) -- 0:01:20
36500 -- (-1055.884) [-1049.063] (-1051.731) (-1053.792) * (-1050.077) (-1049.622) [-1051.389] (-1049.879) -- 0:01:19
37000 -- (-1057.336) [-1048.295] (-1051.783) (-1051.309) * (-1049.955) (-1049.751) (-1048.851) [-1050.586] -- 0:01:18
37500 -- [-1047.960] (-1049.305) (-1053.848) (-1059.941) * (-1048.443) (-1049.944) (-1050.030) [-1053.279] -- 0:01:17
38000 -- (-1054.733) [-1048.983] (-1048.330) (-1057.489) * [-1049.066] (-1049.540) (-1049.989) (-1052.380) -- 0:01:15
38500 -- [-1050.607] (-1052.614) (-1050.202) (-1053.407) * (-1047.813) [-1049.031] (-1048.362) (-1052.137) -- 0:01:14
39000 -- (-1057.928) (-1051.269) (-1052.041) [-1051.299] * [-1049.476] (-1049.403) (-1049.523) (-1048.543) -- 0:01:13
39500 -- (-1050.715) (-1053.810) [-1051.621] (-1049.512) * (-1050.970) [-1050.547] (-1049.616) (-1049.482) -- 0:01:12
40000 -- [-1049.321] (-1050.717) (-1049.097) (-1047.954) * (-1050.959) (-1048.665) [-1049.221] (-1048.888) -- 0:01:12
Average standard deviation of split frequencies: 0.072227
40500 -- (-1054.368) [-1052.829] (-1049.423) (-1048.821) * (-1048.852) [-1049.647] (-1049.270) (-1050.901) -- 0:01:11
41000 -- (-1054.030) (-1050.148) (-1050.376) [-1048.356] * [-1046.339] (-1055.751) (-1048.611) (-1050.163) -- 0:01:10
41500 -- (-1057.083) (-1050.720) (-1050.704) [-1048.355] * [-1049.409] (-1051.221) (-1050.844) (-1047.222) -- 0:01:09
42000 -- (-1059.303) [-1050.944] (-1055.603) (-1051.694) * [-1050.750] (-1049.031) (-1048.250) (-1048.443) -- 0:01:08
42500 -- (-1050.655) (-1050.542) [-1049.705] (-1054.254) * (-1048.442) (-1051.522) [-1049.652] (-1053.200) -- 0:01:07
43000 -- [-1049.608] (-1049.254) (-1051.499) (-1053.465) * (-1049.580) [-1049.494] (-1050.073) (-1049.203) -- 0:01:06
43500 -- (-1047.987) [-1050.383] (-1048.622) (-1057.397) * [-1049.787] (-1049.990) (-1048.967) (-1050.653) -- 0:01:05
44000 -- (-1054.869) (-1054.035) (-1048.720) [-1050.813] * (-1048.416) (-1051.562) [-1050.680] (-1050.608) -- 0:01:05
44500 -- (-1053.242) [-1048.883] (-1049.064) (-1054.431) * (-1048.242) (-1049.645) [-1048.807] (-1050.615) -- 0:01:04
45000 -- (-1051.312) (-1053.462) [-1054.229] (-1054.197) * [-1051.035] (-1051.373) (-1052.115) (-1049.692) -- 0:01:03
Average standard deviation of split frequencies: 0.062854
45500 -- (-1066.264) (-1050.337) (-1049.673) [-1049.091] * (-1049.977) (-1050.138) [-1050.442] (-1050.320) -- 0:01:02
46000 -- [-1051.494] (-1050.283) (-1050.445) (-1050.353) * [-1049.306] (-1049.921) (-1049.490) (-1050.364) -- 0:01:02
46500 -- (-1048.446) [-1049.761] (-1049.535) (-1050.303) * (-1048.928) [-1048.468] (-1048.399) (-1052.502) -- 0:01:01
47000 -- [-1046.388] (-1051.417) (-1050.677) (-1051.738) * (-1048.582) (-1049.566) (-1054.890) [-1052.039] -- 0:01:00
47500 -- (-1050.962) [-1052.324] (-1048.795) (-1051.004) * (-1050.034) (-1051.608) (-1047.934) [-1050.518] -- 0:01:00
48000 -- [-1045.504] (-1049.877) (-1051.213) (-1052.409) * (-1055.152) (-1053.583) (-1048.768) [-1050.734] -- 0:01:19
48500 -- (-1056.453) (-1055.787) (-1049.546) [-1049.987] * (-1051.937) [-1050.867] (-1049.818) (-1049.808) -- 0:01:18
49000 -- [-1052.120] (-1049.137) (-1050.542) (-1050.057) * (-1051.013) [-1049.084] (-1048.431) (-1050.713) -- 0:01:17
49500 -- [-1052.636] (-1049.428) (-1046.440) (-1049.958) * [-1056.027] (-1048.984) (-1048.481) (-1050.434) -- 0:01:16
50000 -- (-1050.661) (-1049.948) (-1049.385) [-1049.359] * (-1052.771) (-1052.897) [-1048.819] (-1053.533) -- 0:01:16
Average standard deviation of split frequencies: 0.065128
50500 -- (-1050.725) (-1049.558) [-1053.144] (-1050.269) * (-1054.053) (-1053.212) (-1050.194) [-1051.665] -- 0:01:15
51000 -- (-1050.500) [-1050.274] (-1051.420) (-1049.659) * (-1053.472) [-1050.693] (-1050.124) (-1048.447) -- 0:01:14
51500 -- [-1049.472] (-1052.538) (-1050.216) (-1050.784) * (-1050.477) (-1051.148) [-1051.410] (-1050.137) -- 0:01:13
52000 -- (-1050.802) [-1046.196] (-1053.271) (-1051.018) * (-1051.096) (-1050.154) [-1050.706] (-1054.569) -- 0:01:12
52500 -- [-1059.371] (-1053.219) (-1049.791) (-1051.152) * (-1048.861) (-1049.991) [-1051.170] (-1049.447) -- 0:01:12
53000 -- [-1053.937] (-1049.081) (-1049.769) (-1055.533) * (-1051.128) [-1051.068] (-1050.986) (-1055.281) -- 0:01:11
53500 -- (-1053.944) (-1049.949) [-1051.607] (-1056.470) * (-1051.335) [-1051.378] (-1052.722) (-1056.872) -- 0:01:10
54000 -- (-1061.321) (-1049.624) [-1050.107] (-1050.750) * (-1049.304) [-1049.972] (-1055.217) (-1051.091) -- 0:01:10
54500 -- (-1059.785) (-1053.922) [-1053.224] (-1051.509) * (-1048.250) (-1049.182) [-1052.576] (-1048.083) -- 0:01:09
55000 -- [-1054.632] (-1048.149) (-1050.083) (-1051.721) * (-1048.464) (-1050.437) [-1055.139] (-1052.154) -- 0:01:08
Average standard deviation of split frequencies: 0.065099
55500 -- [-1053.440] (-1049.687) (-1049.418) (-1047.997) * (-1049.758) [-1049.606] (-1050.568) (-1050.853) -- 0:01:08
56000 -- (-1058.078) (-1048.393) [-1049.113] (-1051.104) * (-1048.747) [-1050.517] (-1051.156) (-1050.214) -- 0:01:07
56500 -- [-1050.228] (-1050.361) (-1054.469) (-1050.210) * (-1048.699) (-1049.395) (-1051.121) [-1048.722] -- 0:01:06
57000 -- (-1049.960) (-1048.221) (-1049.496) [-1048.779] * (-1049.594) (-1050.303) (-1048.739) [-1049.492] -- 0:01:06
57500 -- (-1053.896) [-1048.593] (-1048.951) (-1050.863) * (-1055.577) (-1050.454) (-1051.246) [-1048.695] -- 0:01:05
58000 -- (-1047.716) [-1050.063] (-1053.848) (-1052.468) * (-1051.472) [-1049.132] (-1050.572) (-1049.324) -- 0:01:04
58500 -- (-1047.629) (-1050.900) [-1046.041] (-1049.200) * (-1052.114) (-1051.406) (-1050.259) [-1049.013] -- 0:01:04
59000 -- (-1056.069) (-1051.695) (-1053.163) [-1050.138] * (-1050.561) (-1048.822) (-1050.689) [-1050.529] -- 0:01:03
59500 -- (-1060.055) (-1050.689) [-1047.609] (-1050.077) * (-1052.029) (-1053.620) (-1048.663) [-1047.621] -- 0:01:03
60000 -- (-1063.300) [-1049.251] (-1049.712) (-1046.752) * [-1050.847] (-1056.633) (-1048.500) (-1050.854) -- 0:01:02
Average standard deviation of split frequencies: 0.062163
60500 -- (-1063.529) (-1049.700) [-1050.056] (-1048.181) * (-1046.107) (-1051.785) [-1050.394] (-1051.268) -- 0:01:02
61000 -- [-1050.139] (-1049.200) (-1049.127) (-1048.005) * (-1048.784) (-1051.493) (-1050.202) [-1048.818] -- 0:01:01
61500 -- (-1057.440) (-1049.431) (-1049.302) [-1047.177] * (-1050.401) (-1050.704) [-1049.332] (-1048.036) -- 0:01:01
62000 -- (-1051.512) (-1049.672) (-1051.211) [-1049.090] * (-1052.705) (-1048.493) [-1053.098] (-1047.396) -- 0:01:00
62500 -- (-1050.931) (-1049.917) [-1051.129] (-1049.013) * (-1051.484) (-1049.468) (-1046.050) [-1048.589] -- 0:01:00
63000 -- (-1056.638) (-1051.805) [-1049.042] (-1051.603) * (-1049.073) [-1048.795] (-1052.458) (-1049.530) -- 0:01:14
63500 -- (-1051.810) (-1050.334) [-1049.113] (-1050.175) * (-1050.023) (-1052.858) (-1048.996) [-1049.606] -- 0:01:13
64000 -- [-1055.167] (-1049.804) (-1050.564) (-1049.707) * (-1048.521) (-1049.504) [-1050.619] (-1051.723) -- 0:01:13
64500 -- [-1050.415] (-1048.716) (-1055.118) (-1049.028) * (-1049.358) [-1051.772] (-1049.478) (-1049.218) -- 0:01:12
65000 -- (-1052.555) (-1049.582) [-1051.797] (-1047.603) * [-1046.253] (-1047.710) (-1050.358) (-1048.329) -- 0:01:11
Average standard deviation of split frequencies: 0.060314
65500 -- (-1057.174) (-1051.443) (-1050.586) [-1050.814] * (-1052.538) (-1049.376) [-1049.240] (-1049.322) -- 0:01:11
66000 -- (-1058.225) (-1050.714) [-1052.642] (-1050.255) * (-1050.820) [-1050.790] (-1048.662) (-1052.075) -- 0:01:10
66500 -- (-1049.807) (-1053.388) (-1049.753) [-1049.348] * (-1049.537) [-1050.868] (-1049.229) (-1051.184) -- 0:01:10
67000 -- (-1058.091) (-1050.496) (-1049.913) [-1050.433] * (-1050.533) [-1048.614] (-1050.968) (-1047.996) -- 0:01:09
67500 -- [-1059.078] (-1051.678) (-1051.619) (-1048.123) * [-1054.078] (-1049.605) (-1049.667) (-1049.439) -- 0:01:09
68000 -- (-1052.976) [-1050.381] (-1051.208) (-1049.528) * (-1050.971) (-1051.453) (-1049.936) [-1049.086] -- 0:01:08
68500 -- (-1048.726) [-1050.161] (-1050.855) (-1051.492) * (-1051.396) (-1053.120) (-1051.666) [-1051.249] -- 0:01:07
69000 -- (-1057.160) (-1048.497) [-1049.642] (-1051.378) * (-1047.942) (-1051.022) (-1051.705) [-1049.765] -- 0:01:07
69500 -- (-1061.095) (-1051.054) [-1050.273] (-1049.989) * [-1049.677] (-1049.767) (-1051.235) (-1051.524) -- 0:01:06
70000 -- [-1050.247] (-1048.781) (-1048.116) (-1050.080) * (-1051.331) (-1051.792) (-1051.854) [-1049.698] -- 0:01:06
Average standard deviation of split frequencies: 0.057229
70500 -- [-1052.699] (-1049.188) (-1049.372) (-1049.768) * (-1050.218) (-1051.035) (-1048.433) [-1049.992] -- 0:01:05
71000 -- [-1057.222] (-1050.437) (-1049.777) (-1051.602) * (-1050.577) (-1048.875) [-1049.308] (-1048.336) -- 0:01:05
71500 -- [-1052.816] (-1052.807) (-1053.773) (-1051.702) * (-1051.700) (-1050.974) [-1049.770] (-1049.891) -- 0:01:04
72000 -- (-1056.370) (-1052.058) [-1052.846] (-1051.438) * (-1051.331) (-1050.625) [-1051.602] (-1048.746) -- 0:01:04
72500 -- [-1050.278] (-1050.894) (-1050.997) (-1055.727) * (-1051.380) [-1049.021] (-1049.873) (-1050.690) -- 0:01:03
73000 -- (-1052.536) (-1051.175) (-1051.046) [-1048.534] * [-1050.014] (-1052.027) (-1052.171) (-1051.890) -- 0:01:03
73500 -- [-1052.618] (-1050.721) (-1049.425) (-1050.536) * (-1049.397) [-1052.891] (-1051.116) (-1046.922) -- 0:01:03
74000 -- (-1053.365) (-1049.764) (-1049.498) [-1050.040] * (-1048.997) (-1048.588) (-1050.498) [-1048.733] -- 0:01:02
74500 -- (-1052.990) (-1048.900) (-1050.409) [-1053.475] * (-1046.537) [-1048.398] (-1050.272) (-1050.151) -- 0:01:02
75000 -- [-1052.120] (-1050.464) (-1051.880) (-1049.464) * (-1050.211) (-1051.771) [-1051.707] (-1049.139) -- 0:01:01
Average standard deviation of split frequencies: 0.052378
75500 -- [-1048.560] (-1049.155) (-1051.868) (-1048.787) * (-1046.802) (-1048.099) (-1047.278) [-1049.190] -- 0:01:01
76000 -- (-1058.690) [-1051.154] (-1050.675) (-1048.838) * [-1048.393] (-1049.614) (-1049.661) (-1050.569) -- 0:01:00
76500 -- (-1056.693) (-1051.113) [-1050.728] (-1049.646) * [-1049.509] (-1050.309) (-1052.709) (-1051.554) -- 0:01:00
77000 -- [-1054.182] (-1049.143) (-1052.222) (-1048.945) * [-1051.260] (-1051.112) (-1051.087) (-1052.224) -- 0:00:59
77500 -- [-1051.995] (-1048.493) (-1050.404) (-1048.084) * (-1047.409) (-1052.989) (-1051.961) [-1052.089] -- 0:00:59
78000 -- (-1051.114) (-1053.374) (-1053.086) [-1048.087] * (-1046.744) [-1050.720] (-1047.713) (-1050.765) -- 0:01:10
78500 -- [-1049.856] (-1051.888) (-1050.427) (-1049.974) * [-1049.059] (-1050.296) (-1052.379) (-1051.604) -- 0:01:10
79000 -- (-1059.933) (-1049.765) [-1055.112] (-1047.422) * [-1047.591] (-1048.975) (-1049.188) (-1050.423) -- 0:01:09
79500 -- (-1061.523) (-1049.799) (-1053.726) [-1052.594] * (-1050.189) [-1049.086] (-1049.523) (-1050.425) -- 0:01:09
80000 -- [-1060.354] (-1050.108) (-1050.615) (-1047.767) * [-1048.724] (-1047.737) (-1048.952) (-1050.752) -- 0:01:09
Average standard deviation of split frequencies: 0.053626
80500 -- [-1054.988] (-1049.580) (-1049.412) (-1049.452) * (-1050.740) (-1049.408) [-1050.491] (-1052.980) -- 0:01:08
81000 -- [-1051.071] (-1053.032) (-1048.320) (-1050.572) * (-1048.088) (-1051.450) (-1049.940) [-1050.707] -- 0:01:08
81500 -- [-1051.684] (-1053.599) (-1054.464) (-1051.965) * (-1049.493) (-1049.519) (-1050.507) [-1047.866] -- 0:01:07
82000 -- [-1047.650] (-1057.527) (-1047.682) (-1056.373) * (-1055.767) (-1050.162) (-1051.803) [-1049.899] -- 0:01:07
82500 -- (-1052.440) (-1052.575) [-1047.616] (-1049.815) * (-1050.330) (-1047.873) [-1050.484] (-1050.433) -- 0:01:06
83000 -- [-1052.640] (-1050.068) (-1048.973) (-1049.858) * (-1047.385) (-1049.310) [-1048.361] (-1050.356) -- 0:01:06
83500 -- (-1055.533) (-1051.309) [-1049.511] (-1054.006) * (-1048.682) [-1049.931] (-1048.368) (-1049.093) -- 0:01:05
84000 -- [-1053.441] (-1050.288) (-1048.554) (-1056.384) * (-1047.566) (-1055.507) [-1050.294] (-1050.272) -- 0:01:05
84500 -- (-1054.898) (-1051.180) (-1049.815) [-1049.200] * (-1050.773) (-1051.012) (-1051.918) [-1050.026] -- 0:01:05
85000 -- (-1060.230) [-1049.306] (-1048.811) (-1050.533) * [-1050.403] (-1051.411) (-1051.551) (-1055.713) -- 0:01:04
Average standard deviation of split frequencies: 0.057411
85500 -- [-1055.941] (-1053.393) (-1050.560) (-1054.867) * (-1051.954) (-1052.141) (-1050.999) [-1050.579] -- 0:01:04
86000 -- (-1054.637) (-1052.785) [-1048.243] (-1049.743) * (-1051.255) [-1052.599] (-1051.926) (-1050.146) -- 0:01:03
86500 -- (-1052.466) [-1050.891] (-1049.069) (-1048.788) * (-1051.203) (-1052.502) (-1048.392) [-1048.058] -- 0:01:03
87000 -- [-1051.251] (-1051.604) (-1050.698) (-1048.503) * (-1049.728) (-1049.544) (-1049.176) [-1048.209] -- 0:01:02
87500 -- [-1055.637] (-1050.059) (-1048.714) (-1050.787) * (-1049.354) [-1047.910] (-1050.170) (-1048.182) -- 0:01:02
88000 -- [-1051.057] (-1051.929) (-1050.613) (-1049.328) * (-1053.769) [-1050.576] (-1047.507) (-1050.692) -- 0:01:02
88500 -- [-1051.634] (-1050.836) (-1049.221) (-1052.621) * (-1049.704) (-1052.491) [-1046.995] (-1053.319) -- 0:01:01
89000 -- [-1056.892] (-1055.444) (-1048.948) (-1048.725) * (-1053.418) (-1049.662) [-1048.643] (-1048.723) -- 0:01:01
89500 -- [-1052.553] (-1051.352) (-1048.955) (-1046.241) * [-1049.203] (-1049.422) (-1048.758) (-1049.435) -- 0:01:01
90000 -- (-1052.672) (-1056.843) [-1049.157] (-1048.240) * (-1048.607) [-1049.228] (-1053.746) (-1049.430) -- 0:01:00
Average standard deviation of split frequencies: 0.057740
90500 -- (-1059.846) [-1052.097] (-1051.055) (-1049.295) * [-1047.967] (-1049.002) (-1052.305) (-1051.162) -- 0:01:00
91000 -- [-1053.264] (-1048.597) (-1050.761) (-1048.910) * (-1050.119) (-1050.524) (-1050.384) [-1050.287] -- 0:00:59
91500 -- (-1053.183) (-1049.079) (-1048.385) [-1049.361] * [-1049.435] (-1049.933) (-1048.304) (-1053.509) -- 0:00:59
92000 -- (-1058.389) (-1048.882) [-1049.481] (-1052.148) * [-1047.632] (-1050.151) (-1054.099) (-1054.569) -- 0:00:59
92500 -- (-1049.912) (-1051.035) (-1049.951) [-1048.857] * (-1050.423) (-1048.936) (-1051.223) [-1050.580] -- 0:00:58
93000 -- [-1053.029] (-1052.184) (-1051.014) (-1048.560) * [-1049.601] (-1048.804) (-1048.220) (-1050.403) -- 0:00:58
93500 -- (-1055.105) (-1051.658) (-1050.912) [-1048.715] * (-1051.642) (-1050.262) [-1051.280] (-1051.146) -- 0:01:07
94000 -- (-1051.229) [-1048.012] (-1048.922) (-1050.443) * [-1049.767] (-1049.194) (-1049.196) (-1051.180) -- 0:01:07
94500 -- (-1061.702) (-1052.740) (-1050.761) [-1056.741] * (-1056.392) [-1047.032] (-1050.908) (-1051.757) -- 0:01:07
95000 -- [-1054.435] (-1049.863) (-1051.509) (-1047.051) * [-1048.786] (-1052.153) (-1048.106) (-1052.155) -- 0:01:06
Average standard deviation of split frequencies: 0.055049
95500 -- [-1048.961] (-1049.056) (-1047.377) (-1051.275) * [-1048.728] (-1048.839) (-1054.898) (-1050.160) -- 0:01:06
96000 -- (-1052.608) (-1049.968) [-1049.609] (-1048.068) * (-1048.595) [-1049.267] (-1055.224) (-1049.140) -- 0:01:05
96500 -- (-1063.490) [-1048.779] (-1053.313) (-1048.242) * (-1047.584) (-1049.665) (-1050.426) [-1050.959] -- 0:01:05
97000 -- (-1059.763) (-1048.757) [-1046.798] (-1050.431) * (-1054.321) [-1048.982] (-1048.200) (-1050.716) -- 0:01:05
97500 -- (-1063.133) (-1051.044) (-1048.318) [-1047.702] * [-1050.494] (-1050.747) (-1050.002) (-1051.279) -- 0:01:04
98000 -- (-1065.376) (-1049.493) (-1048.774) [-1053.445] * [-1051.356] (-1048.055) (-1053.388) (-1050.574) -- 0:01:04
98500 -- (-1050.719) (-1050.080) [-1051.856] (-1049.890) * (-1049.802) [-1048.766] (-1054.743) (-1048.169) -- 0:01:04
99000 -- (-1055.380) [-1050.749] (-1047.415) (-1049.351) * (-1050.268) [-1045.803] (-1050.010) (-1049.801) -- 0:01:03
99500 -- (-1057.123) (-1047.779) (-1049.641) [-1049.580] * (-1050.144) [-1052.025] (-1049.687) (-1051.297) -- 0:01:03
100000 -- (-1050.256) [-1049.008] (-1047.512) (-1051.508) * [-1048.114] (-1050.202) (-1049.804) (-1050.019) -- 0:01:02
Average standard deviation of split frequencies: 0.050525
100500 -- (-1053.644) (-1052.876) [-1049.384] (-1049.185) * [-1048.456] (-1046.937) (-1050.694) (-1051.206) -- 0:01:02
101000 -- [-1050.829] (-1047.420) (-1047.185) (-1051.468) * (-1051.021) (-1048.522) [-1047.651] (-1049.058) -- 0:01:02
101500 -- (-1052.880) [-1051.437] (-1048.536) (-1048.797) * (-1049.529) [-1046.252] (-1049.768) (-1050.249) -- 0:01:01
102000 -- (-1053.271) (-1050.854) (-1049.242) [-1051.281] * (-1050.530) [-1048.147] (-1049.424) (-1051.785) -- 0:01:01
102500 -- (-1051.109) [-1049.570] (-1050.779) (-1048.638) * (-1052.419) [-1048.977] (-1048.911) (-1048.508) -- 0:01:01
103000 -- (-1051.035) (-1049.496) (-1051.020) [-1052.292] * (-1048.737) [-1049.850] (-1049.100) (-1048.684) -- 0:01:00
103500 -- [-1052.673] (-1048.332) (-1051.451) (-1050.659) * [-1049.111] (-1048.481) (-1049.104) (-1048.575) -- 0:01:00
104000 -- [-1052.527] (-1049.411) (-1050.326) (-1050.003) * [-1050.100] (-1049.028) (-1049.707) (-1050.311) -- 0:01:00
104500 -- (-1049.918) (-1051.823) (-1049.624) [-1050.858] * [-1050.607] (-1049.952) (-1050.844) (-1050.410) -- 0:00:59
105000 -- (-1056.823) [-1047.959] (-1050.332) (-1049.973) * (-1048.368) (-1049.135) [-1049.782] (-1048.932) -- 0:00:59
Average standard deviation of split frequencies: 0.048919
105500 -- (-1050.620) [-1049.955] (-1049.720) (-1049.400) * (-1049.947) (-1049.311) (-1048.803) [-1049.079] -- 0:00:59
106000 -- (-1058.721) (-1048.576) (-1051.672) [-1048.504] * [-1049.132] (-1052.251) (-1050.352) (-1048.601) -- 0:00:59
106500 -- (-1060.134) (-1050.405) (-1050.945) [-1049.080] * (-1053.009) [-1049.175] (-1050.795) (-1049.230) -- 0:00:58
107000 -- (-1049.498) (-1051.797) [-1051.215] (-1048.249) * (-1051.088) [-1048.085] (-1050.333) (-1049.364) -- 0:00:58
107500 -- (-1063.963) (-1051.510) [-1048.863] (-1048.994) * (-1048.935) (-1052.571) [-1047.819] (-1049.103) -- 0:00:58
108000 -- (-1049.914) (-1058.540) (-1048.816) [-1048.212] * (-1055.192) [-1050.073] (-1049.594) (-1050.446) -- 0:00:57
108500 -- (-1048.974) (-1050.393) [-1046.994] (-1049.663) * (-1048.872) (-1050.639) [-1048.582] (-1053.230) -- 0:01:05
109000 -- (-1050.532) [-1048.824] (-1048.730) (-1051.423) * (-1049.833) [-1049.906] (-1051.470) (-1052.386) -- 0:01:05
109500 -- [-1050.419] (-1049.490) (-1050.779) (-1055.806) * (-1052.111) [-1055.149] (-1047.808) (-1050.313) -- 0:01:05
110000 -- (-1050.821) (-1051.846) [-1051.131] (-1052.895) * (-1049.577) [-1050.168] (-1050.637) (-1052.566) -- 0:01:04
Average standard deviation of split frequencies: 0.048040
110500 -- (-1050.388) (-1046.196) (-1050.963) [-1049.862] * [-1049.278] (-1051.012) (-1049.275) (-1048.010) -- 0:01:04
111000 -- (-1047.882) (-1051.108) [-1049.918] (-1049.732) * (-1047.490) (-1050.323) [-1054.302] (-1049.494) -- 0:01:04
111500 -- (-1046.876) [-1050.799] (-1049.748) (-1050.806) * (-1051.217) [-1050.074] (-1053.492) (-1047.976) -- 0:01:03
112000 -- (-1052.794) [-1049.408] (-1048.606) (-1051.486) * (-1051.461) (-1051.634) [-1049.516] (-1053.591) -- 0:01:03
112500 -- (-1051.070) [-1048.071] (-1046.559) (-1050.269) * [-1049.845] (-1049.482) (-1050.238) (-1052.793) -- 0:01:03
113000 -- (-1050.521) (-1049.146) (-1047.554) [-1049.187] * [-1050.094] (-1049.906) (-1048.220) (-1051.798) -- 0:01:02
113500 -- (-1050.157) (-1051.713) [-1049.466] (-1050.324) * (-1050.311) (-1050.309) (-1050.267) [-1047.434] -- 0:01:02
114000 -- (-1051.526) [-1049.358] (-1049.836) (-1051.205) * [-1048.749] (-1051.898) (-1048.352) (-1050.853) -- 0:01:02
114500 -- (-1048.333) [-1046.996] (-1050.213) (-1053.490) * (-1049.736) (-1053.375) [-1049.267] (-1048.440) -- 0:01:01
115000 -- [-1047.044] (-1048.477) (-1048.212) (-1056.760) * [-1050.633] (-1049.294) (-1049.411) (-1048.659) -- 0:01:01
Average standard deviation of split frequencies: 0.046413
115500 -- (-1048.692) [-1048.396] (-1049.752) (-1054.225) * (-1049.333) (-1049.466) [-1051.102] (-1048.316) -- 0:01:01
116000 -- (-1050.026) (-1047.981) (-1049.713) [-1048.727] * (-1058.550) (-1053.582) [-1048.985] (-1049.102) -- 0:01:00
116500 -- (-1048.565) (-1051.195) (-1049.105) [-1049.406] * (-1051.473) (-1046.037) [-1047.477] (-1046.458) -- 0:01:00
117000 -- (-1050.222) [-1052.372] (-1050.081) (-1051.434) * (-1050.129) (-1050.515) [-1051.881] (-1048.641) -- 0:01:00
117500 -- [-1046.745] (-1050.523) (-1048.039) (-1049.509) * (-1050.351) (-1050.249) [-1048.504] (-1048.486) -- 0:01:00
118000 -- [-1047.903] (-1051.221) (-1049.567) (-1048.522) * (-1052.347) [-1048.441] (-1050.732) (-1050.047) -- 0:00:59
118500 -- [-1049.966] (-1049.944) (-1049.383) (-1051.103) * (-1052.186) (-1045.336) (-1049.240) [-1050.632] -- 0:00:59
119000 -- [-1046.670] (-1050.479) (-1048.986) (-1050.640) * (-1051.796) [-1048.711] (-1047.717) (-1048.543) -- 0:00:59
119500 -- (-1048.570) (-1051.802) [-1049.266] (-1049.872) * (-1050.737) (-1045.528) (-1046.965) [-1048.692] -- 0:00:58
120000 -- (-1050.194) (-1050.468) (-1048.602) [-1050.508] * (-1055.719) (-1049.241) (-1048.646) [-1048.844] -- 0:00:58
Average standard deviation of split frequencies: 0.044207
120500 -- [-1049.038] (-1049.234) (-1050.125) (-1050.858) * (-1053.828) [-1048.800] (-1051.143) (-1047.699) -- 0:00:58
121000 -- (-1053.595) (-1049.066) (-1052.290) [-1050.204] * (-1053.130) [-1052.033] (-1047.167) (-1051.760) -- 0:00:58
121500 -- (-1048.477) [-1049.174] (-1048.837) (-1053.697) * (-1052.747) (-1051.010) [-1049.703] (-1049.089) -- 0:00:57
122000 -- [-1049.229] (-1052.287) (-1052.569) (-1049.909) * (-1048.624) (-1052.795) (-1050.406) [-1049.846] -- 0:00:57
122500 -- (-1048.591) [-1051.250] (-1052.624) (-1049.976) * (-1055.380) (-1051.350) (-1050.424) [-1053.982] -- 0:00:57
123000 -- [-1046.903] (-1051.128) (-1051.476) (-1050.033) * (-1049.513) (-1052.660) [-1049.922] (-1046.870) -- 0:00:57
123500 -- [-1049.041] (-1053.628) (-1049.316) (-1049.620) * (-1051.240) (-1049.032) (-1052.069) [-1050.587] -- 0:00:56
124000 -- (-1048.340) (-1051.229) [-1052.584] (-1048.014) * (-1049.007) (-1048.524) [-1050.467] (-1049.643) -- 0:01:03
124500 -- (-1049.793) (-1053.994) (-1048.869) [-1050.768] * (-1051.894) (-1050.243) [-1049.824] (-1048.836) -- 0:01:03
125000 -- [-1050.147] (-1053.230) (-1051.389) (-1049.261) * (-1050.139) (-1050.906) (-1051.573) [-1049.350] -- 0:01:03
Average standard deviation of split frequencies: 0.042336
125500 -- (-1049.242) [-1050.055] (-1052.442) (-1055.038) * (-1050.862) (-1050.174) (-1049.652) [-1048.014] -- 0:01:02
126000 -- [-1047.590] (-1049.875) (-1053.244) (-1055.293) * (-1048.277) (-1049.821) (-1048.885) [-1049.398] -- 0:01:02
126500 -- (-1052.846) (-1053.433) [-1048.117] (-1052.428) * (-1048.232) [-1050.432] (-1048.877) (-1052.459) -- 0:01:02
127000 -- (-1050.843) (-1048.878) (-1051.313) [-1049.699] * (-1050.890) [-1050.873] (-1049.004) (-1045.466) -- 0:01:01
127500 -- (-1050.461) [-1051.650] (-1049.048) (-1049.195) * (-1051.461) (-1048.930) [-1050.460] (-1046.812) -- 0:01:01
128000 -- (-1051.091) (-1051.609) (-1049.953) [-1049.265] * (-1049.374) (-1048.321) (-1049.443) [-1050.573] -- 0:01:01
128500 -- [-1051.875] (-1047.898) (-1048.710) (-1050.077) * (-1051.249) [-1049.518] (-1050.895) (-1048.539) -- 0:01:01
129000 -- (-1048.702) (-1049.870) [-1048.235] (-1049.334) * (-1048.838) (-1048.439) (-1053.652) [-1048.955] -- 0:01:00
129500 -- (-1050.472) (-1050.602) [-1047.555] (-1049.419) * (-1047.572) (-1051.975) [-1048.596] (-1052.261) -- 0:01:00
130000 -- (-1050.620) [-1050.601] (-1050.939) (-1048.679) * (-1048.862) (-1053.040) (-1050.037) [-1045.937] -- 0:01:00
Average standard deviation of split frequencies: 0.041014
130500 -- (-1050.573) (-1049.301) [-1047.541] (-1050.188) * (-1050.292) (-1057.748) [-1049.734] (-1047.522) -- 0:00:59
131000 -- (-1048.929) (-1050.906) [-1046.770] (-1050.364) * (-1050.234) (-1048.962) [-1052.428] (-1050.932) -- 0:00:59
131500 -- (-1048.260) [-1051.358] (-1048.571) (-1050.398) * (-1051.839) (-1047.461) (-1053.019) [-1050.683] -- 0:00:59
132000 -- (-1049.930) (-1050.695) [-1049.658] (-1050.656) * (-1049.417) [-1049.062] (-1048.986) (-1050.817) -- 0:00:59
132500 -- [-1049.427] (-1050.017) (-1049.478) (-1048.672) * (-1050.017) (-1050.636) [-1052.374] (-1048.341) -- 0:00:58
133000 -- [-1050.661] (-1049.160) (-1050.223) (-1055.098) * [-1048.962] (-1052.616) (-1052.220) (-1047.334) -- 0:00:58
133500 -- (-1048.065) [-1049.708] (-1048.389) (-1052.747) * (-1050.502) (-1049.477) (-1051.563) [-1047.819] -- 0:00:58
134000 -- (-1049.718) (-1049.712) [-1051.556] (-1055.749) * [-1049.394] (-1052.541) (-1048.282) (-1048.925) -- 0:00:58
134500 -- (-1049.113) (-1051.324) (-1050.097) [-1049.696] * (-1051.173) [-1049.433] (-1052.336) (-1051.517) -- 0:00:57
135000 -- (-1050.321) (-1049.598) (-1049.821) [-1050.367] * (-1049.252) [-1049.197] (-1049.852) (-1047.087) -- 0:00:57
Average standard deviation of split frequencies: 0.037924
135500 -- [-1049.116] (-1050.377) (-1049.064) (-1049.055) * (-1050.154) [-1051.827] (-1048.330) (-1047.904) -- 0:00:57
136000 -- (-1048.435) [-1050.706] (-1049.589) (-1051.912) * (-1049.400) (-1050.461) [-1050.322] (-1049.565) -- 0:00:57
136500 -- (-1049.982) (-1051.138) (-1050.652) [-1048.527] * (-1051.736) (-1050.312) (-1049.937) [-1052.075] -- 0:00:56
137000 -- [-1049.656] (-1049.777) (-1051.426) (-1049.674) * [-1051.183] (-1051.804) (-1052.783) (-1052.014) -- 0:00:56
137500 -- [-1048.455] (-1051.236) (-1050.518) (-1051.633) * (-1050.336) (-1049.239) (-1052.859) [-1046.700] -- 0:00:56
138000 -- [-1048.428] (-1050.304) (-1051.212) (-1050.614) * (-1050.974) (-1048.484) (-1049.315) [-1049.883] -- 0:00:56
138500 -- (-1051.372) (-1052.325) (-1051.656) [-1049.254] * (-1053.072) (-1050.282) [-1049.087] (-1050.135) -- 0:00:55
139000 -- (-1050.139) (-1048.411) [-1050.507] (-1052.819) * (-1054.341) (-1049.047) (-1049.145) [-1048.335] -- 0:01:01
139500 -- (-1049.521) (-1049.476) [-1050.686] (-1050.886) * [-1048.144] (-1049.616) (-1052.312) (-1049.041) -- 0:01:01
140000 -- (-1050.606) (-1049.308) (-1053.106) [-1049.536] * (-1050.888) (-1048.319) (-1050.684) [-1049.644] -- 0:01:01
Average standard deviation of split frequencies: 0.034695
140500 -- [-1049.480] (-1049.241) (-1055.387) (-1050.263) * [-1049.201] (-1048.437) (-1050.610) (-1049.155) -- 0:01:01
141000 -- (-1050.358) (-1047.028) [-1048.705] (-1049.681) * (-1052.350) [-1048.743] (-1048.484) (-1049.845) -- 0:01:00
141500 -- (-1048.662) (-1048.862) [-1049.091] (-1051.741) * (-1051.899) (-1049.442) [-1047.998] (-1049.661) -- 0:01:00
142000 -- [-1048.264] (-1049.408) (-1050.515) (-1053.864) * (-1050.966) (-1050.743) [-1049.483] (-1047.486) -- 0:01:00
142500 -- (-1049.418) [-1048.640] (-1048.369) (-1050.006) * (-1048.476) [-1048.644] (-1048.011) (-1050.975) -- 0:01:00
143000 -- (-1048.525) (-1051.919) [-1048.489] (-1049.544) * (-1048.929) (-1049.101) [-1053.960] (-1050.424) -- 0:00:59
143500 -- [-1049.995] (-1052.287) (-1049.803) (-1048.943) * (-1049.166) (-1049.612) [-1051.640] (-1049.243) -- 0:00:59
144000 -- [-1050.629] (-1050.632) (-1049.564) (-1051.755) * (-1047.463) (-1050.330) (-1050.067) [-1046.108] -- 0:00:59
144500 -- (-1049.780) [-1048.621] (-1050.620) (-1053.609) * (-1049.199) (-1049.643) (-1051.826) [-1048.290] -- 0:00:59
145000 -- (-1055.424) (-1051.401) (-1049.798) [-1053.052] * [-1048.937] (-1046.133) (-1049.938) (-1059.202) -- 0:00:58
Average standard deviation of split frequencies: 0.031528
145500 -- (-1056.486) (-1050.202) [-1052.781] (-1050.151) * (-1049.459) [-1051.371] (-1048.503) (-1053.202) -- 0:00:58
146000 -- (-1049.725) [-1047.912] (-1052.105) (-1050.295) * (-1048.680) (-1048.495) (-1048.061) [-1052.367] -- 0:00:58
146500 -- (-1048.379) (-1049.390) (-1050.573) [-1048.611] * [-1052.535] (-1049.966) (-1049.790) (-1048.794) -- 0:00:58
147000 -- (-1048.888) (-1051.047) (-1049.341) [-1048.437] * (-1048.800) [-1048.739] (-1048.790) (-1051.676) -- 0:00:58
147500 -- [-1050.846] (-1048.988) (-1050.772) (-1049.420) * (-1049.254) (-1048.293) (-1049.248) [-1051.330] -- 0:00:57
148000 -- (-1051.483) (-1049.290) [-1049.129] (-1057.489) * [-1048.636] (-1054.274) (-1051.228) (-1049.545) -- 0:00:57
148500 -- (-1052.171) (-1049.733) [-1047.338] (-1048.796) * (-1047.307) (-1051.854) [-1050.967] (-1052.921) -- 0:00:57
149000 -- (-1048.789) (-1051.905) [-1047.097] (-1048.857) * (-1049.558) (-1049.087) (-1048.333) [-1048.769] -- 0:00:57
149500 -- (-1048.456) [-1048.570] (-1047.939) (-1049.053) * (-1046.992) [-1050.208] (-1049.102) (-1050.350) -- 0:00:56
150000 -- (-1053.153) (-1049.855) (-1048.423) [-1047.960] * [-1052.643] (-1049.628) (-1051.798) (-1047.791) -- 0:00:56
Average standard deviation of split frequencies: 0.031114
150500 -- (-1048.750) (-1050.234) (-1047.071) [-1051.084] * (-1046.568) (-1048.988) [-1048.778] (-1047.027) -- 0:00:56
151000 -- [-1048.256] (-1047.117) (-1047.121) (-1050.886) * [-1049.273] (-1049.533) (-1049.949) (-1048.742) -- 0:00:56
151500 -- (-1052.687) [-1048.020] (-1048.475) (-1049.516) * [-1049.152] (-1050.993) (-1047.056) (-1049.222) -- 0:00:56
152000 -- [-1049.434] (-1049.529) (-1050.573) (-1049.333) * (-1048.659) (-1049.241) [-1050.012] (-1049.047) -- 0:00:55
152500 -- (-1048.466) (-1047.615) [-1048.894] (-1050.881) * (-1048.757) [-1048.545] (-1052.570) (-1049.568) -- 0:00:55
153000 -- (-1055.494) (-1050.531) (-1050.736) [-1051.988] * (-1050.985) [-1048.722] (-1051.675) (-1049.842) -- 0:00:55
153500 -- (-1052.298) [-1049.800] (-1051.171) (-1051.656) * [-1048.297] (-1051.123) (-1050.591) (-1048.845) -- 0:00:55
154000 -- (-1051.057) (-1050.951) (-1047.783) [-1049.444] * (-1049.941) [-1049.283] (-1045.714) (-1047.717) -- 0:00:54
154500 -- [-1048.814] (-1052.742) (-1050.312) (-1051.843) * (-1053.231) (-1051.002) (-1048.321) [-1048.324] -- 0:01:00
155000 -- (-1048.917) (-1050.867) [-1049.577] (-1051.762) * (-1049.824) (-1047.450) [-1054.003] (-1049.550) -- 0:00:59
Average standard deviation of split frequencies: 0.031226
155500 -- (-1047.599) (-1054.358) (-1054.146) [-1057.913] * (-1049.058) (-1048.860) [-1051.733] (-1050.590) -- 0:00:59
156000 -- (-1048.960) [-1046.782] (-1048.869) (-1056.722) * (-1048.288) [-1051.902] (-1047.314) (-1050.942) -- 0:00:59
156500 -- [-1049.257] (-1048.617) (-1053.126) (-1055.322) * (-1048.206) (-1048.853) [-1050.886] (-1053.369) -- 0:00:59
157000 -- (-1050.015) (-1053.830) (-1049.733) [-1054.439] * (-1051.984) (-1046.410) [-1049.849] (-1058.598) -- 0:00:59
157500 -- (-1050.856) (-1053.872) [-1050.624] (-1053.565) * (-1052.435) [-1050.568] (-1052.518) (-1050.887) -- 0:00:58
158000 -- (-1048.468) (-1050.119) [-1050.749] (-1050.084) * (-1052.534) (-1051.118) (-1046.827) [-1050.756] -- 0:00:58
158500 -- (-1049.985) [-1049.104] (-1049.396) (-1048.186) * (-1046.893) (-1049.826) [-1047.544] (-1049.406) -- 0:00:58
159000 -- [-1049.516] (-1049.465) (-1050.317) (-1052.611) * (-1047.761) [-1047.141] (-1048.427) (-1049.326) -- 0:00:58
159500 -- [-1047.716] (-1050.316) (-1051.223) (-1053.439) * (-1046.900) (-1054.039) (-1048.211) [-1047.652] -- 0:00:57
160000 -- [-1049.788] (-1050.381) (-1050.695) (-1051.859) * (-1049.893) (-1058.347) (-1048.167) [-1048.910] -- 0:00:57
Average standard deviation of split frequencies: 0.032112
160500 -- [-1050.096] (-1049.781) (-1049.957) (-1050.220) * [-1050.450] (-1057.674) (-1051.525) (-1050.137) -- 0:00:57
161000 -- (-1049.804) (-1050.096) [-1050.761] (-1050.091) * [-1050.122] (-1056.882) (-1049.782) (-1049.669) -- 0:00:57
161500 -- (-1050.278) (-1047.274) (-1053.744) [-1049.762] * (-1048.761) [-1047.923] (-1049.121) (-1051.461) -- 0:00:57
162000 -- (-1048.843) (-1050.084) [-1050.361] (-1053.281) * [-1049.066] (-1048.915) (-1051.259) (-1050.955) -- 0:00:56
162500 -- (-1051.536) (-1049.959) [-1048.515] (-1052.798) * [-1046.552] (-1048.985) (-1050.405) (-1052.063) -- 0:00:56
163000 -- (-1048.993) (-1051.088) (-1050.672) [-1052.851] * [-1047.903] (-1047.519) (-1049.519) (-1050.203) -- 0:00:56
163500 -- (-1054.598) [-1049.130] (-1050.212) (-1052.103) * [-1046.835] (-1052.185) (-1051.627) (-1048.555) -- 0:00:56
164000 -- (-1050.268) (-1050.309) [-1048.737] (-1050.081) * [-1048.122] (-1051.731) (-1059.862) (-1049.290) -- 0:00:56
164500 -- (-1049.379) (-1050.619) (-1049.372) [-1048.148] * (-1047.854) (-1049.027) (-1053.560) [-1049.330] -- 0:00:55
165000 -- (-1055.425) (-1050.256) (-1048.410) [-1053.864] * [-1047.934] (-1050.462) (-1053.092) (-1050.764) -- 0:00:55
Average standard deviation of split frequencies: 0.032184
165500 -- (-1051.121) (-1052.795) [-1049.262] (-1050.455) * (-1049.793) (-1055.166) (-1055.120) [-1053.070] -- 0:00:55
166000 -- (-1049.622) (-1053.480) [-1053.184] (-1053.983) * [-1049.410] (-1050.127) (-1049.223) (-1051.373) -- 0:00:55
166500 -- [-1049.628] (-1050.800) (-1053.301) (-1046.854) * (-1052.868) (-1051.215) [-1049.298] (-1052.201) -- 0:00:55
167000 -- (-1050.441) (-1050.743) (-1055.942) [-1048.124] * [-1049.085] (-1053.063) (-1052.010) (-1050.165) -- 0:00:54
167500 -- (-1047.921) (-1053.281) [-1055.250] (-1051.356) * (-1051.143) (-1050.651) [-1048.400] (-1050.151) -- 0:00:54
168000 -- (-1051.323) [-1048.585] (-1052.701) (-1051.284) * (-1053.477) (-1052.815) [-1049.786] (-1049.662) -- 0:00:54
168500 -- [-1048.727] (-1050.119) (-1051.950) (-1050.709) * [-1047.693] (-1053.574) (-1049.153) (-1048.947) -- 0:00:54
169000 -- (-1049.285) [-1048.600] (-1050.612) (-1048.417) * [-1050.543] (-1051.893) (-1049.696) (-1051.916) -- 0:00:54
169500 -- (-1048.690) [-1048.034] (-1052.565) (-1051.256) * (-1051.289) (-1052.539) (-1048.834) [-1048.882] -- 0:00:58
170000 -- [-1049.985] (-1048.001) (-1049.501) (-1051.483) * (-1050.323) (-1049.363) (-1048.206) [-1049.977] -- 0:00:58
Average standard deviation of split frequencies: 0.030690
170500 -- [-1049.232] (-1052.723) (-1052.158) (-1049.504) * (-1052.284) [-1051.305] (-1051.060) (-1050.897) -- 0:00:58
171000 -- (-1047.752) [-1052.435] (-1050.518) (-1051.246) * (-1050.979) (-1049.240) [-1048.529] (-1049.425) -- 0:00:58
171500 -- (-1049.509) (-1049.940) [-1049.213] (-1052.426) * [-1047.656] (-1048.994) (-1048.246) (-1050.264) -- 0:00:57
172000 -- [-1049.278] (-1050.381) (-1053.364) (-1048.772) * (-1048.566) (-1049.259) [-1051.282] (-1051.520) -- 0:00:57
172500 -- [-1051.688] (-1050.427) (-1049.385) (-1050.309) * (-1049.443) (-1048.254) [-1049.946] (-1050.150) -- 0:00:57
173000 -- (-1051.176) (-1050.535) [-1048.774] (-1051.616) * (-1055.209) (-1049.808) [-1048.729] (-1050.578) -- 0:00:57
173500 -- (-1053.230) (-1049.509) [-1048.483] (-1053.158) * (-1052.706) [-1053.105] (-1047.814) (-1055.527) -- 0:00:57
174000 -- (-1052.510) [-1048.684] (-1048.680) (-1051.556) * (-1049.048) (-1049.551) [-1050.577] (-1051.387) -- 0:00:56
174500 -- (-1049.825) [-1049.083] (-1049.981) (-1056.068) * (-1052.915) (-1049.152) [-1048.773] (-1053.374) -- 0:00:56
175000 -- (-1049.420) (-1051.518) (-1051.512) [-1047.625] * (-1050.885) [-1049.259] (-1048.849) (-1049.955) -- 0:00:56
Average standard deviation of split frequencies: 0.027082
175500 -- (-1048.926) (-1047.365) [-1050.616] (-1050.985) * (-1050.606) [-1049.456] (-1052.832) (-1050.712) -- 0:00:56
176000 -- (-1050.446) (-1049.255) (-1050.687) [-1054.869] * (-1048.316) [-1050.040] (-1051.614) (-1049.925) -- 0:00:56
176500 -- [-1049.175] (-1051.063) (-1050.029) (-1049.003) * (-1049.817) (-1050.276) (-1048.504) [-1051.024] -- 0:00:55
177000 -- [-1048.465] (-1053.335) (-1050.269) (-1047.957) * (-1051.142) [-1050.397] (-1047.913) (-1051.020) -- 0:00:55
177500 -- (-1049.223) [-1052.498] (-1048.313) (-1049.122) * [-1052.422] (-1051.613) (-1049.767) (-1049.278) -- 0:00:55
178000 -- (-1047.640) (-1049.342) (-1049.211) [-1048.784] * (-1050.383) [-1048.583] (-1053.222) (-1051.204) -- 0:00:55
178500 -- (-1050.335) (-1047.888) [-1050.466] (-1048.512) * (-1053.165) (-1051.143) (-1049.303) [-1048.395] -- 0:00:55
179000 -- (-1049.985) (-1047.872) [-1050.363] (-1044.840) * [-1052.446] (-1050.180) (-1052.406) (-1048.943) -- 0:00:55
179500 -- (-1049.918) (-1053.326) (-1048.664) [-1051.549] * (-1052.700) (-1049.280) [-1049.094] (-1049.557) -- 0:00:54
180000 -- (-1050.259) (-1050.074) [-1049.968] (-1047.934) * (-1051.318) (-1052.132) (-1049.939) [-1051.488] -- 0:00:54
Average standard deviation of split frequencies: 0.028992
180500 -- [-1050.397] (-1047.335) (-1049.695) (-1049.170) * (-1050.596) (-1047.309) [-1048.907] (-1049.133) -- 0:00:54
181000 -- (-1048.823) (-1049.553) (-1051.379) [-1049.334] * [-1052.724] (-1056.887) (-1049.692) (-1048.455) -- 0:00:54
181500 -- (-1049.804) (-1048.931) [-1050.592] (-1049.503) * (-1052.012) [-1050.101] (-1048.907) (-1049.309) -- 0:00:54
182000 -- (-1056.170) [-1049.387] (-1049.601) (-1050.942) * (-1050.020) (-1053.838) (-1052.209) [-1053.665] -- 0:00:53
182500 -- (-1056.318) [-1050.637] (-1052.579) (-1048.872) * (-1048.552) (-1051.370) (-1052.222) [-1052.738] -- 0:00:53
183000 -- (-1053.609) (-1049.554) [-1050.572] (-1048.048) * (-1051.121) [-1051.159] (-1053.049) (-1052.711) -- 0:00:53
183500 -- (-1051.494) (-1049.520) (-1048.813) [-1054.547] * (-1046.627) (-1048.190) [-1049.075] (-1052.708) -- 0:00:53
184000 -- (-1051.228) (-1048.825) (-1052.267) [-1053.134] * (-1048.882) (-1050.052) (-1051.363) [-1051.464] -- 0:00:53
184500 -- (-1053.865) (-1052.144) (-1056.079) [-1049.042] * (-1049.504) [-1049.746] (-1051.258) (-1049.979) -- 0:00:57
185000 -- (-1052.285) (-1054.167) [-1051.003] (-1048.382) * (-1050.557) [-1051.770] (-1050.473) (-1049.728) -- 0:00:57
Average standard deviation of split frequencies: 0.028160
185500 -- (-1053.550) (-1051.860) [-1051.425] (-1049.553) * (-1050.591) (-1050.424) (-1048.889) [-1049.876] -- 0:00:57
186000 -- (-1048.559) [-1049.205] (-1051.969) (-1051.332) * (-1052.457) (-1050.614) (-1052.003) [-1050.402] -- 0:00:56
186500 -- [-1049.382] (-1049.418) (-1050.001) (-1051.569) * (-1050.665) (-1049.147) [-1050.412] (-1051.919) -- 0:00:56
187000 -- (-1051.285) (-1048.979) (-1050.913) [-1049.090] * (-1048.580) (-1048.964) (-1050.766) [-1050.959] -- 0:00:56
187500 -- (-1048.344) [-1050.054] (-1051.073) (-1047.899) * (-1049.129) (-1048.822) [-1049.398] (-1053.975) -- 0:00:56
188000 -- [-1052.339] (-1052.137) (-1054.063) (-1049.096) * (-1052.929) (-1049.976) (-1048.396) [-1056.101] -- 0:00:56
188500 -- (-1051.096) (-1049.528) (-1049.658) [-1051.084] * (-1051.301) (-1049.755) [-1049.230] (-1049.740) -- 0:00:55
189000 -- (-1050.399) (-1048.883) (-1049.454) [-1052.001] * (-1051.178) [-1048.950] (-1050.510) (-1049.768) -- 0:00:55
189500 -- (-1047.642) (-1048.779) (-1055.434) [-1050.999] * (-1049.470) [-1051.193] (-1050.162) (-1050.947) -- 0:00:55
190000 -- (-1047.914) (-1049.390) (-1051.205) [-1051.354] * (-1048.802) (-1049.668) [-1049.907] (-1051.607) -- 0:00:55
Average standard deviation of split frequencies: 0.024999
190500 -- (-1051.664) (-1055.695) (-1048.230) [-1052.930] * [-1050.227] (-1048.644) (-1049.644) (-1047.605) -- 0:00:55
191000 -- (-1049.843) (-1053.829) [-1046.914] (-1048.658) * [-1051.916] (-1052.174) (-1049.227) (-1048.771) -- 0:00:55
191500 -- [-1050.001] (-1051.603) (-1048.169) (-1049.048) * (-1052.569) (-1048.488) (-1048.500) [-1049.441] -- 0:00:54
192000 -- (-1051.195) (-1049.805) (-1050.931) [-1049.713] * (-1050.500) [-1050.302] (-1050.578) (-1048.837) -- 0:00:54
192500 -- (-1052.402) (-1049.657) [-1052.466] (-1051.063) * (-1053.026) [-1053.631] (-1050.091) (-1050.895) -- 0:00:54
193000 -- [-1049.771] (-1049.078) (-1049.347) (-1048.675) * (-1048.875) (-1051.110) (-1054.032) [-1047.577] -- 0:00:54
193500 -- (-1052.835) [-1051.302] (-1049.902) (-1049.120) * (-1050.861) (-1050.454) (-1050.185) [-1048.462] -- 0:00:54
194000 -- [-1048.416] (-1049.136) (-1050.425) (-1047.644) * [-1049.785] (-1049.823) (-1051.607) (-1052.398) -- 0:00:54
194500 -- [-1047.867] (-1050.063) (-1049.373) (-1050.799) * (-1050.012) (-1049.844) (-1051.832) [-1050.603] -- 0:00:53
195000 -- (-1049.194) [-1050.006] (-1049.007) (-1049.175) * [-1049.076] (-1050.414) (-1048.546) (-1050.392) -- 0:00:53
Average standard deviation of split frequencies: 0.025042
195500 -- [-1047.669] (-1054.839) (-1050.312) (-1049.126) * [-1052.688] (-1049.231) (-1051.850) (-1049.650) -- 0:00:53
196000 -- (-1049.249) (-1052.567) (-1048.403) [-1050.529] * (-1051.451) (-1050.174) [-1050.453] (-1053.374) -- 0:00:53
196500 -- [-1047.306] (-1051.852) (-1051.887) (-1048.358) * (-1050.784) (-1050.723) (-1049.362) [-1048.630] -- 0:00:53
197000 -- (-1049.096) [-1049.691] (-1046.781) (-1050.750) * [-1051.886] (-1048.708) (-1048.681) (-1050.248) -- 0:00:52
197500 -- (-1048.740) (-1052.887) [-1047.314] (-1051.934) * (-1051.738) (-1050.382) [-1048.153] (-1049.839) -- 0:00:52
198000 -- (-1054.358) [-1051.252] (-1048.651) (-1051.354) * [-1050.227] (-1049.406) (-1048.389) (-1048.808) -- 0:00:52
198500 -- [-1046.721] (-1050.365) (-1048.060) (-1048.743) * (-1050.057) (-1049.585) (-1049.023) [-1048.267] -- 0:00:52
199000 -- (-1053.312) (-1051.152) (-1050.788) [-1049.351] * (-1047.427) (-1050.035) [-1050.516] (-1049.185) -- 0:00:52
199500 -- [-1049.030] (-1049.985) (-1048.309) (-1050.467) * [-1048.504] (-1050.019) (-1050.527) (-1048.897) -- 0:00:56
200000 -- (-1050.218) [-1049.374] (-1048.810) (-1047.563) * (-1049.373) (-1050.630) (-1050.036) [-1048.331] -- 0:00:55
Average standard deviation of split frequencies: 0.022056
200500 -- (-1049.158) [-1048.325] (-1053.900) (-1049.599) * (-1048.839) [-1052.923] (-1045.047) (-1050.915) -- 0:00:55
201000 -- (-1054.717) (-1048.036) [-1048.222] (-1051.545) * (-1048.600) [-1049.524] (-1048.398) (-1050.323) -- 0:00:55
201500 -- [-1049.103] (-1051.127) (-1055.665) (-1052.661) * (-1050.974) [-1048.620] (-1049.334) (-1050.291) -- 0:00:55
202000 -- [-1049.751] (-1051.171) (-1056.965) (-1048.617) * [-1049.514] (-1053.955) (-1046.166) (-1050.715) -- 0:00:55
202500 -- (-1049.058) [-1051.629] (-1047.976) (-1048.428) * (-1052.380) [-1049.117] (-1049.885) (-1052.098) -- 0:00:55
203000 -- (-1049.356) [-1049.032] (-1049.900) (-1051.511) * (-1049.609) [-1049.523] (-1048.486) (-1052.839) -- 0:00:54
203500 -- (-1050.008) (-1051.847) [-1051.325] (-1053.307) * (-1050.325) (-1048.802) [-1048.050] (-1051.769) -- 0:00:54
204000 -- (-1048.260) (-1055.364) (-1050.525) [-1053.353] * [-1051.889] (-1047.307) (-1049.516) (-1049.253) -- 0:00:54
204500 -- (-1051.800) [-1051.198] (-1049.872) (-1049.772) * (-1049.695) (-1048.892) [-1049.293] (-1050.253) -- 0:00:54
205000 -- [-1047.125] (-1049.778) (-1050.982) (-1050.543) * (-1049.425) (-1050.177) (-1052.955) [-1049.638] -- 0:00:54
Average standard deviation of split frequencies: 0.020114
205500 -- (-1055.208) [-1050.176] (-1048.882) (-1050.159) * (-1050.479) (-1054.259) [-1051.463] (-1049.144) -- 0:00:54
206000 -- (-1052.174) [-1050.484] (-1049.092) (-1050.351) * (-1048.921) [-1049.039] (-1050.613) (-1049.278) -- 0:00:53
206500 -- (-1047.605) [-1050.013] (-1049.033) (-1050.547) * (-1053.113) (-1051.256) (-1047.855) [-1049.230] -- 0:00:53
207000 -- (-1049.356) [-1049.171] (-1051.733) (-1048.663) * (-1047.466) (-1049.031) (-1048.787) [-1048.884] -- 0:00:53
207500 -- [-1049.924] (-1048.110) (-1051.078) (-1049.946) * (-1049.344) (-1050.343) (-1053.075) [-1050.793] -- 0:00:53
208000 -- [-1048.819] (-1054.413) (-1049.448) (-1051.049) * [-1050.556] (-1046.544) (-1048.986) (-1050.587) -- 0:00:53
208500 -- (-1050.788) [-1050.527] (-1050.154) (-1049.318) * (-1051.294) [-1049.685] (-1050.415) (-1049.547) -- 0:00:53
209000 -- (-1052.229) (-1051.432) [-1050.217] (-1049.686) * (-1049.337) [-1049.291] (-1050.160) (-1051.934) -- 0:00:52
209500 -- (-1049.940) (-1051.535) [-1052.051] (-1053.008) * (-1050.594) [-1052.480] (-1049.170) (-1050.443) -- 0:00:52
210000 -- (-1051.281) (-1048.676) (-1049.333) [-1051.522] * [-1049.995] (-1049.720) (-1051.976) (-1048.528) -- 0:00:52
Average standard deviation of split frequencies: 0.020728
210500 -- (-1048.243) (-1050.825) [-1049.164] (-1049.018) * (-1051.193) [-1049.792] (-1049.072) (-1048.829) -- 0:00:52
211000 -- (-1047.843) (-1050.553) (-1048.744) [-1051.992] * (-1056.096) [-1050.783] (-1048.020) (-1052.405) -- 0:00:52
211500 -- (-1048.851) (-1052.816) (-1049.062) [-1049.736] * (-1050.796) (-1051.976) [-1049.276] (-1052.522) -- 0:00:52
212000 -- [-1048.394] (-1054.353) (-1052.366) (-1052.368) * (-1051.920) [-1048.269] (-1050.051) (-1050.057) -- 0:00:52
212500 -- (-1050.637) (-1049.670) (-1049.749) [-1053.220] * (-1052.758) (-1049.452) [-1050.114] (-1053.476) -- 0:00:51
213000 -- [-1048.729] (-1049.853) (-1049.755) (-1049.735) * (-1052.512) (-1048.809) [-1052.615] (-1049.659) -- 0:00:51
213500 -- [-1048.805] (-1050.905) (-1051.700) (-1052.390) * (-1051.713) (-1049.540) [-1049.223] (-1052.284) -- 0:00:51
214000 -- (-1049.307) (-1052.878) (-1053.321) [-1049.321] * (-1050.802) [-1051.143] (-1046.792) (-1052.194) -- 0:00:51
214500 -- [-1049.675] (-1050.766) (-1054.072) (-1047.335) * (-1047.465) (-1048.984) [-1046.122] (-1050.537) -- 0:00:51
215000 -- [-1049.487] (-1050.311) (-1049.321) (-1046.572) * (-1046.612) [-1049.862] (-1050.029) (-1049.131) -- 0:00:54
Average standard deviation of split frequencies: 0.021595
215500 -- (-1049.494) [-1048.269] (-1049.313) (-1049.042) * (-1050.706) (-1049.707) [-1051.046] (-1049.587) -- 0:00:54
216000 -- (-1048.328) [-1049.509] (-1048.854) (-1045.916) * [-1050.168] (-1050.779) (-1051.315) (-1050.933) -- 0:00:54
216500 -- (-1048.321) (-1051.882) [-1049.626] (-1050.433) * [-1049.543] (-1048.309) (-1049.844) (-1049.492) -- 0:00:54
217000 -- [-1048.669] (-1050.225) (-1049.291) (-1048.269) * [-1052.733] (-1048.734) (-1051.124) (-1050.263) -- 0:00:54
217500 -- (-1048.740) (-1050.573) [-1048.673] (-1054.184) * (-1053.622) [-1050.097] (-1051.019) (-1051.116) -- 0:00:53
218000 -- (-1050.547) (-1048.949) (-1049.789) [-1046.563] * (-1050.004) (-1048.808) (-1051.037) [-1049.840] -- 0:00:53
218500 -- (-1048.408) [-1051.134] (-1051.903) (-1052.978) * (-1053.714) [-1048.663] (-1050.654) (-1052.019) -- 0:00:53
219000 -- (-1049.873) (-1048.120) (-1048.842) [-1049.770] * (-1048.678) [-1049.380] (-1053.601) (-1050.406) -- 0:00:53
219500 -- (-1050.552) (-1050.560) (-1051.266) [-1048.129] * [-1048.008] (-1052.161) (-1048.761) (-1049.877) -- 0:00:53
220000 -- [-1048.464] (-1048.634) (-1050.679) (-1047.245) * [-1049.331] (-1050.206) (-1050.227) (-1050.118) -- 0:00:53
Average standard deviation of split frequencies: 0.021925
220500 -- [-1051.611] (-1052.452) (-1049.374) (-1048.007) * (-1049.441) (-1053.464) [-1054.236] (-1050.951) -- 0:00:53
221000 -- (-1051.046) (-1051.202) (-1052.470) [-1048.445] * [-1049.325] (-1048.738) (-1052.805) (-1055.411) -- 0:00:52
221500 -- [-1051.096] (-1047.665) (-1050.708) (-1047.880) * (-1048.482) (-1049.626) [-1050.166] (-1050.664) -- 0:00:52
222000 -- (-1050.588) [-1048.614] (-1050.316) (-1052.623) * (-1052.134) [-1050.292] (-1051.072) (-1049.697) -- 0:00:52
222500 -- (-1048.521) (-1049.009) (-1050.658) [-1049.500] * (-1050.617) (-1050.096) [-1051.525] (-1048.522) -- 0:00:52
223000 -- [-1048.559] (-1049.337) (-1051.591) (-1053.351) * (-1047.529) [-1046.754] (-1050.880) (-1050.459) -- 0:00:52
223500 -- (-1052.308) (-1048.687) (-1047.923) [-1048.310] * [-1048.787] (-1049.933) (-1051.310) (-1052.439) -- 0:00:52
224000 -- (-1053.428) [-1049.986] (-1049.585) (-1048.772) * [-1050.957] (-1050.023) (-1049.021) (-1052.918) -- 0:00:51
224500 -- [-1049.389] (-1051.702) (-1049.190) (-1048.823) * [-1048.423] (-1047.754) (-1052.825) (-1053.215) -- 0:00:51
225000 -- (-1049.503) (-1054.777) (-1048.370) [-1049.007] * (-1050.728) (-1049.274) (-1052.308) [-1046.457] -- 0:00:51
Average standard deviation of split frequencies: 0.020529
225500 -- (-1047.475) [-1054.056] (-1049.330) (-1049.081) * (-1053.995) [-1046.807] (-1050.742) (-1048.558) -- 0:00:51
226000 -- (-1050.649) [-1047.508] (-1049.716) (-1047.330) * (-1048.760) (-1049.889) [-1048.927] (-1052.741) -- 0:00:51
226500 -- (-1049.294) (-1050.356) (-1050.444) [-1049.993] * (-1051.358) [-1048.838] (-1049.805) (-1051.280) -- 0:00:51
227000 -- (-1048.286) [-1053.684] (-1048.503) (-1048.054) * [-1045.959] (-1051.556) (-1051.856) (-1051.759) -- 0:00:51
227500 -- (-1049.638) (-1052.085) (-1049.637) [-1048.350] * [-1050.175] (-1049.580) (-1053.753) (-1051.444) -- 0:00:50
228000 -- (-1051.343) (-1051.298) (-1049.372) [-1053.125] * (-1049.939) (-1049.976) (-1050.361) [-1048.828] -- 0:00:50
228500 -- [-1053.460] (-1053.743) (-1049.004) (-1047.417) * (-1049.672) (-1049.738) [-1052.051] (-1048.864) -- 0:00:50
229000 -- (-1052.292) (-1053.846) (-1049.180) [-1046.791] * (-1050.324) (-1050.325) (-1051.757) [-1050.043] -- 0:00:50
229500 -- (-1048.176) [-1050.266] (-1049.102) (-1048.310) * (-1054.563) [-1048.492] (-1050.744) (-1049.122) -- 0:00:50
230000 -- (-1051.980) (-1050.887) (-1050.845) [-1049.548] * (-1051.170) (-1051.406) [-1051.055] (-1049.232) -- 0:00:53
Average standard deviation of split frequencies: 0.019899
230500 -- (-1049.565) [-1050.150] (-1050.619) (-1050.305) * (-1051.219) [-1047.219] (-1049.670) (-1048.395) -- 0:00:53
231000 -- (-1049.347) (-1053.746) [-1049.210] (-1049.461) * [-1050.294] (-1048.802) (-1048.025) (-1048.474) -- 0:00:53
231500 -- (-1049.481) (-1051.483) (-1047.075) [-1048.349] * (-1052.185) (-1057.163) (-1047.648) [-1048.828] -- 0:00:53
232000 -- (-1045.595) (-1051.398) [-1049.573] (-1051.133) * (-1051.826) [-1050.344] (-1052.507) (-1049.563) -- 0:00:52
232500 -- (-1048.516) [-1048.964] (-1050.529) (-1049.489) * [-1049.026] (-1054.501) (-1051.825) (-1049.660) -- 0:00:52
233000 -- (-1049.453) (-1049.707) [-1053.174] (-1050.269) * (-1053.801) (-1051.642) [-1048.867] (-1048.681) -- 0:00:52
233500 -- [-1047.784] (-1049.158) (-1049.751) (-1049.297) * (-1049.947) (-1047.269) [-1051.053] (-1053.736) -- 0:00:52
234000 -- (-1049.454) (-1054.671) [-1048.869] (-1046.050) * (-1050.463) [-1049.605] (-1050.141) (-1050.266) -- 0:00:52
234500 -- (-1051.709) (-1052.589) (-1049.792) [-1048.370] * [-1049.109] (-1047.863) (-1052.290) (-1049.491) -- 0:00:52
235000 -- (-1050.429) [-1051.072] (-1049.789) (-1050.106) * (-1049.031) [-1048.838] (-1048.872) (-1048.221) -- 0:00:52
Average standard deviation of split frequencies: 0.018818
235500 -- (-1052.102) (-1050.051) (-1051.247) [-1049.604] * (-1047.813) (-1049.945) (-1051.623) [-1049.342] -- 0:00:51
236000 -- (-1048.910) (-1051.863) (-1052.951) [-1045.178] * [-1050.683] (-1050.434) (-1047.916) (-1050.831) -- 0:00:51
236500 -- (-1056.972) (-1051.261) [-1049.610] (-1047.703) * (-1049.595) [-1049.689] (-1050.987) (-1051.287) -- 0:00:51
237000 -- (-1048.453) (-1048.779) (-1049.330) [-1050.502] * (-1046.343) (-1050.465) [-1048.852] (-1052.388) -- 0:00:51
237500 -- (-1049.022) (-1050.761) [-1051.739] (-1052.755) * (-1048.460) (-1050.823) (-1054.070) [-1052.318] -- 0:00:51
238000 -- [-1050.321] (-1051.802) (-1050.185) (-1049.989) * (-1049.909) [-1047.785] (-1049.204) (-1049.553) -- 0:00:51
238500 -- (-1051.200) (-1049.631) (-1050.634) [-1050.530] * (-1049.696) (-1050.383) (-1051.125) [-1050.395] -- 0:00:51
239000 -- (-1051.985) (-1048.823) (-1050.194) [-1053.191] * [-1047.353] (-1050.438) (-1051.596) (-1054.284) -- 0:00:50
239500 -- (-1049.492) (-1051.109) [-1049.841] (-1049.952) * (-1050.498) (-1049.897) (-1049.837) [-1050.321] -- 0:00:50
240000 -- (-1049.155) (-1051.030) (-1051.753) [-1050.026] * (-1048.615) (-1051.014) [-1049.822] (-1054.505) -- 0:00:50
Average standard deviation of split frequencies: 0.017629
240500 -- (-1049.031) (-1049.887) (-1050.441) [-1047.078] * (-1051.666) (-1051.591) [-1050.844] (-1048.876) -- 0:00:50
241000 -- (-1050.551) (-1050.448) [-1052.838] (-1047.748) * (-1049.933) [-1050.763] (-1050.085) (-1053.314) -- 0:00:50
241500 -- (-1050.615) (-1047.501) [-1049.420] (-1049.184) * (-1048.795) (-1050.713) (-1049.894) [-1049.797] -- 0:00:50
242000 -- (-1050.289) [-1050.084] (-1051.174) (-1050.322) * (-1049.626) (-1052.089) (-1049.424) [-1048.625] -- 0:00:50
242500 -- [-1049.651] (-1052.306) (-1049.576) (-1047.383) * (-1050.323) (-1050.736) (-1051.185) [-1046.646] -- 0:00:49
243000 -- (-1049.573) [-1049.053] (-1049.681) (-1051.190) * (-1048.280) (-1046.262) [-1049.792] (-1049.622) -- 0:00:49
243500 -- (-1047.928) [-1048.949] (-1048.231) (-1048.527) * [-1048.874] (-1048.965) (-1053.516) (-1052.485) -- 0:00:49
244000 -- (-1051.026) [-1048.362] (-1051.654) (-1056.550) * (-1048.533) (-1049.447) [-1048.987] (-1055.093) -- 0:00:49
244500 -- (-1047.641) [-1051.771] (-1052.846) (-1052.413) * (-1051.814) (-1049.116) [-1057.170] (-1050.763) -- 0:00:49
245000 -- [-1050.279] (-1050.184) (-1051.354) (-1048.571) * (-1052.077) (-1051.906) [-1048.700] (-1051.330) -- 0:00:52
Average standard deviation of split frequencies: 0.016944
245500 -- [-1052.095] (-1049.090) (-1050.321) (-1047.067) * [-1049.921] (-1052.945) (-1055.170) (-1049.841) -- 0:00:52
246000 -- [-1051.290] (-1049.025) (-1051.362) (-1049.903) * (-1048.263) [-1048.163] (-1049.949) (-1049.112) -- 0:00:52
246500 -- (-1046.587) (-1052.673) (-1050.261) [-1046.872] * (-1049.268) (-1051.149) [-1049.546] (-1048.579) -- 0:00:51
247000 -- (-1049.660) [-1050.246] (-1050.405) (-1048.885) * [-1048.438] (-1048.898) (-1050.107) (-1049.002) -- 0:00:51
247500 -- (-1050.484) (-1053.532) (-1049.797) [-1048.123] * (-1049.127) [-1048.783] (-1052.940) (-1048.829) -- 0:00:51
248000 -- [-1049.300] (-1053.532) (-1050.719) (-1049.765) * [-1048.069] (-1049.164) (-1054.889) (-1050.840) -- 0:00:51
248500 -- (-1052.709) (-1050.687) (-1055.451) [-1049.930] * (-1050.372) (-1050.377) [-1050.814] (-1049.842) -- 0:00:51
249000 -- (-1053.272) (-1049.488) (-1053.526) [-1050.215] * (-1050.573) (-1049.007) (-1052.165) [-1051.759] -- 0:00:51
249500 -- (-1056.105) (-1050.479) (-1046.524) [-1053.223] * (-1050.082) (-1049.345) [-1050.895] (-1049.391) -- 0:00:51
250000 -- (-1052.970) (-1051.791) [-1050.162] (-1052.760) * [-1051.698] (-1050.468) (-1047.578) (-1049.937) -- 0:00:51
Average standard deviation of split frequencies: 0.015936
250500 -- (-1050.542) (-1048.220) [-1049.657] (-1054.498) * (-1051.409) (-1051.021) [-1048.380] (-1049.232) -- 0:00:50
251000 -- [-1048.994] (-1049.624) (-1051.518) (-1053.353) * [-1050.582] (-1051.045) (-1051.529) (-1049.554) -- 0:00:50
251500 -- [-1047.424] (-1049.343) (-1049.714) (-1054.297) * (-1050.141) (-1049.940) [-1051.778] (-1050.462) -- 0:00:50
252000 -- (-1053.095) (-1050.045) [-1052.820] (-1050.832) * (-1052.147) (-1054.069) (-1051.058) [-1049.014] -- 0:00:50
252500 -- (-1049.314) [-1049.338] (-1050.031) (-1048.397) * (-1052.795) [-1049.946] (-1050.639) (-1050.612) -- 0:00:50
253000 -- [-1047.840] (-1050.335) (-1050.039) (-1045.285) * (-1052.495) (-1050.821) [-1048.482] (-1053.370) -- 0:00:50
253500 -- (-1046.986) (-1050.364) [-1048.508] (-1050.243) * (-1048.382) (-1051.013) (-1050.703) [-1049.753] -- 0:00:50
254000 -- (-1049.755) (-1050.297) (-1050.093) [-1046.792] * (-1049.918) [-1048.967] (-1053.039) (-1049.980) -- 0:00:49
254500 -- [-1049.193] (-1051.543) (-1051.682) (-1050.896) * (-1050.528) [-1049.125] (-1052.050) (-1053.421) -- 0:00:49
255000 -- (-1048.696) (-1049.493) (-1050.443) [-1052.024] * [-1051.273] (-1047.998) (-1051.194) (-1049.040) -- 0:00:49
Average standard deviation of split frequencies: 0.015857
255500 -- (-1047.097) [-1049.258] (-1050.781) (-1049.431) * (-1051.007) (-1051.933) (-1048.788) [-1049.564] -- 0:00:49
256000 -- (-1045.607) (-1045.575) [-1053.961] (-1049.189) * [-1049.646] (-1048.950) (-1051.076) (-1050.229) -- 0:00:49
256500 -- (-1048.304) (-1050.299) [-1053.035] (-1049.118) * [-1050.927] (-1051.915) (-1048.987) (-1049.590) -- 0:00:49
257000 -- [-1049.197] (-1050.957) (-1057.965) (-1049.055) * [-1047.821] (-1052.874) (-1050.102) (-1050.543) -- 0:00:49
257500 -- (-1047.713) (-1050.755) (-1050.553) [-1051.713] * (-1051.667) [-1050.355] (-1051.872) (-1049.333) -- 0:00:49
258000 -- (-1047.755) (-1047.528) [-1057.293] (-1050.234) * (-1051.754) (-1049.063) [-1050.655] (-1048.370) -- 0:00:48
258500 -- (-1050.869) [-1050.340] (-1052.322) (-1050.753) * (-1055.676) (-1050.311) [-1049.052] (-1049.330) -- 0:00:48
259000 -- (-1048.658) [-1049.104] (-1052.947) (-1048.448) * [-1049.098] (-1052.020) (-1053.263) (-1051.266) -- 0:00:48
259500 -- (-1049.148) [-1049.243] (-1049.043) (-1052.754) * (-1050.128) (-1050.598) (-1051.656) [-1048.828] -- 0:00:48
260000 -- (-1050.481) (-1053.713) [-1050.368] (-1048.443) * (-1049.599) [-1047.628] (-1049.747) (-1049.343) -- 0:00:51
Average standard deviation of split frequencies: 0.015171
260500 -- [-1049.516] (-1050.845) (-1049.272) (-1047.404) * (-1048.526) (-1053.648) [-1049.896] (-1049.508) -- 0:00:51
261000 -- (-1047.345) [-1050.979] (-1051.445) (-1051.684) * (-1049.141) [-1050.737] (-1050.600) (-1050.119) -- 0:00:50
261500 -- (-1051.362) (-1048.928) [-1049.647] (-1049.011) * (-1049.411) (-1049.111) [-1050.763] (-1049.845) -- 0:00:50
262000 -- (-1048.783) (-1049.453) (-1054.468) [-1047.823] * (-1049.433) (-1048.920) (-1050.416) [-1052.394] -- 0:00:50
262500 -- (-1051.127) (-1053.500) [-1049.193] (-1051.942) * (-1049.716) (-1048.681) (-1049.188) [-1049.854] -- 0:00:50
263000 -- (-1052.616) (-1048.977) (-1048.969) [-1049.287] * (-1049.000) [-1047.850] (-1048.787) (-1049.403) -- 0:00:50
263500 -- (-1050.300) [-1049.286] (-1047.762) (-1050.968) * [-1049.163] (-1050.404) (-1048.799) (-1048.715) -- 0:00:50
264000 -- (-1050.162) (-1049.064) [-1051.380] (-1050.134) * (-1050.156) [-1051.778] (-1049.378) (-1051.019) -- 0:00:50
264500 -- (-1049.729) (-1050.136) (-1053.227) [-1049.221] * (-1048.991) (-1050.503) [-1050.232] (-1048.880) -- 0:00:50
265000 -- (-1048.660) (-1049.103) [-1049.770] (-1050.383) * (-1048.083) (-1050.771) (-1052.006) [-1049.765] -- 0:00:49
Average standard deviation of split frequencies: 0.014737
265500 -- (-1049.650) (-1048.901) (-1049.671) [-1050.267] * [-1050.507] (-1051.801) (-1051.846) (-1047.264) -- 0:00:49
266000 -- (-1050.302) (-1053.068) (-1049.541) [-1050.870] * (-1051.536) (-1050.087) [-1048.928] (-1050.643) -- 0:00:49
266500 -- [-1051.038] (-1047.132) (-1050.046) (-1052.617) * (-1049.483) (-1053.660) (-1050.880) [-1049.320] -- 0:00:49
267000 -- [-1052.985] (-1048.629) (-1050.472) (-1048.595) * (-1049.592) (-1051.271) [-1053.480] (-1051.786) -- 0:00:49
267500 -- (-1049.202) [-1049.639] (-1051.274) (-1049.493) * (-1050.448) [-1049.876] (-1048.594) (-1054.237) -- 0:00:49
268000 -- (-1048.097) (-1050.219) [-1052.146] (-1051.445) * (-1049.226) (-1051.016) [-1051.926] (-1051.299) -- 0:00:49
268500 -- [-1047.437] (-1050.784) (-1049.366) (-1049.336) * (-1051.947) [-1051.195] (-1050.100) (-1049.477) -- 0:00:49
269000 -- (-1050.164) (-1050.109) [-1050.018] (-1049.120) * (-1048.290) (-1049.612) [-1052.723] (-1055.147) -- 0:00:48
269500 -- [-1053.912] (-1050.904) (-1051.627) (-1049.467) * (-1046.991) (-1049.698) (-1058.553) [-1048.494] -- 0:00:48
270000 -- [-1048.975] (-1051.694) (-1053.056) (-1048.823) * (-1049.577) (-1050.570) (-1062.971) [-1048.183] -- 0:00:48
Average standard deviation of split frequencies: 0.014758
270500 -- (-1048.507) (-1049.576) (-1051.973) [-1048.188] * (-1048.784) (-1048.838) [-1051.803] (-1048.325) -- 0:00:48
271000 -- (-1049.638) (-1048.499) [-1050.845] (-1050.798) * [-1049.307] (-1049.546) (-1051.426) (-1048.283) -- 0:00:48
271500 -- [-1051.915] (-1049.768) (-1048.472) (-1049.021) * (-1048.777) (-1052.094) (-1055.124) [-1049.099] -- 0:00:48
272000 -- (-1049.487) (-1049.093) [-1051.065] (-1049.220) * [-1047.950] (-1050.316) (-1049.778) (-1050.221) -- 0:00:48
272500 -- (-1049.204) (-1046.247) (-1051.633) [-1049.743] * (-1050.759) (-1051.274) [-1052.739] (-1048.864) -- 0:00:48
273000 -- (-1050.010) (-1052.083) (-1053.212) [-1048.984] * (-1054.573) [-1053.590] (-1049.127) (-1048.581) -- 0:00:47
273500 -- (-1049.098) (-1051.775) [-1048.788] (-1052.334) * (-1048.169) (-1051.163) [-1050.663] (-1049.239) -- 0:00:47
274000 -- [-1047.958] (-1049.529) (-1050.768) (-1052.963) * [-1049.159] (-1049.441) (-1050.514) (-1048.583) -- 0:00:47
274500 -- (-1050.301) (-1050.044) (-1052.488) [-1048.361] * (-1052.494) (-1048.756) [-1048.795] (-1048.146) -- 0:00:47
275000 -- (-1049.996) [-1050.115] (-1053.071) (-1049.534) * [-1052.409] (-1049.658) (-1048.706) (-1047.028) -- 0:00:50
Average standard deviation of split frequencies: 0.014563
275500 -- (-1050.489) (-1051.133) (-1048.997) [-1051.112] * (-1048.681) (-1050.005) (-1048.998) [-1053.292] -- 0:00:49
276000 -- [-1051.165] (-1049.721) (-1050.166) (-1050.023) * (-1051.287) (-1054.075) [-1049.849] (-1049.815) -- 0:00:49
276500 -- (-1052.944) [-1049.419] (-1054.499) (-1050.516) * [-1050.256] (-1048.839) (-1052.104) (-1048.908) -- 0:00:49
277000 -- (-1051.718) [-1049.648] (-1048.757) (-1054.459) * (-1047.749) (-1051.786) [-1050.171] (-1048.432) -- 0:00:49
277500 -- (-1051.102) (-1052.446) (-1050.502) [-1049.212] * [-1049.589] (-1048.451) (-1048.790) (-1048.640) -- 0:00:49
278000 -- (-1050.446) [-1050.303] (-1049.379) (-1049.235) * (-1051.899) (-1051.252) (-1050.519) [-1049.439] -- 0:00:49
278500 -- (-1049.708) (-1048.637) (-1055.518) [-1049.952] * [-1050.706] (-1049.269) (-1049.099) (-1053.101) -- 0:00:49
279000 -- (-1053.584) [-1048.216] (-1050.030) (-1048.281) * [-1050.823] (-1049.069) (-1048.876) (-1049.282) -- 0:00:49
279500 -- (-1051.841) [-1048.913] (-1049.164) (-1048.925) * (-1048.795) [-1050.889] (-1048.911) (-1055.228) -- 0:00:48
280000 -- [-1050.750] (-1050.418) (-1052.557) (-1049.865) * [-1048.010] (-1050.154) (-1051.664) (-1049.579) -- 0:00:48
Average standard deviation of split frequencies: 0.014498
280500 -- (-1049.620) (-1050.530) [-1050.716] (-1048.748) * (-1049.896) (-1051.522) [-1051.400] (-1047.576) -- 0:00:48
281000 -- (-1051.472) [-1049.107] (-1050.105) (-1052.192) * (-1054.386) (-1050.935) [-1050.816] (-1050.888) -- 0:00:48
281500 -- (-1052.951) [-1048.572] (-1051.570) (-1050.611) * (-1049.954) [-1048.310] (-1060.622) (-1057.314) -- 0:00:48
282000 -- [-1051.287] (-1048.873) (-1049.505) (-1050.992) * [-1046.803] (-1050.237) (-1050.898) (-1050.721) -- 0:00:48
282500 -- (-1049.307) [-1050.307] (-1050.030) (-1049.896) * [-1049.508] (-1048.943) (-1050.196) (-1054.319) -- 0:00:48
283000 -- (-1049.592) (-1049.344) [-1051.775] (-1049.119) * (-1051.239) (-1048.893) [-1051.153] (-1051.586) -- 0:00:48
283500 -- [-1049.414] (-1048.322) (-1056.653) (-1052.254) * [-1053.090] (-1048.965) (-1050.825) (-1049.580) -- 0:00:48
284000 -- [-1048.612] (-1049.229) (-1055.965) (-1051.009) * (-1048.761) (-1055.031) (-1049.458) [-1049.490] -- 0:00:47
284500 -- [-1051.163] (-1049.828) (-1050.380) (-1051.511) * (-1047.625) [-1051.235] (-1050.033) (-1049.974) -- 0:00:47
285000 -- (-1052.485) [-1049.245] (-1049.845) (-1049.860) * (-1047.843) (-1051.184) (-1052.488) [-1051.727] -- 0:00:47
Average standard deviation of split frequencies: 0.013880
285500 -- [-1051.813] (-1050.672) (-1050.508) (-1049.591) * (-1053.528) [-1051.782] (-1049.083) (-1048.848) -- 0:00:47
286000 -- (-1051.279) (-1053.296) [-1048.940] (-1051.900) * (-1051.791) (-1048.998) (-1052.039) [-1048.905] -- 0:00:47
286500 -- (-1053.131) (-1048.840) (-1057.971) [-1050.095] * (-1053.037) [-1049.226] (-1053.805) (-1050.450) -- 0:00:47
287000 -- (-1056.451) [-1050.590] (-1054.473) (-1051.135) * [-1050.712] (-1049.724) (-1052.658) (-1049.164) -- 0:00:47
287500 -- (-1049.142) (-1048.889) (-1050.899) [-1051.621] * (-1048.637) (-1047.388) (-1049.758) [-1049.147] -- 0:00:47
288000 -- (-1051.349) (-1054.549) [-1055.106] (-1051.807) * (-1048.799) [-1050.514] (-1049.695) (-1048.480) -- 0:00:46
288500 -- (-1052.724) [-1047.687] (-1053.852) (-1051.781) * (-1046.984) [-1047.152] (-1050.084) (-1048.535) -- 0:00:46
289000 -- (-1050.102) (-1049.997) (-1049.479) [-1048.420] * (-1049.468) (-1051.271) [-1049.767] (-1047.105) -- 0:00:46
289500 -- (-1050.253) [-1048.751] (-1049.843) (-1048.782) * (-1051.831) (-1050.398) [-1054.020] (-1052.720) -- 0:00:46
290000 -- (-1050.960) (-1049.371) [-1048.929] (-1048.645) * (-1052.907) [-1052.696] (-1048.416) (-1050.392) -- 0:00:46
Average standard deviation of split frequencies: 0.012804
290500 -- (-1050.713) [-1048.328] (-1050.935) (-1050.319) * (-1052.473) (-1052.024) [-1051.574] (-1050.728) -- 0:00:48
291000 -- [-1050.833] (-1048.926) (-1052.567) (-1052.163) * (-1047.199) (-1050.314) (-1052.088) [-1049.551] -- 0:00:48
291500 -- (-1052.784) [-1048.036] (-1049.485) (-1050.400) * (-1046.174) (-1049.216) [-1048.374] (-1049.168) -- 0:00:48
292000 -- [-1049.127] (-1052.754) (-1049.505) (-1052.123) * [-1047.414] (-1047.053) (-1050.248) (-1048.963) -- 0:00:48
292500 -- (-1049.114) (-1049.328) [-1049.324] (-1051.257) * [-1048.022] (-1050.919) (-1049.107) (-1049.801) -- 0:00:48
293000 -- [-1046.209] (-1049.160) (-1050.250) (-1051.003) * [-1047.009] (-1049.441) (-1051.644) (-1049.469) -- 0:00:48
293500 -- (-1048.592) (-1049.445) [-1052.053] (-1053.565) * [-1045.186] (-1049.420) (-1053.622) (-1052.194) -- 0:00:48
294000 -- (-1048.638) (-1052.347) [-1050.451] (-1049.349) * [-1048.715] (-1049.177) (-1051.190) (-1051.355) -- 0:00:48
294500 -- (-1048.531) (-1049.501) [-1051.450] (-1048.747) * (-1047.667) (-1049.806) (-1051.920) [-1049.452] -- 0:00:47
295000 -- (-1056.269) [-1049.009] (-1050.564) (-1048.801) * [-1048.287] (-1051.532) (-1049.260) (-1051.580) -- 0:00:47
Average standard deviation of split frequencies: 0.012741
295500 -- (-1050.386) [-1048.506] (-1050.232) (-1049.684) * (-1052.255) (-1052.639) (-1047.311) [-1049.411] -- 0:00:47
296000 -- [-1049.626] (-1048.575) (-1050.602) (-1053.762) * (-1047.762) (-1049.268) [-1048.626] (-1049.994) -- 0:00:47
296500 -- (-1049.341) (-1052.371) (-1050.689) [-1048.526] * [-1053.415] (-1051.235) (-1051.048) (-1050.575) -- 0:00:47
297000 -- (-1049.239) [-1050.529] (-1053.546) (-1050.652) * (-1055.806) (-1052.010) [-1045.680] (-1054.494) -- 0:00:47
297500 -- [-1048.939] (-1055.235) (-1051.430) (-1049.153) * (-1053.291) (-1049.406) (-1049.489) [-1054.486] -- 0:00:47
298000 -- (-1050.495) (-1052.548) [-1049.770] (-1051.648) * (-1052.968) (-1050.519) (-1046.931) [-1049.753] -- 0:00:47
298500 -- (-1049.671) (-1051.738) (-1051.141) [-1048.343] * (-1050.142) (-1050.389) [-1049.813] (-1049.395) -- 0:00:47
299000 -- (-1049.596) (-1049.276) (-1051.904) [-1048.610] * (-1048.965) (-1050.008) (-1048.954) [-1050.363] -- 0:00:46
299500 -- (-1053.902) (-1048.680) (-1052.118) [-1050.458] * (-1049.090) (-1048.020) [-1053.462] (-1052.065) -- 0:00:46
300000 -- [-1046.826] (-1048.593) (-1051.147) (-1048.639) * (-1048.623) (-1049.706) (-1053.503) [-1049.716] -- 0:00:46
Average standard deviation of split frequencies: 0.012130
300500 -- (-1049.622) (-1049.821) (-1050.587) [-1048.495] * (-1051.949) [-1048.724] (-1052.447) (-1048.754) -- 0:00:46
301000 -- (-1049.064) [-1049.618] (-1051.222) (-1049.699) * (-1053.848) [-1048.787] (-1050.451) (-1049.254) -- 0:00:46
301500 -- (-1050.700) (-1049.150) (-1051.379) [-1049.535] * (-1050.621) (-1049.132) (-1048.728) [-1047.658] -- 0:00:46
302000 -- [-1050.422] (-1049.580) (-1050.042) (-1049.270) * (-1052.184) (-1054.273) [-1049.115] (-1050.505) -- 0:00:46
302500 -- [-1049.661] (-1049.639) (-1051.969) (-1047.822) * (-1049.918) [-1049.225] (-1052.757) (-1049.282) -- 0:00:46
303000 -- (-1053.249) (-1048.918) (-1050.364) [-1049.569] * [-1046.728] (-1050.440) (-1048.584) (-1051.948) -- 0:00:46
303500 -- (-1048.988) (-1051.817) [-1050.169] (-1049.647) * (-1049.110) [-1049.636] (-1052.053) (-1048.537) -- 0:00:45
304000 -- [-1048.443] (-1053.267) (-1050.013) (-1051.321) * [-1052.966] (-1048.785) (-1050.675) (-1046.521) -- 0:00:45
304500 -- [-1048.462] (-1052.502) (-1047.942) (-1053.355) * (-1048.721) (-1047.946) (-1051.694) [-1048.844] -- 0:00:45
305000 -- (-1049.904) (-1048.771) [-1052.577] (-1050.378) * (-1048.973) (-1052.362) [-1049.414] (-1049.975) -- 0:00:45
Average standard deviation of split frequencies: 0.011919
305500 -- (-1049.271) (-1049.610) (-1049.094) [-1049.658] * (-1051.840) [-1053.671] (-1052.003) (-1048.430) -- 0:00:47
306000 -- (-1050.801) [-1051.255] (-1046.581) (-1052.321) * (-1051.376) (-1052.436) [-1049.056] (-1051.142) -- 0:00:47
306500 -- (-1055.235) (-1053.244) (-1049.256) [-1050.341] * (-1052.130) [-1050.507] (-1051.099) (-1047.537) -- 0:00:47
307000 -- (-1048.439) (-1051.277) [-1050.063] (-1049.765) * [-1051.291] (-1051.741) (-1049.724) (-1047.782) -- 0:00:47
307500 -- (-1049.268) [-1051.597] (-1049.950) (-1049.406) * (-1049.850) (-1051.847) [-1048.569] (-1051.524) -- 0:00:47
308000 -- [-1051.643] (-1052.711) (-1049.827) (-1052.944) * (-1049.088) [-1048.256] (-1048.809) (-1047.224) -- 0:00:47
308500 -- (-1053.562) (-1051.453) (-1050.385) [-1051.159] * (-1049.647) (-1050.359) (-1051.264) [-1049.028] -- 0:00:47
309000 -- (-1051.562) (-1050.189) [-1048.024] (-1048.569) * [-1048.810] (-1049.421) (-1046.995) (-1052.072) -- 0:00:46
309500 -- (-1051.445) [-1051.694] (-1050.690) (-1048.382) * (-1049.101) (-1049.094) (-1049.877) [-1050.081] -- 0:00:46
310000 -- (-1050.410) (-1049.517) [-1049.875] (-1048.202) * (-1049.248) [-1049.826] (-1051.294) (-1050.723) -- 0:00:46
Average standard deviation of split frequencies: 0.012059
310500 -- (-1050.663) (-1048.117) (-1050.947) [-1049.708] * (-1049.774) (-1050.353) (-1054.523) [-1046.720] -- 0:00:46
311000 -- (-1053.602) [-1051.503] (-1051.459) (-1050.728) * [-1049.988] (-1050.912) (-1049.069) (-1047.811) -- 0:00:46
311500 -- [-1049.261] (-1051.693) (-1051.194) (-1050.244) * (-1048.637) (-1048.974) [-1049.593] (-1048.941) -- 0:00:46
312000 -- (-1048.642) [-1050.324] (-1054.192) (-1049.846) * (-1057.754) (-1048.654) [-1050.672] (-1047.690) -- 0:00:46
312500 -- (-1049.598) (-1051.328) (-1050.100) [-1048.376] * (-1049.522) [-1049.749] (-1051.268) (-1050.613) -- 0:00:46
313000 -- (-1053.851) [-1054.517] (-1051.594) (-1049.237) * [-1050.561] (-1049.659) (-1055.003) (-1057.147) -- 0:00:46
313500 -- (-1050.771) (-1050.673) (-1051.651) [-1045.873] * (-1050.141) [-1049.368] (-1054.980) (-1054.454) -- 0:00:45
314000 -- (-1050.649) (-1049.636) [-1052.183] (-1046.951) * [-1048.106] (-1050.727) (-1053.312) (-1050.233) -- 0:00:45
314500 -- (-1048.932) (-1053.407) [-1051.640] (-1048.081) * (-1047.086) (-1050.161) (-1050.637) [-1048.737] -- 0:00:45
315000 -- (-1049.656) [-1052.296] (-1050.526) (-1047.649) * (-1048.142) [-1049.543] (-1050.400) (-1048.042) -- 0:00:45
Average standard deviation of split frequencies: 0.011542
315500 -- (-1048.531) (-1053.808) [-1045.891] (-1050.742) * (-1048.585) (-1050.398) (-1048.191) [-1047.459] -- 0:00:45
316000 -- (-1050.984) [-1052.072] (-1047.389) (-1046.072) * (-1049.811) [-1051.711] (-1049.488) (-1049.015) -- 0:00:45
316500 -- (-1047.783) (-1050.282) (-1050.969) [-1047.984] * (-1049.334) [-1047.850] (-1050.544) (-1048.789) -- 0:00:45
317000 -- (-1052.409) [-1049.480] (-1050.722) (-1049.724) * (-1049.082) [-1046.625] (-1051.838) (-1049.363) -- 0:00:45
317500 -- [-1051.247] (-1048.734) (-1049.126) (-1050.838) * (-1049.226) [-1048.182] (-1049.110) (-1049.124) -- 0:00:45
318000 -- [-1049.471] (-1048.897) (-1056.935) (-1050.861) * [-1049.063] (-1047.840) (-1048.876) (-1052.845) -- 0:00:45
318500 -- [-1048.977] (-1049.283) (-1049.057) (-1049.979) * [-1049.543] (-1048.174) (-1050.132) (-1048.436) -- 0:00:44
319000 -- (-1052.751) (-1051.238) [-1048.976] (-1050.123) * (-1051.777) (-1050.102) (-1048.702) [-1048.483] -- 0:00:44
319500 -- (-1050.187) (-1050.283) [-1052.165] (-1048.974) * (-1050.049) [-1049.402] (-1048.897) (-1049.597) -- 0:00:44
320000 -- (-1049.695) (-1049.056) [-1047.753] (-1049.532) * (-1046.568) [-1048.947] (-1050.513) (-1050.417) -- 0:00:44
Average standard deviation of split frequencies: 0.010832
320500 -- (-1048.867) (-1048.861) (-1047.673) [-1047.879] * (-1050.002) [-1047.809] (-1050.680) (-1048.392) -- 0:00:46
321000 -- (-1050.602) [-1050.332] (-1052.107) (-1048.519) * [-1049.070] (-1050.492) (-1047.445) (-1051.415) -- 0:00:46
321500 -- (-1051.631) (-1055.915) (-1051.127) [-1048.028] * (-1048.726) (-1047.641) (-1048.969) [-1048.284] -- 0:00:46
322000 -- (-1049.592) (-1050.947) (-1050.552) [-1048.925] * (-1051.133) (-1053.645) (-1049.200) [-1047.780] -- 0:00:46
322500 -- (-1048.845) (-1050.322) [-1049.495] (-1050.892) * (-1046.516) (-1049.369) [-1048.784] (-1053.457) -- 0:00:46
323000 -- (-1050.727) [-1049.769] (-1050.427) (-1049.508) * [-1048.250] (-1048.941) (-1050.841) (-1054.038) -- 0:00:46
323500 -- (-1049.468) (-1048.964) (-1048.109) [-1052.618] * (-1047.807) (-1049.640) (-1050.390) [-1054.870] -- 0:00:46
324000 -- (-1050.475) [-1050.677] (-1046.785) (-1053.765) * (-1049.756) (-1049.384) (-1051.603) [-1050.977] -- 0:00:45
324500 -- (-1048.891) (-1049.795) (-1049.032) [-1049.889] * (-1050.168) (-1048.706) [-1049.140] (-1048.175) -- 0:00:45
325000 -- (-1049.742) (-1049.493) (-1049.184) [-1049.932] * (-1050.740) (-1050.479) [-1045.786] (-1048.627) -- 0:00:45
Average standard deviation of split frequencies: 0.010503
325500 -- (-1049.006) (-1050.192) (-1050.374) [-1049.328] * (-1050.538) (-1048.933) [-1050.049] (-1051.748) -- 0:00:45
326000 -- (-1048.909) (-1048.851) [-1053.545] (-1049.061) * [-1049.119] (-1049.942) (-1050.275) (-1047.362) -- 0:00:45
326500 -- (-1048.674) (-1048.680) (-1060.928) [-1048.987] * (-1049.144) [-1052.368] (-1046.276) (-1048.319) -- 0:00:45
327000 -- (-1048.390) [-1051.059] (-1048.573) (-1048.863) * [-1048.229] (-1052.030) (-1046.869) (-1046.910) -- 0:00:45
327500 -- [-1049.114] (-1054.250) (-1048.397) (-1051.430) * [-1050.098] (-1054.069) (-1054.841) (-1051.386) -- 0:00:45
328000 -- (-1050.251) [-1053.048] (-1050.335) (-1053.162) * (-1049.160) (-1049.629) (-1053.171) [-1047.785] -- 0:00:45
328500 -- [-1051.299] (-1054.169) (-1048.911) (-1052.007) * (-1051.467) (-1050.071) (-1048.401) [-1049.731] -- 0:00:44
329000 -- (-1049.937) (-1050.310) [-1049.841] (-1049.949) * [-1050.824] (-1051.758) (-1049.195) (-1049.798) -- 0:00:44
329500 -- [-1046.454] (-1049.085) (-1048.653) (-1046.885) * [-1049.471] (-1053.400) (-1051.095) (-1046.181) -- 0:00:44
330000 -- (-1049.143) (-1049.413) (-1046.263) [-1050.589] * [-1049.197] (-1053.455) (-1051.061) (-1048.608) -- 0:00:44
Average standard deviation of split frequencies: 0.010580
330500 -- (-1051.341) (-1059.707) [-1047.239] (-1050.227) * (-1051.067) [-1052.907] (-1048.241) (-1051.381) -- 0:00:44
331000 -- (-1049.289) [-1049.625] (-1046.727) (-1049.671) * (-1053.108) (-1050.574) [-1048.231] (-1049.615) -- 0:00:44
331500 -- [-1050.853] (-1049.480) (-1048.602) (-1049.076) * (-1052.843) (-1050.817) [-1049.136] (-1048.106) -- 0:00:44
332000 -- (-1055.269) [-1049.310] (-1047.175) (-1051.165) * (-1052.927) [-1050.632] (-1047.752) (-1050.809) -- 0:00:44
332500 -- (-1051.715) [-1049.498] (-1050.900) (-1053.470) * (-1050.238) (-1049.079) [-1047.356] (-1054.877) -- 0:00:44
333000 -- (-1054.095) [-1049.898] (-1045.564) (-1048.654) * (-1050.750) (-1048.993) (-1049.771) [-1050.881] -- 0:00:44
333500 -- (-1052.081) (-1048.979) (-1050.637) [-1049.717] * (-1048.958) [-1048.496] (-1049.516) (-1051.148) -- 0:00:43
334000 -- (-1050.132) (-1049.421) [-1048.399] (-1048.799) * (-1048.646) (-1049.785) [-1051.802] (-1054.678) -- 0:00:43
334500 -- [-1047.919] (-1050.374) (-1048.864) (-1048.889) * (-1048.395) (-1050.192) (-1052.205) [-1052.228] -- 0:00:43
335000 -- (-1048.694) [-1049.248] (-1046.697) (-1050.044) * (-1049.860) [-1052.906] (-1051.007) (-1050.775) -- 0:00:43
Average standard deviation of split frequencies: 0.010707
335500 -- (-1048.477) [-1054.138] (-1050.294) (-1051.659) * [-1049.565] (-1055.903) (-1051.988) (-1049.751) -- 0:00:45
336000 -- (-1048.362) (-1051.282) (-1049.665) [-1050.390] * (-1048.524) (-1050.156) (-1050.228) [-1048.845] -- 0:00:45
336500 -- (-1048.122) [-1048.814] (-1051.079) (-1051.711) * [-1047.824] (-1049.236) (-1050.411) (-1051.263) -- 0:00:45
337000 -- [-1046.391] (-1050.729) (-1053.618) (-1049.199) * (-1047.960) (-1049.102) (-1052.378) [-1050.846] -- 0:00:45
337500 -- [-1048.331] (-1050.266) (-1053.247) (-1050.790) * [-1052.325] (-1050.084) (-1054.181) (-1048.370) -- 0:00:45
338000 -- (-1048.949) (-1058.423) [-1049.189] (-1050.795) * (-1051.331) [-1048.888] (-1047.923) (-1051.630) -- 0:00:45
338500 -- (-1049.734) (-1050.566) [-1053.640] (-1050.130) * (-1051.230) (-1050.046) (-1048.365) [-1050.285] -- 0:00:44
339000 -- (-1050.143) (-1051.430) (-1050.677) [-1051.995] * (-1047.280) (-1050.489) [-1048.874] (-1047.137) -- 0:00:44
339500 -- (-1047.914) [-1051.116] (-1049.118) (-1049.446) * (-1048.197) (-1052.555) [-1049.076] (-1048.970) -- 0:00:44
340000 -- [-1047.122] (-1049.685) (-1049.769) (-1052.647) * (-1050.383) (-1047.651) (-1048.076) [-1047.026] -- 0:00:44
Average standard deviation of split frequencies: 0.010706
340500 -- [-1050.020] (-1048.629) (-1049.820) (-1049.709) * (-1048.316) [-1048.695] (-1049.324) (-1052.040) -- 0:00:44
341000 -- (-1050.148) (-1048.746) (-1051.392) [-1052.252] * (-1047.935) (-1048.635) [-1048.875] (-1049.953) -- 0:00:44
341500 -- (-1047.694) (-1050.532) (-1048.958) [-1048.784] * [-1047.964] (-1048.733) (-1047.324) (-1049.105) -- 0:00:44
342000 -- (-1051.039) (-1049.694) [-1047.115] (-1050.382) * (-1047.245) [-1051.451] (-1046.836) (-1049.034) -- 0:00:44
342500 -- (-1052.888) (-1053.062) [-1050.088] (-1050.964) * (-1052.353) (-1049.292) [-1050.081] (-1051.284) -- 0:00:44
343000 -- (-1049.971) (-1051.449) [-1050.625] (-1050.570) * (-1048.991) (-1051.986) (-1049.060) [-1049.681] -- 0:00:44
343500 -- [-1047.447] (-1049.508) (-1046.709) (-1053.155) * (-1048.386) [-1047.305] (-1050.869) (-1050.109) -- 0:00:43
344000 -- [-1046.328] (-1050.325) (-1048.637) (-1050.628) * (-1046.934) [-1051.325] (-1052.901) (-1055.677) -- 0:00:43
344500 -- (-1049.420) (-1051.098) [-1050.784] (-1052.070) * (-1048.903) (-1049.694) (-1049.637) [-1051.240] -- 0:00:43
345000 -- (-1051.888) (-1050.142) (-1048.073) [-1051.543] * [-1050.387] (-1049.252) (-1051.481) (-1049.006) -- 0:00:43
Average standard deviation of split frequencies: 0.011043
345500 -- (-1052.364) (-1049.480) [-1050.926] (-1051.692) * (-1047.878) (-1050.185) (-1050.630) [-1050.963] -- 0:00:43
346000 -- (-1047.279) (-1048.502) (-1052.053) [-1049.492] * (-1051.306) (-1051.813) (-1048.499) [-1049.486] -- 0:00:43
346500 -- (-1050.276) (-1050.665) (-1050.902) [-1048.606] * (-1049.090) [-1048.007] (-1050.345) (-1045.066) -- 0:00:43
347000 -- (-1049.128) (-1049.373) [-1050.520] (-1053.858) * (-1047.698) [-1047.366] (-1049.509) (-1046.800) -- 0:00:43
347500 -- [-1048.099] (-1049.939) (-1051.169) (-1051.514) * (-1050.217) [-1050.254] (-1052.463) (-1050.709) -- 0:00:43
348000 -- [-1049.888] (-1049.745) (-1055.297) (-1049.490) * (-1046.919) [-1050.359] (-1048.588) (-1048.808) -- 0:00:43
348500 -- (-1050.518) (-1048.759) [-1049.996] (-1047.916) * (-1044.311) (-1050.567) [-1047.213] (-1049.284) -- 0:00:42
349000 -- (-1049.762) [-1049.034] (-1049.609) (-1049.125) * (-1047.397) [-1048.665] (-1051.505) (-1052.910) -- 0:00:42
349500 -- [-1051.473] (-1049.228) (-1048.441) (-1051.393) * (-1045.900) (-1051.409) [-1049.083] (-1052.706) -- 0:00:42
350000 -- (-1048.485) [-1048.832] (-1054.718) (-1050.057) * (-1050.750) [-1049.381] (-1049.618) (-1050.649) -- 0:00:42
Average standard deviation of split frequencies: 0.010967
350500 -- (-1048.999) [-1050.090] (-1052.020) (-1048.724) * (-1048.452) [-1049.257] (-1050.251) (-1049.827) -- 0:00:44
351000 -- (-1050.108) (-1052.515) (-1049.215) [-1052.428] * [-1050.097] (-1046.790) (-1050.074) (-1052.350) -- 0:00:44
351500 -- (-1048.325) (-1049.085) (-1050.930) [-1050.369] * (-1053.310) [-1049.012] (-1053.166) (-1051.458) -- 0:00:44
352000 -- [-1050.020] (-1052.500) (-1053.530) (-1049.598) * [-1048.452] (-1047.688) (-1049.003) (-1050.228) -- 0:00:44
352500 -- (-1050.644) [-1050.115] (-1050.004) (-1049.036) * [-1048.712] (-1049.368) (-1047.432) (-1047.297) -- 0:00:44
353000 -- [-1051.187] (-1052.108) (-1049.508) (-1049.993) * (-1048.819) (-1051.364) (-1050.821) [-1047.553] -- 0:00:43
353500 -- (-1050.036) (-1052.857) [-1048.509] (-1054.023) * (-1048.144) (-1049.169) (-1049.051) [-1051.081] -- 0:00:43
354000 -- (-1054.693) [-1050.987] (-1051.833) (-1049.062) * [-1049.327] (-1051.492) (-1048.303) (-1053.849) -- 0:00:43
354500 -- (-1054.105) [-1048.476] (-1049.624) (-1055.741) * [-1051.145] (-1051.278) (-1048.454) (-1056.284) -- 0:00:43
355000 -- (-1056.078) [-1050.394] (-1049.150) (-1052.329) * (-1052.774) (-1051.166) [-1047.327] (-1051.959) -- 0:00:43
Average standard deviation of split frequencies: 0.010802
355500 -- [-1048.529] (-1049.976) (-1049.240) (-1055.320) * (-1049.320) [-1048.291] (-1047.313) (-1050.173) -- 0:00:43
356000 -- [-1048.612] (-1051.140) (-1048.551) (-1050.624) * (-1048.619) (-1052.144) [-1048.161] (-1051.045) -- 0:00:43
356500 -- (-1048.762) [-1048.099] (-1049.385) (-1049.437) * (-1048.884) [-1051.603] (-1047.059) (-1049.670) -- 0:00:43
357000 -- (-1050.701) (-1052.306) [-1050.978] (-1051.123) * [-1050.882] (-1053.586) (-1046.883) (-1051.319) -- 0:00:43
357500 -- (-1048.868) (-1052.291) (-1054.283) [-1048.878] * (-1054.323) (-1054.881) [-1047.111] (-1048.315) -- 0:00:43
358000 -- (-1052.003) [-1048.602] (-1049.279) (-1048.410) * (-1048.304) [-1048.464] (-1050.673) (-1050.084) -- 0:00:43
358500 -- (-1048.918) (-1050.331) (-1051.210) [-1048.439] * (-1049.307) (-1049.239) (-1051.214) [-1050.774] -- 0:00:42
359000 -- (-1049.433) (-1052.116) (-1051.297) [-1050.315] * (-1048.204) (-1048.779) [-1048.782] (-1049.411) -- 0:00:42
359500 -- (-1050.078) [-1051.219] (-1051.064) (-1050.347) * (-1048.343) (-1049.224) (-1047.871) [-1049.937] -- 0:00:42
360000 -- (-1048.942) (-1051.486) [-1050.533] (-1049.573) * [-1048.589] (-1049.686) (-1048.341) (-1048.152) -- 0:00:42
Average standard deviation of split frequencies: 0.011075
360500 -- (-1048.022) [-1050.041] (-1052.754) (-1050.986) * (-1046.399) (-1050.902) (-1050.558) [-1050.153] -- 0:00:42
361000 -- (-1053.059) (-1049.311) (-1046.273) [-1049.300] * [-1048.799] (-1050.607) (-1047.023) (-1049.847) -- 0:00:42
361500 -- (-1050.927) [-1049.016] (-1048.263) (-1049.695) * (-1049.271) (-1048.320) (-1049.001) [-1048.920] -- 0:00:42
362000 -- (-1052.002) (-1049.973) (-1048.660) [-1048.888] * [-1048.131] (-1051.165) (-1052.105) (-1050.302) -- 0:00:42
362500 -- (-1047.616) [-1050.703] (-1048.993) (-1048.931) * (-1054.208) (-1051.015) (-1047.886) [-1049.706] -- 0:00:42
363000 -- (-1052.504) (-1057.917) (-1047.768) [-1057.442] * (-1054.394) [-1048.629] (-1051.392) (-1049.599) -- 0:00:42
363500 -- (-1049.445) (-1051.079) (-1050.086) [-1050.886] * (-1050.673) [-1048.716] (-1049.938) (-1049.435) -- 0:00:42
364000 -- (-1054.684) [-1050.824] (-1049.990) (-1052.313) * [-1049.707] (-1049.225) (-1051.420) (-1049.547) -- 0:00:41
364500 -- (-1049.330) (-1048.835) (-1049.309) [-1051.067] * (-1049.075) (-1049.364) [-1046.639] (-1049.783) -- 0:00:41
365000 -- [-1048.849] (-1048.483) (-1050.989) (-1049.247) * [-1047.809] (-1048.284) (-1049.211) (-1049.131) -- 0:00:41
Average standard deviation of split frequencies: 0.011389
365500 -- (-1049.380) (-1049.108) [-1048.869] (-1051.068) * (-1054.225) (-1049.608) (-1051.025) [-1048.740] -- 0:00:43
366000 -- (-1050.643) [-1048.753] (-1050.788) (-1050.489) * (-1050.327) [-1049.100] (-1052.301) (-1050.435) -- 0:00:43
366500 -- [-1051.191] (-1050.540) (-1051.604) (-1052.210) * [-1047.233] (-1049.449) (-1052.167) (-1051.898) -- 0:00:43
367000 -- [-1048.972] (-1048.458) (-1049.689) (-1051.032) * (-1047.144) (-1052.261) (-1052.132) [-1049.186] -- 0:00:43
367500 -- [-1049.343] (-1048.274) (-1050.307) (-1051.239) * (-1054.535) [-1047.525] (-1053.632) (-1051.592) -- 0:00:43
368000 -- [-1049.949] (-1051.378) (-1049.735) (-1046.391) * (-1050.238) [-1049.792] (-1051.550) (-1048.352) -- 0:00:42
368500 -- (-1049.807) [-1048.971] (-1048.389) (-1049.208) * (-1049.754) [-1050.004] (-1049.184) (-1050.280) -- 0:00:42
369000 -- (-1050.578) (-1050.455) [-1048.649] (-1048.301) * [-1048.437] (-1048.375) (-1050.139) (-1049.278) -- 0:00:42
369500 -- (-1047.911) (-1049.045) (-1051.229) [-1047.369] * (-1048.363) [-1048.080] (-1049.686) (-1048.741) -- 0:00:42
370000 -- (-1048.402) (-1050.266) (-1050.747) [-1049.727] * (-1049.764) [-1046.948] (-1049.075) (-1049.872) -- 0:00:42
Average standard deviation of split frequencies: 0.011647
370500 -- [-1048.921] (-1050.349) (-1049.531) (-1056.036) * [-1049.753] (-1054.533) (-1049.766) (-1049.994) -- 0:00:42
371000 -- [-1046.117] (-1050.834) (-1048.831) (-1057.151) * (-1049.721) (-1049.193) [-1049.705] (-1050.890) -- 0:00:42
371500 -- [-1050.859] (-1049.999) (-1051.488) (-1057.460) * (-1052.061) [-1051.248] (-1048.203) (-1051.818) -- 0:00:42
372000 -- [-1049.069] (-1050.555) (-1048.673) (-1050.695) * (-1049.120) (-1052.694) (-1049.772) [-1046.545] -- 0:00:42
372500 -- (-1050.486) [-1048.228] (-1049.022) (-1054.060) * (-1049.154) (-1052.246) (-1050.923) [-1046.340] -- 0:00:42
373000 -- (-1052.020) [-1048.065] (-1050.024) (-1052.157) * (-1049.847) [-1047.174] (-1050.812) (-1051.451) -- 0:00:42
373500 -- [-1051.083] (-1052.155) (-1052.105) (-1049.288) * (-1048.663) [-1047.932] (-1050.760) (-1050.960) -- 0:00:41
374000 -- (-1050.087) (-1049.534) (-1049.848) [-1046.912] * (-1048.369) [-1049.379] (-1050.585) (-1051.350) -- 0:00:41
374500 -- (-1052.936) (-1049.218) (-1049.086) [-1049.635] * (-1052.258) [-1047.727] (-1047.715) (-1049.673) -- 0:00:41
375000 -- (-1047.828) (-1049.763) [-1048.405] (-1047.901) * (-1052.967) (-1049.191) (-1051.959) [-1048.010] -- 0:00:41
Average standard deviation of split frequencies: 0.012405
375500 -- (-1049.878) [-1051.031] (-1049.277) (-1049.381) * [-1050.693] (-1053.578) (-1051.759) (-1045.067) -- 0:00:41
376000 -- [-1049.677] (-1049.722) (-1052.696) (-1049.638) * (-1051.019) [-1049.135] (-1049.422) (-1051.181) -- 0:00:41
376500 -- (-1048.584) (-1050.332) (-1051.087) [-1047.047] * (-1050.096) (-1047.872) [-1049.008] (-1054.903) -- 0:00:41
377000 -- (-1049.394) [-1050.488] (-1051.156) (-1050.193) * (-1053.320) [-1047.221] (-1049.077) (-1048.062) -- 0:00:41
377500 -- (-1052.425) (-1050.140) (-1049.102) [-1049.674] * (-1052.779) [-1046.536] (-1048.990) (-1052.539) -- 0:00:41
378000 -- (-1049.348) (-1050.506) (-1049.021) [-1049.552] * (-1052.462) (-1050.513) (-1049.521) [-1048.322] -- 0:00:41
378500 -- [-1048.492] (-1051.044) (-1051.543) (-1051.188) * [-1051.536] (-1049.300) (-1055.294) (-1049.124) -- 0:00:41
379000 -- (-1049.859) (-1049.040) [-1054.442] (-1048.442) * (-1054.059) (-1048.137) [-1048.488] (-1048.974) -- 0:00:40
379500 -- (-1048.128) [-1050.550] (-1049.823) (-1048.690) * [-1047.042] (-1049.402) (-1047.955) (-1048.475) -- 0:00:40
380000 -- (-1051.916) (-1049.188) [-1048.757] (-1049.494) * [-1050.317] (-1045.722) (-1049.741) (-1056.923) -- 0:00:40
Average standard deviation of split frequencies: 0.012123
380500 -- (-1049.814) (-1049.115) (-1047.185) [-1052.893] * [-1052.310] (-1047.280) (-1050.837) (-1050.303) -- 0:00:40
381000 -- [-1049.837] (-1049.760) (-1048.280) (-1052.530) * [-1051.700] (-1050.975) (-1050.702) (-1050.924) -- 0:00:42
381500 -- (-1049.920) (-1049.533) (-1047.381) [-1049.174] * [-1051.375] (-1051.561) (-1049.432) (-1051.118) -- 0:00:42
382000 -- (-1053.587) [-1048.973] (-1051.417) (-1050.973) * (-1049.480) [-1050.130] (-1050.536) (-1049.960) -- 0:00:42
382500 -- (-1053.584) [-1049.227] (-1049.045) (-1050.472) * (-1051.678) (-1055.896) [-1047.614] (-1053.099) -- 0:00:41
383000 -- (-1048.823) [-1050.733] (-1050.114) (-1049.238) * [-1049.827] (-1052.125) (-1048.655) (-1047.500) -- 0:00:41
383500 -- (-1049.601) (-1048.866) [-1051.475] (-1048.867) * (-1048.945) [-1052.462] (-1049.487) (-1048.497) -- 0:00:41
384000 -- (-1050.932) (-1050.731) [-1049.879] (-1052.465) * [-1047.626] (-1049.917) (-1053.354) (-1049.057) -- 0:00:41
384500 -- [-1048.922] (-1048.015) (-1047.916) (-1051.102) * [-1046.550] (-1047.331) (-1051.750) (-1050.387) -- 0:00:41
385000 -- [-1050.601] (-1049.195) (-1048.173) (-1050.889) * (-1049.403) (-1049.813) [-1047.650] (-1053.812) -- 0:00:41
Average standard deviation of split frequencies: 0.012405
385500 -- (-1052.725) (-1050.265) (-1050.278) [-1048.577] * (-1048.487) (-1049.431) [-1048.404] (-1048.960) -- 0:00:41
386000 -- (-1049.408) (-1052.441) [-1047.572] (-1048.320) * (-1048.307) (-1049.762) (-1050.788) [-1048.905] -- 0:00:41
386500 -- (-1052.644) [-1049.869] (-1051.003) (-1047.018) * (-1050.447) [-1049.065] (-1053.489) (-1050.456) -- 0:00:41
387000 -- (-1051.322) (-1048.775) [-1051.607] (-1054.854) * (-1047.665) [-1046.699] (-1050.266) (-1050.699) -- 0:00:41
387500 -- (-1048.932) [-1049.101] (-1051.667) (-1050.095) * (-1051.939) [-1050.050] (-1051.078) (-1048.641) -- 0:00:41
388000 -- (-1048.959) [-1048.691] (-1050.888) (-1046.366) * (-1049.166) (-1048.451) [-1050.413] (-1051.843) -- 0:00:41
388500 -- [-1049.387] (-1049.016) (-1051.359) (-1050.439) * (-1049.049) (-1050.581) (-1048.675) [-1048.466] -- 0:00:40
389000 -- (-1050.935) (-1048.894) [-1048.837] (-1054.891) * (-1049.797) [-1050.405] (-1050.159) (-1049.761) -- 0:00:40
389500 -- (-1049.958) (-1049.498) [-1049.019] (-1052.939) * [-1047.164] (-1050.215) (-1050.679) (-1052.153) -- 0:00:40
390000 -- (-1051.951) (-1049.070) (-1051.066) [-1048.938] * [-1049.653] (-1049.587) (-1049.057) (-1052.434) -- 0:00:40
Average standard deviation of split frequencies: 0.011051
390500 -- [-1050.810] (-1049.190) (-1050.290) (-1048.717) * (-1051.252) (-1056.737) [-1047.781] (-1048.340) -- 0:00:40
391000 -- (-1051.199) (-1049.444) [-1051.772] (-1047.922) * (-1050.087) [-1054.416] (-1048.596) (-1048.907) -- 0:00:40
391500 -- [-1051.868] (-1049.720) (-1050.503) (-1048.648) * (-1049.206) [-1050.935] (-1049.668) (-1050.233) -- 0:00:40
392000 -- (-1051.575) (-1052.121) [-1054.772] (-1049.234) * (-1050.542) (-1048.590) (-1047.395) [-1048.674] -- 0:00:40
392500 -- [-1049.195] (-1049.233) (-1053.178) (-1050.071) * (-1050.310) (-1045.542) (-1049.365) [-1048.583] -- 0:00:40
393000 -- (-1049.624) (-1050.490) (-1050.783) [-1049.715] * [-1052.618] (-1050.364) (-1047.821) (-1049.410) -- 0:00:40
393500 -- (-1048.991) [-1048.839] (-1050.724) (-1049.261) * (-1049.878) (-1058.181) [-1047.009] (-1051.867) -- 0:00:40
394000 -- [-1049.300] (-1050.919) (-1048.272) (-1052.096) * (-1050.846) (-1048.108) [-1047.294] (-1048.828) -- 0:00:39
394500 -- (-1050.747) [-1048.723] (-1050.270) (-1049.199) * (-1048.804) (-1049.824) [-1049.101] (-1050.997) -- 0:00:39
395000 -- (-1049.621) [-1047.829] (-1049.360) (-1051.395) * [-1048.551] (-1049.803) (-1049.740) (-1050.815) -- 0:00:39
Average standard deviation of split frequencies: 0.011466
395500 -- (-1046.205) (-1052.563) [-1050.150] (-1049.079) * (-1048.183) (-1049.402) (-1046.395) [-1049.920] -- 0:00:39
396000 -- (-1053.184) [-1046.246] (-1049.196) (-1049.062) * [-1049.005] (-1049.145) (-1049.806) (-1048.057) -- 0:00:41
396500 -- (-1049.915) [-1050.850] (-1048.220) (-1051.262) * (-1049.669) (-1049.179) [-1049.472] (-1050.925) -- 0:00:41
397000 -- [-1048.436] (-1050.361) (-1050.321) (-1049.519) * (-1051.592) (-1053.493) [-1050.165] (-1050.887) -- 0:00:41
397500 -- (-1049.522) (-1049.414) (-1048.367) [-1049.900] * (-1050.182) (-1046.908) (-1050.245) [-1048.919] -- 0:00:40
398000 -- [-1049.279] (-1049.382) (-1049.826) (-1048.123) * [-1050.112] (-1047.867) (-1050.379) (-1051.535) -- 0:00:40
398500 -- (-1048.908) (-1048.696) (-1047.217) [-1049.009] * (-1051.591) (-1047.162) (-1049.593) [-1048.297] -- 0:00:40
399000 -- (-1048.401) [-1049.431] (-1049.404) (-1048.612) * (-1049.549) (-1050.139) (-1050.122) [-1049.122] -- 0:00:40
399500 -- (-1049.784) (-1049.814) (-1047.836) [-1049.922] * [-1051.521] (-1052.967) (-1049.442) (-1049.944) -- 0:00:40
400000 -- (-1048.976) (-1054.679) (-1048.195) [-1049.870] * [-1049.392] (-1049.755) (-1048.767) (-1049.250) -- 0:00:40
Average standard deviation of split frequencies: 0.011394
400500 -- (-1051.604) (-1049.658) [-1052.223] (-1048.756) * [-1049.526] (-1051.040) (-1048.715) (-1049.252) -- 0:00:40
401000 -- (-1049.380) (-1051.807) (-1047.961) [-1048.235] * (-1048.984) [-1050.408] (-1046.199) (-1053.423) -- 0:00:40
401500 -- (-1048.598) (-1051.366) [-1048.457] (-1050.077) * (-1049.562) (-1048.389) (-1050.541) [-1049.076] -- 0:00:40
402000 -- (-1048.560) (-1047.451) (-1050.927) [-1048.339] * (-1049.197) [-1047.863] (-1050.493) (-1050.431) -- 0:00:40
402500 -- [-1050.977] (-1048.419) (-1050.433) (-1049.843) * [-1048.959] (-1049.108) (-1049.683) (-1051.195) -- 0:00:40
403000 -- [-1049.279] (-1049.079) (-1052.330) (-1047.695) * [-1049.469] (-1049.414) (-1048.719) (-1049.471) -- 0:00:39
403500 -- (-1047.041) [-1049.225] (-1051.838) (-1049.401) * (-1047.217) (-1047.939) (-1047.536) [-1051.314] -- 0:00:39
404000 -- (-1045.959) (-1049.274) [-1050.276] (-1054.963) * (-1049.844) [-1048.681] (-1050.730) (-1049.039) -- 0:00:39
404500 -- [-1047.663] (-1051.019) (-1048.133) (-1050.416) * (-1050.371) (-1049.263) [-1050.746] (-1050.469) -- 0:00:39
405000 -- (-1048.479) (-1051.720) [-1045.857] (-1050.080) * (-1048.622) [-1053.112] (-1050.916) (-1051.110) -- 0:00:39
Average standard deviation of split frequencies: 0.010511
405500 -- (-1048.914) (-1049.087) [-1046.494] (-1048.540) * (-1048.455) (-1049.256) (-1050.868) [-1051.326] -- 0:00:39
406000 -- (-1049.795) (-1051.210) [-1050.169] (-1050.108) * (-1049.473) (-1049.777) (-1048.684) [-1046.912] -- 0:00:39
406500 -- (-1047.678) [-1051.731] (-1048.631) (-1049.213) * (-1052.796) (-1049.790) [-1048.417] (-1049.368) -- 0:00:39
407000 -- (-1049.429) [-1051.638] (-1051.158) (-1049.226) * (-1052.189) (-1051.500) (-1047.803) [-1048.838] -- 0:00:39
407500 -- (-1048.643) [-1049.341] (-1049.863) (-1048.668) * (-1049.261) (-1050.776) [-1047.380] (-1047.843) -- 0:00:39
408000 -- (-1046.041) (-1048.834) (-1054.806) [-1049.973] * (-1050.854) (-1050.500) [-1049.010] (-1051.705) -- 0:00:39
408500 -- [-1048.608] (-1049.618) (-1049.875) (-1049.176) * (-1050.210) (-1049.128) (-1050.632) [-1050.458] -- 0:00:39
409000 -- [-1047.620] (-1049.578) (-1053.694) (-1052.408) * (-1049.837) [-1052.604] (-1049.696) (-1049.761) -- 0:00:39
409500 -- (-1048.948) [-1048.491] (-1051.073) (-1051.427) * [-1049.869] (-1051.972) (-1045.614) (-1050.516) -- 0:00:38
410000 -- (-1050.836) (-1051.850) (-1049.181) [-1049.886] * (-1052.629) (-1048.380) (-1047.134) [-1048.782] -- 0:00:38
Average standard deviation of split frequencies: 0.009727
410500 -- [-1049.878] (-1050.593) (-1049.024) (-1049.403) * (-1053.542) (-1050.810) (-1050.050) [-1050.218] -- 0:00:38
411000 -- [-1048.761] (-1050.833) (-1048.487) (-1053.252) * (-1051.371) [-1049.940] (-1049.169) (-1049.518) -- 0:00:40
411500 -- [-1048.575] (-1055.239) (-1048.732) (-1051.650) * (-1052.782) (-1048.724) (-1049.897) [-1047.236] -- 0:00:40
412000 -- (-1049.166) (-1050.334) (-1050.540) [-1052.634] * [-1056.738] (-1054.159) (-1050.266) (-1048.625) -- 0:00:39
412500 -- (-1050.353) (-1049.972) (-1051.475) [-1051.624] * [-1051.670] (-1049.334) (-1048.644) (-1048.873) -- 0:00:39
413000 -- (-1050.572) (-1049.467) (-1053.605) [-1048.731] * (-1051.179) (-1052.542) (-1049.747) [-1047.806] -- 0:00:39
413500 -- [-1048.560] (-1051.835) (-1048.951) (-1049.425) * (-1049.990) (-1051.636) [-1048.078] (-1047.638) -- 0:00:39
414000 -- (-1052.071) (-1052.251) (-1049.374) [-1048.966] * (-1048.442) (-1049.798) [-1049.651] (-1047.388) -- 0:00:39
414500 -- (-1049.510) [-1050.416] (-1046.190) (-1047.769) * [-1049.630] (-1050.599) (-1049.147) (-1052.639) -- 0:00:39
415000 -- [-1051.835] (-1049.399) (-1048.966) (-1050.984) * (-1049.514) [-1048.617] (-1049.900) (-1053.379) -- 0:00:39
Average standard deviation of split frequencies: 0.010497
415500 -- (-1048.958) (-1055.905) [-1048.738] (-1047.409) * (-1049.075) (-1049.306) [-1049.244] (-1048.919) -- 0:00:39
416000 -- (-1050.615) (-1049.612) [-1049.370] (-1049.607) * (-1048.122) (-1053.721) [-1049.846] (-1053.697) -- 0:00:39
416500 -- (-1050.149) (-1048.863) [-1054.313] (-1049.084) * (-1053.126) [-1051.717] (-1048.959) (-1051.589) -- 0:00:39
417000 -- (-1048.744) [-1048.774] (-1050.031) (-1062.119) * (-1054.038) (-1052.295) (-1051.603) [-1048.383] -- 0:00:39
417500 -- (-1050.518) (-1050.633) (-1050.015) [-1050.698] * (-1048.693) (-1051.025) (-1049.274) [-1048.515] -- 0:00:39
418000 -- (-1055.731) (-1048.809) (-1051.913) [-1049.917] * (-1050.407) [-1053.481] (-1048.669) (-1048.923) -- 0:00:38
418500 -- [-1050.571] (-1052.603) (-1050.509) (-1048.864) * (-1048.409) (-1053.357) (-1047.914) [-1049.029] -- 0:00:38
419000 -- [-1046.939] (-1049.666) (-1050.025) (-1051.266) * (-1050.484) (-1054.141) (-1051.780) [-1051.405] -- 0:00:38
419500 -- (-1048.603) [-1053.258] (-1050.369) (-1052.649) * [-1050.542] (-1054.761) (-1050.110) (-1051.003) -- 0:00:38
420000 -- (-1048.085) (-1050.963) [-1050.453] (-1051.765) * (-1048.252) (-1053.265) (-1047.530) [-1052.296] -- 0:00:38
Average standard deviation of split frequencies: 0.010321
420500 -- (-1051.136) (-1049.536) (-1049.598) [-1050.049] * (-1049.082) [-1051.684] (-1053.603) (-1048.873) -- 0:00:38
421000 -- (-1050.654) (-1049.211) [-1048.744] (-1053.267) * (-1049.491) (-1055.412) (-1047.689) [-1049.657] -- 0:00:38
421500 -- (-1048.384) [-1049.356] (-1049.805) (-1050.730) * (-1048.967) [-1051.048] (-1047.803) (-1052.144) -- 0:00:38
422000 -- (-1050.288) (-1052.579) (-1048.272) [-1049.405] * (-1049.403) [-1051.267] (-1046.488) (-1048.079) -- 0:00:38
422500 -- (-1050.520) [-1052.062] (-1048.041) (-1048.705) * (-1049.779) [-1051.495] (-1049.355) (-1051.628) -- 0:00:38
423000 -- (-1050.319) [-1054.783] (-1055.044) (-1049.109) * [-1051.862] (-1051.356) (-1050.432) (-1047.740) -- 0:00:38
423500 -- (-1053.674) [-1049.873] (-1051.063) (-1049.318) * (-1053.981) (-1049.059) (-1048.743) [-1049.770] -- 0:00:38
424000 -- (-1052.431) (-1050.695) [-1051.051] (-1052.044) * [-1051.064] (-1049.444) (-1048.268) (-1051.191) -- 0:00:38
424500 -- (-1053.857) (-1049.721) (-1052.361) [-1053.375] * (-1050.096) (-1052.226) (-1048.749) [-1048.880] -- 0:00:37
425000 -- (-1052.565) (-1054.023) [-1047.463] (-1051.294) * (-1053.590) (-1049.399) (-1049.175) [-1049.975] -- 0:00:37
Average standard deviation of split frequencies: 0.010367
425500 -- (-1053.378) [-1051.034] (-1050.343) (-1053.480) * (-1051.946) (-1051.754) [-1046.882] (-1049.880) -- 0:00:37
426000 -- (-1052.618) (-1055.209) (-1048.751) [-1048.949] * [-1050.175] (-1050.867) (-1048.635) (-1049.230) -- 0:00:37
426500 -- [-1049.351] (-1048.427) (-1049.977) (-1051.939) * (-1050.539) (-1050.731) (-1049.998) [-1052.319] -- 0:00:38
427000 -- [-1050.096] (-1052.199) (-1051.023) (-1050.941) * (-1049.853) [-1050.270] (-1049.342) (-1050.418) -- 0:00:38
427500 -- (-1052.327) [-1047.458] (-1050.598) (-1050.834) * (-1050.269) [-1048.793] (-1052.297) (-1049.221) -- 0:00:38
428000 -- (-1049.583) (-1048.477) [-1049.354] (-1049.329) * (-1050.779) [-1050.826] (-1050.088) (-1048.483) -- 0:00:38
428500 -- (-1050.422) (-1052.436) (-1051.393) [-1048.699] * (-1048.916) (-1057.128) (-1051.005) [-1050.208] -- 0:00:38
429000 -- (-1051.165) (-1053.828) (-1053.572) [-1049.828] * [-1047.338] (-1050.835) (-1049.828) (-1049.398) -- 0:00:38
429500 -- (-1050.605) (-1054.114) [-1053.506] (-1048.109) * [-1047.924] (-1052.672) (-1049.196) (-1048.889) -- 0:00:38
430000 -- (-1048.701) (-1050.125) (-1050.923) [-1050.972] * [-1045.866] (-1049.173) (-1049.135) (-1048.741) -- 0:00:38
Average standard deviation of split frequencies: 0.010658
430500 -- [-1048.834] (-1052.080) (-1055.429) (-1049.162) * [-1046.975] (-1051.719) (-1055.290) (-1054.522) -- 0:00:38
431000 -- (-1048.459) (-1049.868) (-1052.451) [-1053.467] * (-1046.641) (-1049.872) [-1050.561] (-1048.527) -- 0:00:38
431500 -- (-1048.590) (-1048.324) [-1048.897] (-1049.076) * [-1052.185] (-1051.381) (-1050.275) (-1049.858) -- 0:00:38
432000 -- (-1048.858) (-1047.266) (-1048.951) [-1049.459] * (-1050.588) (-1051.454) [-1051.112] (-1050.778) -- 0:00:38
432500 -- (-1048.579) (-1048.218) (-1050.389) [-1050.767] * [-1050.033] (-1049.480) (-1050.812) (-1048.817) -- 0:00:38
433000 -- (-1048.878) (-1048.622) (-1049.524) [-1049.044] * (-1048.377) [-1049.885] (-1050.044) (-1048.121) -- 0:00:37
433500 -- [-1050.553] (-1050.445) (-1052.254) (-1050.086) * [-1049.589] (-1050.466) (-1052.487) (-1048.265) -- 0:00:37
434000 -- (-1052.327) (-1050.956) (-1051.300) [-1046.878] * (-1048.664) (-1049.954) (-1050.225) [-1049.473] -- 0:00:37
434500 -- (-1052.713) (-1049.586) [-1049.593] (-1049.356) * (-1048.813) (-1048.645) (-1049.265) [-1048.292] -- 0:00:37
435000 -- (-1048.942) (-1051.138) [-1053.173] (-1051.000) * [-1047.399] (-1051.059) (-1049.283) (-1051.034) -- 0:00:37
Average standard deviation of split frequencies: 0.010414
435500 -- (-1048.801) [-1052.767] (-1049.536) (-1050.394) * (-1050.141) (-1052.271) (-1049.880) [-1051.506] -- 0:00:37
436000 -- [-1050.908] (-1050.103) (-1050.114) (-1049.493) * (-1053.746) (-1051.988) [-1047.128] (-1049.609) -- 0:00:37
436500 -- (-1050.572) [-1048.982] (-1049.403) (-1047.269) * (-1051.242) (-1049.505) [-1047.155] (-1051.448) -- 0:00:37
437000 -- (-1050.276) (-1050.264) (-1049.496) [-1048.094] * (-1048.190) (-1051.078) [-1046.302] (-1049.706) -- 0:00:37
437500 -- (-1051.097) [-1049.741] (-1049.395) (-1049.170) * (-1050.358) (-1049.833) (-1048.087) [-1050.887] -- 0:00:37
438000 -- (-1048.941) (-1049.809) [-1049.352] (-1048.691) * [-1052.420] (-1049.814) (-1050.504) (-1048.350) -- 0:00:37
438500 -- [-1048.600] (-1050.037) (-1051.485) (-1056.698) * (-1054.032) (-1050.070) (-1051.909) [-1048.990] -- 0:00:37
439000 -- (-1048.344) (-1049.243) [-1051.142] (-1050.958) * (-1057.695) (-1050.162) (-1054.486) [-1047.628] -- 0:00:37
439500 -- (-1052.072) [-1048.616] (-1047.990) (-1052.476) * (-1054.841) (-1050.417) (-1047.796) [-1049.857] -- 0:00:36
440000 -- (-1050.567) (-1052.860) (-1050.929) [-1053.507] * (-1057.451) [-1049.267] (-1048.272) (-1049.411) -- 0:00:36
Average standard deviation of split frequencies: 0.010472
440500 -- (-1048.908) (-1052.361) [-1052.125] (-1050.627) * (-1049.622) (-1049.172) [-1048.842] (-1048.558) -- 0:00:36
441000 -- (-1051.416) (-1050.956) [-1048.781] (-1049.372) * [-1049.608] (-1048.578) (-1051.882) (-1050.349) -- 0:00:36
441500 -- [-1050.818] (-1049.486) (-1050.766) (-1050.110) * [-1049.711] (-1049.173) (-1052.036) (-1049.959) -- 0:00:37
442000 -- (-1050.553) [-1050.005] (-1051.361) (-1049.217) * (-1049.475) (-1048.946) [-1048.768] (-1050.935) -- 0:00:37
442500 -- (-1048.189) (-1051.516) (-1048.853) [-1050.355] * (-1048.236) [-1050.074] (-1047.072) (-1051.026) -- 0:00:37
443000 -- (-1049.470) [-1049.652] (-1048.661) (-1049.850) * (-1046.106) (-1050.645) [-1047.846] (-1049.780) -- 0:00:37
443500 -- (-1049.290) (-1051.365) (-1049.114) [-1050.702] * [-1052.326] (-1050.589) (-1049.146) (-1050.685) -- 0:00:37
444000 -- [-1049.854] (-1048.903) (-1048.987) (-1050.022) * (-1049.987) (-1050.408) [-1049.474] (-1049.908) -- 0:00:37
444500 -- (-1053.182) [-1051.581] (-1048.933) (-1049.058) * (-1049.144) [-1049.328] (-1048.239) (-1049.599) -- 0:00:37
445000 -- (-1051.489) (-1048.633) (-1050.820) [-1050.641] * (-1049.707) (-1048.758) [-1048.213] (-1049.485) -- 0:00:37
Average standard deviation of split frequencies: 0.010903
445500 -- (-1050.943) [-1049.786] (-1049.004) (-1049.047) * (-1050.492) (-1051.647) [-1045.756] (-1048.626) -- 0:00:37
446000 -- (-1050.911) (-1049.049) (-1049.479) [-1050.267] * (-1051.608) (-1049.938) [-1046.575] (-1055.064) -- 0:00:37
446500 -- (-1051.950) (-1050.718) [-1051.016] (-1051.869) * (-1050.371) [-1048.270] (-1048.024) (-1051.924) -- 0:00:37
447000 -- [-1050.181] (-1052.128) (-1049.613) (-1051.137) * (-1048.923) (-1049.881) (-1050.027) [-1051.336] -- 0:00:37
447500 -- (-1049.717) [-1051.735] (-1049.732) (-1047.947) * (-1049.003) (-1050.647) [-1049.648] (-1050.078) -- 0:00:37
448000 -- [-1050.565] (-1049.562) (-1050.932) (-1050.843) * (-1051.961) (-1054.202) (-1049.691) [-1050.194] -- 0:00:36
448500 -- (-1049.807) (-1049.998) [-1049.465] (-1049.309) * [-1051.697] (-1051.467) (-1049.392) (-1051.121) -- 0:00:36
449000 -- (-1049.474) (-1050.281) (-1049.661) [-1050.015] * (-1051.159) (-1052.519) (-1051.853) [-1050.585] -- 0:00:36
449500 -- [-1050.436] (-1048.834) (-1050.098) (-1050.362) * [-1049.969] (-1048.475) (-1051.009) (-1051.377) -- 0:00:36
450000 -- (-1049.966) [-1050.840] (-1052.434) (-1050.315) * [-1050.023] (-1052.453) (-1048.515) (-1051.871) -- 0:00:36
Average standard deviation of split frequencies: 0.011066
450500 -- (-1049.591) (-1047.775) (-1053.229) [-1048.648] * (-1052.921) (-1051.975) [-1049.376] (-1051.260) -- 0:00:36
451000 -- (-1050.363) [-1050.550] (-1049.464) (-1045.841) * [-1048.523] (-1049.447) (-1048.687) (-1050.575) -- 0:00:36
451500 -- [-1051.038] (-1051.640) (-1049.439) (-1050.975) * (-1049.387) [-1048.992] (-1048.181) (-1048.574) -- 0:00:36
452000 -- [-1052.460] (-1049.642) (-1049.697) (-1048.995) * [-1050.289] (-1049.507) (-1048.582) (-1048.691) -- 0:00:36
452500 -- (-1050.988) (-1049.239) (-1049.487) [-1048.757] * (-1053.412) (-1049.233) (-1049.826) [-1048.500] -- 0:00:36
453000 -- [-1047.660] (-1051.072) (-1050.568) (-1053.535) * (-1049.896) [-1051.925] (-1052.271) (-1046.860) -- 0:00:36
453500 -- (-1048.604) [-1048.639] (-1051.999) (-1051.047) * (-1049.673) (-1050.730) (-1051.584) [-1047.970] -- 0:00:36
454000 -- [-1052.296] (-1048.471) (-1056.095) (-1054.601) * (-1050.708) (-1049.596) [-1046.747] (-1048.398) -- 0:00:36
454500 -- (-1049.948) [-1048.615] (-1049.377) (-1052.680) * [-1049.983] (-1049.397) (-1055.276) (-1049.584) -- 0:00:36
455000 -- (-1048.275) (-1048.439) (-1048.417) [-1050.256] * [-1048.972] (-1048.963) (-1047.712) (-1048.886) -- 0:00:35
Average standard deviation of split frequencies: 0.011426
455500 -- (-1051.600) [-1048.553] (-1048.765) (-1050.941) * (-1048.439) (-1048.696) [-1050.131] (-1050.252) -- 0:00:35
456000 -- (-1052.329) (-1051.757) (-1050.059) [-1052.505] * (-1050.196) (-1050.552) [-1050.666] (-1050.403) -- 0:00:35
456500 -- (-1053.832) (-1050.283) (-1050.149) [-1050.536] * (-1049.626) (-1049.557) [-1049.476] (-1051.082) -- 0:00:36
457000 -- (-1052.038) [-1047.455] (-1051.490) (-1053.282) * (-1048.435) (-1048.971) [-1049.927] (-1050.514) -- 0:00:36
457500 -- [-1050.469] (-1053.615) (-1051.636) (-1049.681) * [-1048.083] (-1052.256) (-1048.706) (-1049.668) -- 0:00:36
458000 -- (-1051.532) (-1052.268) (-1048.238) [-1050.542] * (-1048.322) [-1048.659] (-1051.788) (-1049.307) -- 0:00:36
458500 -- (-1049.930) (-1051.311) [-1048.604] (-1052.851) * (-1049.062) (-1048.953) [-1048.325] (-1049.554) -- 0:00:36
459000 -- (-1052.336) (-1051.247) [-1047.168] (-1050.493) * (-1050.996) (-1048.259) [-1045.806] (-1051.801) -- 0:00:36
459500 -- (-1049.639) [-1050.697] (-1049.537) (-1049.424) * (-1050.729) (-1048.936) [-1049.321] (-1054.403) -- 0:00:36
460000 -- (-1049.283) [-1050.289] (-1047.940) (-1048.873) * (-1050.904) (-1048.967) (-1049.192) [-1050.324] -- 0:00:36
Average standard deviation of split frequencies: 0.012166
460500 -- (-1048.876) [-1049.438] (-1049.256) (-1049.090) * (-1051.524) [-1052.043] (-1050.456) (-1049.840) -- 0:00:36
461000 -- (-1049.623) (-1048.957) [-1049.057] (-1050.550) * (-1051.355) (-1049.214) (-1051.535) [-1048.441] -- 0:00:36
461500 -- (-1051.375) (-1048.830) (-1051.239) [-1052.140] * (-1050.335) (-1049.523) (-1052.509) [-1049.451] -- 0:00:36
462000 -- (-1051.193) (-1049.849) (-1050.280) [-1050.575] * (-1049.788) (-1050.057) [-1051.286] (-1050.441) -- 0:00:36
462500 -- (-1049.033) (-1048.851) [-1049.768] (-1048.863) * (-1050.455) (-1050.375) (-1051.077) [-1048.486] -- 0:00:36
463000 -- (-1049.357) (-1048.507) [-1051.500] (-1049.120) * [-1050.812] (-1049.090) (-1047.920) (-1052.592) -- 0:00:35
463500 -- (-1049.747) [-1049.720] (-1050.347) (-1049.949) * [-1050.254] (-1047.738) (-1050.677) (-1050.697) -- 0:00:35
464000 -- (-1050.431) [-1048.671] (-1047.937) (-1046.624) * (-1049.762) [-1046.747] (-1049.671) (-1051.485) -- 0:00:35
464500 -- [-1048.097] (-1048.488) (-1058.515) (-1049.377) * (-1050.129) (-1047.371) [-1048.953] (-1049.266) -- 0:00:35
465000 -- (-1048.879) [-1048.576] (-1051.035) (-1049.311) * (-1049.823) [-1045.613] (-1051.065) (-1055.918) -- 0:00:35
Average standard deviation of split frequencies: 0.011287
465500 -- (-1048.611) (-1049.286) [-1052.312] (-1051.192) * (-1051.375) [-1047.375] (-1054.043) (-1051.766) -- 0:00:35
466000 -- [-1052.232] (-1049.570) (-1050.096) (-1047.897) * (-1053.169) [-1047.740] (-1050.011) (-1051.672) -- 0:00:35
466500 -- (-1051.619) [-1051.101] (-1053.716) (-1050.249) * (-1048.806) (-1049.985) (-1049.296) [-1051.731] -- 0:00:35
467000 -- (-1048.420) [-1047.567] (-1051.093) (-1049.218) * [-1051.770] (-1048.143) (-1051.018) (-1050.998) -- 0:00:35
467500 -- [-1049.215] (-1049.951) (-1049.020) (-1048.671) * [-1048.784] (-1047.992) (-1049.106) (-1049.122) -- 0:00:35
468000 -- (-1053.326) [-1052.591] (-1051.389) (-1049.447) * (-1051.179) (-1045.829) (-1051.667) [-1048.785] -- 0:00:35
468500 -- (-1054.618) (-1049.886) [-1048.435] (-1048.762) * [-1056.586] (-1048.066) (-1052.356) (-1051.938) -- 0:00:35
469000 -- [-1050.293] (-1049.197) (-1050.934) (-1048.327) * (-1055.835) [-1047.681] (-1048.617) (-1049.439) -- 0:00:35
469500 -- (-1051.133) [-1049.490] (-1050.511) (-1049.937) * (-1049.310) (-1049.311) (-1048.991) [-1049.499] -- 0:00:35
470000 -- (-1052.686) (-1049.840) [-1051.220] (-1050.319) * [-1048.872] (-1049.583) (-1048.476) (-1048.881) -- 0:00:34
Average standard deviation of split frequencies: 0.010912
470500 -- (-1052.785) (-1052.781) (-1045.630) [-1049.510] * (-1052.033) (-1048.457) (-1049.033) [-1047.693] -- 0:00:34
471000 -- [-1049.798] (-1050.632) (-1048.522) (-1051.020) * (-1050.453) (-1048.038) [-1049.262] (-1051.249) -- 0:00:34
471500 -- (-1049.145) (-1050.021) [-1049.134] (-1048.887) * (-1050.303) [-1047.821] (-1048.266) (-1049.850) -- 0:00:35
472000 -- (-1051.767) (-1052.041) (-1047.692) [-1049.418] * [-1048.975] (-1048.164) (-1048.536) (-1050.006) -- 0:00:35
472500 -- (-1052.040) (-1050.753) (-1049.850) [-1048.753] * (-1050.807) [-1047.569] (-1049.857) (-1048.568) -- 0:00:35
473000 -- (-1051.528) [-1051.930] (-1051.780) (-1049.795) * [-1053.940] (-1046.245) (-1049.408) (-1049.530) -- 0:00:35
473500 -- [-1051.703] (-1051.763) (-1046.739) (-1049.180) * (-1049.875) (-1048.860) [-1050.825] (-1047.946) -- 0:00:35
474000 -- (-1048.913) (-1048.839) [-1050.226] (-1052.684) * (-1051.871) (-1049.557) (-1051.366) [-1048.611] -- 0:00:35
474500 -- [-1048.911] (-1049.752) (-1046.803) (-1050.201) * (-1049.910) (-1049.328) (-1051.800) [-1050.522] -- 0:00:35
475000 -- (-1051.414) (-1052.564) [-1048.429] (-1050.098) * (-1048.797) (-1049.752) (-1049.103) [-1050.240] -- 0:00:35
Average standard deviation of split frequencies: 0.010946
475500 -- (-1050.890) [-1050.216] (-1048.511) (-1051.213) * (-1049.293) (-1047.383) (-1049.481) [-1049.765] -- 0:00:35
476000 -- [-1048.756] (-1050.093) (-1049.364) (-1049.077) * [-1049.530] (-1049.467) (-1048.842) (-1055.242) -- 0:00:35
476500 -- (-1050.164) (-1048.721) (-1048.485) [-1047.474] * (-1051.371) (-1049.380) [-1049.324] (-1050.622) -- 0:00:35
477000 -- (-1048.183) (-1050.820) [-1049.217] (-1049.040) * (-1052.172) (-1049.142) [-1050.214] (-1048.594) -- 0:00:35
477500 -- (-1050.522) (-1049.709) (-1050.950) [-1050.806] * (-1048.419) (-1051.645) [-1050.233] (-1048.946) -- 0:00:35
478000 -- (-1050.138) (-1049.772) (-1050.038) [-1050.698] * (-1049.670) [-1049.532] (-1049.155) (-1049.402) -- 0:00:34
478500 -- (-1048.476) (-1052.865) (-1051.928) [-1047.003] * (-1051.308) (-1051.118) [-1053.893] (-1049.591) -- 0:00:34
479000 -- (-1050.241) [-1048.856] (-1051.143) (-1049.269) * (-1050.425) (-1047.500) [-1049.913] (-1050.505) -- 0:00:34
479500 -- [-1048.310] (-1052.794) (-1048.504) (-1050.266) * (-1049.892) [-1049.990] (-1053.802) (-1050.861) -- 0:00:34
480000 -- (-1046.481) [-1049.001] (-1051.165) (-1052.714) * (-1049.176) (-1049.062) [-1049.602] (-1052.296) -- 0:00:34
Average standard deviation of split frequencies: 0.010788
480500 -- [-1049.378] (-1049.796) (-1048.668) (-1052.300) * (-1049.234) (-1048.997) [-1047.641] (-1056.118) -- 0:00:34
481000 -- [-1045.922] (-1049.367) (-1053.011) (-1053.201) * [-1051.131] (-1048.724) (-1049.140) (-1054.113) -- 0:00:34
481500 -- (-1047.549) (-1048.670) [-1052.249] (-1052.659) * (-1050.899) [-1049.242] (-1048.432) (-1050.748) -- 0:00:34
482000 -- [-1048.756] (-1050.206) (-1051.075) (-1049.330) * (-1048.554) (-1048.870) (-1050.424) [-1048.182] -- 0:00:34
482500 -- [-1050.032] (-1050.024) (-1051.025) (-1047.718) * (-1048.343) (-1054.152) [-1049.710] (-1050.116) -- 0:00:34
483000 -- (-1050.583) [-1050.274] (-1050.420) (-1049.991) * [-1049.766] (-1048.550) (-1048.966) (-1053.774) -- 0:00:34
483500 -- (-1046.547) (-1050.073) [-1049.414] (-1050.822) * [-1048.270] (-1047.655) (-1049.610) (-1051.103) -- 0:00:34
484000 -- (-1050.642) (-1051.587) [-1049.640] (-1047.776) * (-1049.865) (-1049.040) (-1049.550) [-1053.369] -- 0:00:34
484500 -- (-1049.565) (-1049.892) (-1049.330) [-1046.734] * (-1054.728) (-1050.749) [-1052.376] (-1050.993) -- 0:00:34
485000 -- (-1047.150) [-1048.893] (-1048.178) (-1050.530) * (-1049.963) (-1051.754) (-1050.172) [-1048.719] -- 0:00:33
Average standard deviation of split frequencies: 0.009444
485500 -- (-1050.564) (-1050.010) [-1048.507] (-1051.019) * (-1052.508) (-1054.041) (-1050.313) [-1049.489] -- 0:00:33
486000 -- (-1051.322) (-1048.529) [-1053.786] (-1045.745) * (-1051.699) [-1050.684] (-1055.216) (-1057.706) -- 0:00:33
486500 -- [-1046.654] (-1048.320) (-1048.652) (-1052.067) * [-1051.839] (-1049.576) (-1050.211) (-1052.420) -- 0:00:33
487000 -- (-1050.889) (-1048.500) [-1050.656] (-1052.848) * (-1048.893) (-1048.864) [-1046.463] (-1049.620) -- 0:00:34
487500 -- [-1052.115] (-1050.319) (-1050.268) (-1048.571) * [-1052.212] (-1050.048) (-1051.216) (-1049.019) -- 0:00:34
488000 -- (-1052.419) [-1048.981] (-1052.224) (-1049.043) * (-1048.608) [-1051.020] (-1051.502) (-1049.282) -- 0:00:34
488500 -- [-1051.469] (-1053.140) (-1051.354) (-1050.629) * (-1049.421) (-1050.116) [-1050.307] (-1050.146) -- 0:00:34
489000 -- (-1051.048) (-1049.842) [-1049.293] (-1050.705) * (-1049.117) (-1049.391) (-1048.167) [-1050.541] -- 0:00:34
489500 -- [-1052.769] (-1049.112) (-1048.934) (-1051.116) * (-1051.401) [-1047.119] (-1051.585) (-1054.306) -- 0:00:34
490000 -- [-1050.305] (-1051.662) (-1050.351) (-1049.590) * (-1050.383) (-1048.667) [-1053.428] (-1050.062) -- 0:00:34
Average standard deviation of split frequencies: 0.008900
490500 -- (-1054.658) [-1048.804] (-1055.010) (-1047.417) * [-1048.816] (-1048.420) (-1050.547) (-1048.892) -- 0:00:34
491000 -- (-1051.514) [-1049.527] (-1053.868) (-1050.229) * (-1054.304) (-1048.936) (-1050.535) [-1050.747] -- 0:00:34
491500 -- [-1052.772] (-1048.524) (-1051.793) (-1049.123) * (-1051.058) (-1048.271) (-1050.290) [-1050.030] -- 0:00:34
492000 -- (-1051.155) [-1049.687] (-1050.299) (-1052.290) * (-1048.734) [-1046.439] (-1047.664) (-1051.345) -- 0:00:34
492500 -- [-1049.483] (-1048.449) (-1050.031) (-1049.109) * (-1049.900) [-1048.637] (-1049.277) (-1053.101) -- 0:00:34
493000 -- (-1048.986) (-1053.778) (-1049.746) [-1047.735] * (-1049.010) (-1048.263) [-1047.000] (-1050.462) -- 0:00:33
493500 -- (-1053.506) (-1050.258) (-1049.209) [-1048.969] * (-1051.128) [-1049.654] (-1050.186) (-1049.816) -- 0:00:33
494000 -- (-1052.056) (-1051.344) (-1048.999) [-1049.916] * (-1050.745) [-1046.082] (-1048.961) (-1048.585) -- 0:00:33
494500 -- (-1048.600) (-1051.189) [-1048.250] (-1046.876) * (-1049.945) [-1048.674] (-1050.341) (-1049.827) -- 0:00:33
495000 -- (-1049.970) [-1049.342] (-1050.258) (-1048.500) * [-1051.711] (-1045.800) (-1052.096) (-1049.641) -- 0:00:33
Average standard deviation of split frequencies: 0.009504
495500 -- (-1050.694) [-1049.291] (-1050.359) (-1051.366) * (-1050.878) (-1046.643) [-1052.708] (-1054.329) -- 0:00:33
496000 -- (-1049.493) (-1048.966) (-1051.147) [-1049.522] * [-1048.814] (-1050.109) (-1051.114) (-1049.869) -- 0:00:33
496500 -- [-1050.468] (-1050.528) (-1053.738) (-1047.157) * [-1049.292] (-1048.470) (-1049.256) (-1049.894) -- 0:00:33
497000 -- (-1048.811) (-1048.691) [-1050.412] (-1050.687) * (-1052.125) (-1049.233) (-1051.154) [-1045.686] -- 0:00:33
497500 -- [-1053.424] (-1048.719) (-1051.404) (-1051.079) * [-1052.416] (-1047.818) (-1049.683) (-1047.582) -- 0:00:33
498000 -- [-1051.571] (-1052.979) (-1051.593) (-1051.577) * (-1050.150) [-1046.635] (-1049.714) (-1050.326) -- 0:00:33
498500 -- (-1050.928) (-1049.817) (-1049.065) [-1049.153] * [-1049.180] (-1047.068) (-1049.729) (-1050.757) -- 0:00:33
499000 -- [-1050.124] (-1048.654) (-1049.393) (-1049.141) * (-1049.056) (-1048.356) (-1050.903) [-1051.044] -- 0:00:33
499500 -- (-1052.338) (-1052.337) (-1048.446) [-1050.297] * (-1052.604) (-1048.348) (-1050.209) [-1059.667] -- 0:00:33
500000 -- (-1049.605) [-1050.671] (-1049.309) (-1053.581) * (-1052.715) [-1049.220] (-1056.343) (-1048.340) -- 0:00:33
Average standard deviation of split frequencies: 0.010252
500500 -- [-1049.489] (-1052.443) (-1049.152) (-1050.190) * (-1051.353) (-1049.598) (-1055.627) [-1047.708] -- 0:00:32
501000 -- (-1050.033) (-1053.546) [-1050.117] (-1046.926) * (-1050.264) [-1049.679] (-1050.005) (-1050.192) -- 0:00:32
501500 -- (-1051.246) (-1053.539) (-1049.491) [-1053.377] * (-1049.441) (-1049.391) [-1049.129] (-1050.561) -- 0:00:32
502000 -- (-1050.184) [-1048.161] (-1048.364) (-1049.816) * [-1049.823] (-1046.616) (-1048.305) (-1054.306) -- 0:00:33
502500 -- (-1055.477) (-1051.748) (-1051.825) [-1048.864] * [-1046.428] (-1048.831) (-1050.305) (-1051.052) -- 0:00:33
503000 -- [-1048.112] (-1051.079) (-1047.758) (-1049.082) * (-1049.411) (-1048.903) (-1053.092) [-1049.290] -- 0:00:33
503500 -- (-1053.062) [-1050.490] (-1049.283) (-1048.702) * (-1054.080) [-1047.167] (-1053.346) (-1048.419) -- 0:00:33
504000 -- [-1052.019] (-1050.270) (-1049.189) (-1050.554) * (-1054.536) (-1047.466) (-1049.793) [-1049.270] -- 0:00:33
504500 -- [-1050.722] (-1050.179) (-1051.505) (-1049.608) * (-1051.768) (-1047.488) [-1048.351] (-1049.136) -- 0:00:33
505000 -- (-1049.975) [-1049.627] (-1049.684) (-1047.923) * (-1049.795) (-1050.092) (-1050.000) [-1048.251] -- 0:00:33
Average standard deviation of split frequencies: 0.009267
505500 -- [-1050.297] (-1048.866) (-1051.302) (-1049.699) * (-1050.012) (-1049.107) [-1047.980] (-1052.437) -- 0:00:33
506000 -- [-1049.149] (-1049.915) (-1048.566) (-1050.685) * (-1051.064) (-1047.008) [-1049.336] (-1048.258) -- 0:00:33
506500 -- [-1050.633] (-1050.714) (-1051.309) (-1050.091) * (-1051.894) (-1048.976) [-1049.597] (-1050.485) -- 0:00:33
507000 -- (-1049.889) (-1050.314) (-1049.051) [-1048.930] * (-1048.279) (-1047.520) (-1049.428) [-1049.894] -- 0:00:33
507500 -- (-1053.005) (-1052.827) (-1049.193) [-1048.454] * (-1048.391) [-1050.774] (-1050.086) (-1051.420) -- 0:00:32
508000 -- (-1050.607) (-1049.574) [-1048.908] (-1048.723) * [-1047.887] (-1048.676) (-1049.545) (-1053.294) -- 0:00:32
508500 -- (-1051.115) [-1048.278] (-1049.800) (-1051.759) * [-1049.249] (-1049.478) (-1050.483) (-1050.713) -- 0:00:32
509000 -- (-1051.567) (-1048.640) [-1046.861] (-1053.448) * (-1049.113) (-1048.226) (-1050.237) [-1051.695] -- 0:00:32
509500 -- (-1048.321) (-1052.213) (-1051.118) [-1050.775] * (-1048.792) (-1047.888) (-1049.712) [-1051.648] -- 0:00:32
510000 -- (-1049.077) [-1049.443] (-1048.009) (-1048.327) * (-1050.559) [-1047.973] (-1050.429) (-1050.036) -- 0:00:32
Average standard deviation of split frequencies: 0.009183
510500 -- [-1047.838] (-1049.252) (-1048.857) (-1050.875) * (-1047.338) (-1053.122) (-1051.756) [-1049.316] -- 0:00:32
511000 -- (-1049.356) (-1049.354) [-1049.031] (-1050.370) * (-1049.391) [-1049.113] (-1048.896) (-1048.305) -- 0:00:32
511500 -- (-1049.001) (-1051.385) [-1056.091] (-1051.408) * [-1048.251] (-1048.149) (-1050.328) (-1048.874) -- 0:00:32
512000 -- (-1050.689) (-1051.051) (-1052.790) [-1050.039] * (-1050.206) (-1050.741) [-1048.322] (-1050.689) -- 0:00:32
512500 -- [-1051.333] (-1048.984) (-1058.794) (-1050.756) * (-1051.266) (-1044.622) [-1050.335] (-1049.780) -- 0:00:32
513000 -- (-1049.650) (-1054.115) (-1049.869) [-1048.136] * [-1049.241] (-1056.609) (-1050.701) (-1050.129) -- 0:00:32
513500 -- (-1047.556) (-1049.700) (-1049.565) [-1048.951] * [-1051.256] (-1049.598) (-1051.229) (-1051.788) -- 0:00:32
514000 -- (-1051.165) (-1050.213) (-1050.120) [-1051.140] * [-1048.643] (-1049.775) (-1053.736) (-1051.571) -- 0:00:32
514500 -- (-1053.043) (-1049.654) [-1051.154] (-1049.931) * (-1050.210) [-1048.036] (-1054.843) (-1051.613) -- 0:00:32
515000 -- [-1051.967] (-1050.460) (-1051.837) (-1051.248) * (-1049.349) [-1046.781] (-1052.049) (-1051.255) -- 0:00:32
Average standard deviation of split frequencies: 0.008847
515500 -- (-1049.776) (-1053.082) [-1052.120] (-1049.760) * (-1049.610) (-1050.206) [-1049.051] (-1048.597) -- 0:00:31
516000 -- (-1048.605) (-1050.403) [-1049.186] (-1050.698) * (-1051.275) (-1048.409) [-1050.209] (-1051.315) -- 0:00:31
516500 -- [-1049.164] (-1048.890) (-1050.375) (-1049.563) * [-1048.383] (-1049.624) (-1049.278) (-1048.683) -- 0:00:31
517000 -- (-1055.069) (-1050.336) (-1050.010) [-1050.486] * (-1050.143) (-1047.537) (-1051.238) [-1050.921] -- 0:00:32
517500 -- [-1051.920] (-1048.374) (-1048.518) (-1052.435) * [-1048.922] (-1046.535) (-1051.181) (-1049.346) -- 0:00:32
518000 -- (-1048.571) (-1047.898) [-1047.311] (-1048.501) * [-1050.508] (-1049.728) (-1048.034) (-1050.104) -- 0:00:32
518500 -- (-1049.056) [-1048.677] (-1053.275) (-1049.482) * (-1051.537) (-1049.802) (-1047.531) [-1051.919] -- 0:00:32
519000 -- (-1048.658) (-1050.843) (-1048.797) [-1049.444] * [-1048.044] (-1050.181) (-1048.182) (-1048.893) -- 0:00:32
519500 -- (-1050.909) (-1048.299) [-1049.101] (-1048.960) * (-1048.943) (-1048.968) [-1048.997] (-1050.643) -- 0:00:32
520000 -- (-1049.647) [-1049.672] (-1050.425) (-1048.154) * (-1050.339) (-1051.392) (-1053.002) [-1051.192] -- 0:00:32
Average standard deviation of split frequencies: 0.008863
520500 -- [-1047.353] (-1048.877) (-1047.823) (-1049.503) * (-1051.987) [-1049.248] (-1054.001) (-1049.396) -- 0:00:32
521000 -- (-1054.170) (-1050.245) [-1047.496] (-1048.673) * (-1050.884) (-1049.459) [-1049.529] (-1048.074) -- 0:00:32
521500 -- (-1052.393) [-1050.184] (-1049.376) (-1051.132) * (-1049.844) (-1048.912) (-1051.083) [-1047.895] -- 0:00:32
522000 -- [-1051.067] (-1049.910) (-1052.323) (-1052.669) * (-1050.733) [-1047.455] (-1047.972) (-1046.915) -- 0:00:32
522500 -- (-1050.698) (-1050.453) [-1049.344] (-1051.167) * (-1050.981) [-1049.291] (-1046.991) (-1053.072) -- 0:00:31
523000 -- (-1052.897) (-1048.469) [-1048.478] (-1050.122) * [-1049.667] (-1048.505) (-1049.643) (-1049.592) -- 0:00:31
523500 -- (-1049.305) (-1052.984) (-1049.050) [-1048.446] * [-1049.308] (-1050.039) (-1049.765) (-1050.288) -- 0:00:31
524000 -- [-1049.892] (-1048.980) (-1049.768) (-1051.714) * [-1052.583] (-1051.850) (-1049.151) (-1051.455) -- 0:00:31
524500 -- [-1049.861] (-1054.008) (-1049.496) (-1050.082) * (-1051.089) (-1048.982) (-1049.955) [-1051.012] -- 0:00:31
525000 -- (-1055.078) (-1050.826) (-1052.642) [-1050.462] * (-1049.205) [-1048.822] (-1049.666) (-1049.165) -- 0:00:31
Average standard deviation of split frequencies: 0.008632
525500 -- [-1049.485] (-1051.497) (-1049.579) (-1049.251) * (-1049.500) [-1047.519] (-1049.532) (-1052.564) -- 0:00:31
526000 -- (-1048.365) (-1049.249) [-1047.473] (-1049.984) * (-1052.285) (-1053.127) (-1048.545) [-1050.361] -- 0:00:31
526500 -- [-1047.881] (-1050.401) (-1049.423) (-1051.002) * (-1050.985) (-1049.680) [-1051.057] (-1050.205) -- 0:00:31
527000 -- [-1047.787] (-1050.022) (-1053.555) (-1055.019) * (-1050.717) (-1047.433) (-1050.571) [-1050.786] -- 0:00:31
527500 -- (-1048.154) (-1052.005) [-1048.288] (-1051.780) * (-1050.970) (-1048.570) (-1051.566) [-1048.862] -- 0:00:31
528000 -- [-1048.742] (-1052.975) (-1048.738) (-1049.406) * (-1049.518) (-1054.844) (-1049.103) [-1046.420] -- 0:00:31
528500 -- (-1051.383) [-1048.881] (-1049.094) (-1050.858) * [-1050.319] (-1051.144) (-1051.142) (-1050.879) -- 0:00:31
529000 -- [-1052.478] (-1053.415) (-1049.106) (-1049.785) * [-1048.852] (-1052.640) (-1053.720) (-1048.929) -- 0:00:31
529500 -- (-1051.331) [-1051.938] (-1050.364) (-1051.711) * (-1050.628) [-1047.026] (-1051.168) (-1049.719) -- 0:00:31
530000 -- [-1048.725] (-1052.100) (-1055.684) (-1049.934) * [-1051.510] (-1048.792) (-1051.438) (-1053.019) -- 0:00:31
Average standard deviation of split frequencies: 0.009070
530500 -- [-1048.538] (-1053.482) (-1049.488) (-1050.799) * (-1049.570) [-1049.640] (-1049.354) (-1050.174) -- 0:00:30
531000 -- (-1051.499) [-1050.291] (-1050.159) (-1051.953) * (-1049.015) (-1049.576) [-1049.125] (-1048.816) -- 0:00:30
531500 -- (-1050.010) (-1051.222) (-1051.037) [-1050.975] * (-1050.502) (-1053.493) (-1049.719) [-1049.218] -- 0:00:30
532000 -- (-1049.571) (-1048.594) [-1049.390] (-1050.069) * (-1049.792) (-1048.136) (-1051.693) [-1050.556] -- 0:00:31
532500 -- (-1048.901) [-1048.978] (-1050.517) (-1046.816) * [-1047.103] (-1046.402) (-1045.966) (-1049.487) -- 0:00:31
533000 -- [-1050.713] (-1050.670) (-1049.756) (-1051.012) * (-1047.008) (-1050.357) (-1049.685) [-1050.108] -- 0:00:31
533500 -- (-1050.274) (-1050.686) [-1048.748] (-1049.152) * (-1051.900) [-1048.218] (-1049.286) (-1050.702) -- 0:00:31
534000 -- (-1051.870) (-1050.486) [-1049.517] (-1049.817) * (-1048.570) (-1052.812) (-1049.524) [-1049.849] -- 0:00:31
534500 -- (-1050.482) [-1048.838] (-1055.150) (-1047.735) * (-1050.626) (-1054.713) (-1049.180) [-1049.165] -- 0:00:31
535000 -- (-1052.421) (-1048.378) [-1052.651] (-1050.714) * (-1053.537) (-1047.388) (-1049.329) [-1048.841] -- 0:00:31
Average standard deviation of split frequencies: 0.009073
535500 -- (-1049.156) (-1049.910) [-1052.620] (-1049.097) * (-1052.203) (-1049.118) [-1049.140] (-1049.735) -- 0:00:31
536000 -- (-1053.270) [-1049.066] (-1049.485) (-1052.118) * (-1050.343) [-1047.966] (-1047.914) (-1049.487) -- 0:00:31
536500 -- [-1047.740] (-1049.191) (-1050.077) (-1057.518) * (-1050.821) (-1050.409) (-1047.332) [-1049.455] -- 0:00:31
537000 -- (-1049.916) [-1046.804] (-1050.961) (-1051.994) * (-1051.500) (-1049.282) [-1047.892] (-1048.158) -- 0:00:31
537500 -- (-1049.196) (-1050.504) (-1049.174) [-1049.113] * (-1051.487) (-1051.797) (-1055.667) [-1049.798] -- 0:00:30
538000 -- [-1050.242] (-1046.858) (-1049.758) (-1048.374) * (-1050.569) (-1051.509) [-1048.713] (-1048.122) -- 0:00:30
538500 -- (-1051.793) (-1050.138) [-1047.845] (-1049.652) * (-1048.944) [-1046.910] (-1046.090) (-1049.873) -- 0:00:30
539000 -- (-1049.894) (-1052.638) [-1049.035] (-1050.220) * (-1051.347) [-1049.769] (-1052.278) (-1051.088) -- 0:00:30
539500 -- (-1049.468) [-1051.054] (-1047.585) (-1050.389) * [-1047.581] (-1048.924) (-1048.753) (-1049.708) -- 0:00:30
540000 -- (-1052.462) [-1044.372] (-1049.504) (-1050.333) * (-1047.060) [-1048.960] (-1048.869) (-1048.407) -- 0:00:30
Average standard deviation of split frequencies: 0.008765
540500 -- (-1055.892) (-1048.922) [-1048.418] (-1047.108) * [-1050.964] (-1049.096) (-1049.678) (-1049.591) -- 0:00:30
541000 -- (-1049.688) (-1049.170) (-1050.071) [-1049.583] * [-1050.033] (-1050.268) (-1047.064) (-1048.317) -- 0:00:30
541500 -- [-1049.068] (-1048.654) (-1050.579) (-1060.082) * (-1050.819) [-1048.951] (-1048.263) (-1047.777) -- 0:00:30
542000 -- (-1051.194) (-1049.205) [-1048.629] (-1051.530) * [-1050.517] (-1049.724) (-1049.620) (-1054.038) -- 0:00:30
542500 -- [-1053.663] (-1048.550) (-1050.077) (-1049.309) * (-1054.020) [-1050.003] (-1049.372) (-1049.820) -- 0:00:30
543000 -- (-1053.503) (-1052.887) [-1047.837] (-1050.277) * [-1051.762] (-1047.171) (-1048.005) (-1047.789) -- 0:00:30
543500 -- (-1049.963) (-1048.467) [-1047.135] (-1049.357) * (-1049.706) [-1048.270] (-1048.969) (-1050.808) -- 0:00:30
544000 -- (-1050.070) [-1050.882] (-1048.908) (-1048.587) * [-1050.552] (-1053.595) (-1049.249) (-1049.790) -- 0:00:30
544500 -- (-1049.924) (-1049.769) [-1050.779] (-1050.010) * [-1049.460] (-1051.117) (-1047.519) (-1053.870) -- 0:00:30
545000 -- [-1047.917] (-1051.406) (-1048.096) (-1047.894) * (-1049.204) (-1052.541) [-1050.895] (-1050.405) -- 0:00:30
Average standard deviation of split frequencies: 0.009179
545500 -- (-1049.084) (-1051.667) [-1049.257] (-1051.509) * (-1048.301) (-1050.616) [-1051.315] (-1048.897) -- 0:00:29
546000 -- (-1048.725) (-1051.144) [-1048.743] (-1047.762) * (-1049.051) (-1053.265) (-1050.862) [-1048.858] -- 0:00:29
546500 -- (-1052.499) (-1052.894) (-1050.224) [-1053.691] * (-1049.289) (-1050.438) (-1053.549) [-1048.113] -- 0:00:29
547000 -- (-1047.388) [-1047.117] (-1049.155) (-1052.026) * (-1048.507) (-1048.357) (-1048.712) [-1050.935] -- 0:00:29
547500 -- (-1048.559) (-1049.881) (-1050.801) [-1050.801] * (-1052.444) (-1049.056) (-1052.509) [-1050.093] -- 0:00:30
548000 -- (-1049.655) [-1050.685] (-1049.346) (-1048.670) * (-1049.923) (-1051.988) (-1049.353) [-1049.604] -- 0:00:30
548500 -- (-1049.132) (-1049.745) (-1048.400) [-1050.006] * (-1052.987) [-1051.313] (-1049.538) (-1048.999) -- 0:00:30
549000 -- (-1048.560) [-1054.220] (-1049.069) (-1049.345) * [-1047.475] (-1053.317) (-1048.188) (-1048.303) -- 0:00:30
549500 -- [-1045.245] (-1053.147) (-1051.315) (-1050.666) * (-1050.559) (-1054.507) (-1050.294) [-1048.465] -- 0:00:30
550000 -- [-1046.922] (-1051.085) (-1047.234) (-1052.185) * (-1051.220) [-1051.522] (-1048.548) (-1048.727) -- 0:00:30
Average standard deviation of split frequencies: 0.009146
550500 -- (-1049.573) (-1048.423) [-1046.246] (-1048.470) * (-1048.998) (-1050.077) (-1049.718) [-1047.564] -- 0:00:30
551000 -- (-1048.980) (-1049.737) (-1050.924) [-1047.327] * (-1051.199) (-1052.509) (-1052.357) [-1050.980] -- 0:00:30
551500 -- (-1047.358) (-1053.025) (-1049.084) [-1049.645] * [-1049.149] (-1049.243) (-1053.319) (-1053.163) -- 0:00:30
552000 -- (-1050.144) (-1052.545) [-1049.029] (-1051.287) * (-1048.471) (-1048.673) [-1053.156] (-1052.034) -- 0:00:30
552500 -- (-1050.686) (-1053.176) (-1048.416) [-1049.108] * (-1048.490) (-1051.654) [-1048.609] (-1050.911) -- 0:00:29
553000 -- (-1049.445) (-1049.116) [-1048.541] (-1050.082) * [-1047.740] (-1049.229) (-1052.231) (-1048.268) -- 0:00:29
553500 -- (-1051.074) (-1051.221) (-1048.251) [-1049.664] * (-1046.991) [-1049.095] (-1052.121) (-1050.266) -- 0:00:29
554000 -- (-1052.014) [-1050.784] (-1048.162) (-1049.370) * (-1047.668) [-1048.408] (-1051.110) (-1049.422) -- 0:00:29
554500 -- [-1048.537] (-1049.490) (-1050.962) (-1048.431) * [-1048.179] (-1050.932) (-1050.945) (-1050.849) -- 0:00:29
555000 -- (-1048.964) (-1051.480) [-1051.436] (-1051.241) * (-1053.097) [-1048.888] (-1048.492) (-1052.952) -- 0:00:29
Average standard deviation of split frequencies: 0.008702
555500 -- [-1050.634] (-1049.382) (-1049.020) (-1048.573) * (-1048.608) (-1049.190) [-1050.443] (-1055.234) -- 0:00:29
556000 -- (-1052.863) (-1050.529) (-1048.551) [-1049.695] * (-1051.205) (-1048.963) (-1048.545) [-1051.361] -- 0:00:29
556500 -- [-1049.379] (-1049.942) (-1048.029) (-1049.589) * (-1052.452) (-1051.800) [-1049.328] (-1053.204) -- 0:00:29
557000 -- (-1051.630) [-1049.513] (-1045.911) (-1051.624) * (-1050.713) (-1048.597) [-1049.242] (-1051.992) -- 0:00:29
557500 -- [-1047.456] (-1048.995) (-1047.425) (-1051.220) * [-1051.238] (-1049.024) (-1048.744) (-1055.399) -- 0:00:29
558000 -- (-1050.298) [-1048.146] (-1052.262) (-1052.029) * [-1054.687] (-1050.317) (-1048.991) (-1048.354) -- 0:00:29
558500 -- (-1048.965) (-1050.600) [-1047.572] (-1050.000) * (-1055.206) [-1052.625] (-1052.394) (-1049.768) -- 0:00:29
559000 -- (-1049.465) (-1049.002) [-1047.824] (-1048.483) * (-1048.592) [-1049.278] (-1049.469) (-1050.926) -- 0:00:29
559500 -- [-1048.467] (-1053.354) (-1050.397) (-1055.917) * [-1048.842] (-1054.088) (-1048.679) (-1053.838) -- 0:00:29
560000 -- [-1047.804] (-1050.278) (-1052.716) (-1051.715) * [-1049.944] (-1055.153) (-1050.363) (-1051.423) -- 0:00:29
Average standard deviation of split frequencies: 0.008275
560500 -- (-1049.185) (-1048.990) [-1048.850] (-1047.361) * (-1050.959) (-1052.136) [-1049.474] (-1051.547) -- 0:00:29
561000 -- (-1050.458) (-1050.614) [-1051.423] (-1046.827) * (-1049.801) (-1052.656) [-1049.137] (-1050.226) -- 0:00:28
561500 -- (-1051.226) (-1049.969) [-1050.536] (-1050.590) * [-1049.234] (-1050.213) (-1051.393) (-1049.775) -- 0:00:28
562000 -- [-1048.697] (-1053.241) (-1051.043) (-1048.616) * (-1050.030) (-1051.410) [-1050.654] (-1059.633) -- 0:00:28
562500 -- (-1051.110) (-1050.878) [-1048.527] (-1049.566) * [-1050.791] (-1048.896) (-1049.235) (-1048.957) -- 0:00:29
563000 -- [-1049.430] (-1051.037) (-1051.600) (-1053.232) * (-1049.725) (-1048.360) (-1049.600) [-1053.564] -- 0:00:29
563500 -- [-1050.059] (-1048.206) (-1050.808) (-1050.040) * (-1049.293) [-1048.743] (-1048.212) (-1051.005) -- 0:00:29
564000 -- [-1053.149] (-1049.012) (-1050.505) (-1049.550) * (-1049.710) (-1051.203) (-1050.538) [-1049.396] -- 0:00:29
564500 -- [-1050.652] (-1050.170) (-1049.562) (-1050.529) * (-1050.244) (-1051.135) (-1056.948) [-1048.605] -- 0:00:29
565000 -- (-1051.110) (-1052.029) [-1049.801] (-1050.405) * (-1052.256) (-1051.779) [-1049.339] (-1049.584) -- 0:00:29
Average standard deviation of split frequencies: 0.008723
565500 -- [-1051.338] (-1051.412) (-1048.423) (-1050.783) * [-1048.378] (-1049.637) (-1049.943) (-1050.091) -- 0:00:29
566000 -- (-1049.823) (-1050.672) [-1048.781] (-1051.155) * (-1048.772) (-1049.975) (-1049.258) [-1049.614] -- 0:00:29
566500 -- [-1046.009] (-1050.487) (-1050.379) (-1049.415) * (-1049.234) [-1049.471] (-1048.985) (-1050.624) -- 0:00:29
567000 -- (-1049.856) (-1050.111) (-1048.883) [-1050.027] * (-1049.823) (-1048.451) [-1049.036] (-1049.296) -- 0:00:29
567500 -- [-1048.559] (-1049.667) (-1051.083) (-1053.838) * (-1053.946) (-1049.763) (-1051.185) [-1050.234] -- 0:00:28
568000 -- (-1049.651) [-1050.559] (-1051.215) (-1049.985) * (-1049.085) [-1050.800] (-1052.232) (-1049.217) -- 0:00:28
568500 -- (-1049.587) (-1050.971) [-1047.906] (-1046.983) * (-1051.119) (-1050.753) (-1054.604) [-1048.498] -- 0:00:28
569000 -- [-1049.558] (-1053.268) (-1049.668) (-1051.256) * [-1048.197] (-1053.922) (-1048.593) (-1048.884) -- 0:00:28
569500 -- (-1049.363) [-1049.537] (-1051.262) (-1048.520) * (-1052.259) (-1052.200) (-1049.248) [-1050.560] -- 0:00:28
570000 -- (-1049.208) [-1050.884] (-1050.428) (-1049.788) * (-1051.192) (-1054.173) (-1049.455) [-1050.778] -- 0:00:28
Average standard deviation of split frequencies: 0.008956
570500 -- (-1048.391) [-1046.855] (-1053.772) (-1047.239) * [-1053.880] (-1052.068) (-1050.820) (-1050.037) -- 0:00:28
571000 -- [-1048.651] (-1050.949) (-1052.148) (-1050.101) * [-1049.117] (-1051.865) (-1049.357) (-1049.279) -- 0:00:28
571500 -- (-1049.504) [-1049.423] (-1049.244) (-1050.643) * (-1049.790) (-1048.663) (-1048.559) [-1048.736] -- 0:00:28
572000 -- (-1055.055) (-1059.038) (-1049.246) [-1048.067] * (-1049.362) (-1049.647) (-1048.920) [-1047.641] -- 0:00:28
572500 -- [-1052.911] (-1055.046) (-1050.700) (-1049.531) * (-1050.719) (-1057.367) [-1048.433] (-1048.901) -- 0:00:28
573000 -- (-1052.312) [-1047.878] (-1049.970) (-1048.977) * (-1050.569) (-1052.181) (-1047.581) [-1049.559] -- 0:00:28
573500 -- (-1047.679) [-1049.365] (-1051.005) (-1051.360) * (-1049.097) (-1050.134) [-1049.055] (-1048.888) -- 0:00:28
574000 -- (-1047.761) (-1051.064) (-1052.963) [-1048.066] * (-1049.708) (-1051.877) (-1053.113) [-1048.743] -- 0:00:28
574500 -- [-1047.305] (-1050.004) (-1052.375) (-1050.116) * [-1049.932] (-1050.825) (-1049.842) (-1051.273) -- 0:00:28
575000 -- [-1049.130] (-1046.499) (-1053.920) (-1049.119) * [-1050.048] (-1049.612) (-1048.504) (-1050.916) -- 0:00:28
Average standard deviation of split frequencies: 0.008443
575500 -- [-1050.686] (-1049.028) (-1050.035) (-1048.850) * (-1048.864) (-1049.347) [-1048.969] (-1049.042) -- 0:00:28
576000 -- [-1051.355] (-1049.460) (-1048.839) (-1048.582) * (-1047.533) (-1049.449) (-1050.477) [-1048.404] -- 0:00:27
576500 -- (-1048.202) [-1049.208] (-1050.455) (-1048.477) * (-1049.578) [-1048.832] (-1051.315) (-1048.680) -- 0:00:27
577000 -- (-1050.406) (-1052.500) (-1048.699) [-1051.001] * [-1051.117] (-1049.891) (-1051.285) (-1049.905) -- 0:00:27
577500 -- (-1049.375) [-1052.295] (-1050.572) (-1050.412) * [-1050.441] (-1048.870) (-1053.471) (-1052.032) -- 0:00:27
578000 -- [-1046.480] (-1050.167) (-1053.403) (-1052.291) * (-1051.734) [-1049.545] (-1053.346) (-1049.777) -- 0:00:28
578500 -- (-1048.439) [-1046.737] (-1051.459) (-1050.244) * (-1049.837) (-1049.214) [-1050.210] (-1056.604) -- 0:00:28
579000 -- (-1049.037) (-1050.224) [-1047.822] (-1052.933) * [-1047.491] (-1048.713) (-1050.437) (-1050.370) -- 0:00:28
579500 -- (-1049.272) (-1050.040) [-1048.446] (-1051.483) * (-1049.387) [-1050.761] (-1049.220) (-1052.331) -- 0:00:28
580000 -- (-1049.320) (-1050.499) (-1049.692) [-1049.932] * (-1051.646) [-1047.830] (-1051.056) (-1050.573) -- 0:00:28
Average standard deviation of split frequencies: 0.008417
580500 -- [-1046.135] (-1048.418) (-1049.781) (-1052.058) * (-1046.331) [-1048.238] (-1051.444) (-1050.846) -- 0:00:28
581000 -- (-1051.214) (-1049.251) [-1049.531] (-1047.617) * (-1047.745) (-1056.749) (-1056.574) [-1051.737] -- 0:00:28
581500 -- (-1050.329) (-1051.104) (-1053.888) [-1049.591] * (-1048.943) [-1050.072] (-1050.943) (-1051.705) -- 0:00:28
582000 -- (-1052.552) (-1050.287) [-1048.658] (-1049.868) * (-1050.793) (-1050.117) [-1049.776] (-1049.394) -- 0:00:28
582500 -- (-1051.373) [-1055.072] (-1047.983) (-1053.510) * (-1047.983) [-1051.485] (-1048.843) (-1048.528) -- 0:00:27
583000 -- (-1050.214) (-1050.156) (-1049.367) [-1048.134] * (-1049.169) (-1049.636) (-1048.745) [-1049.194] -- 0:00:27
583500 -- [-1049.927] (-1051.351) (-1049.507) (-1048.905) * (-1046.540) [-1052.449] (-1048.566) (-1051.520) -- 0:00:27
584000 -- (-1049.554) (-1051.264) [-1050.841] (-1049.082) * (-1050.603) (-1046.478) [-1048.888] (-1048.433) -- 0:00:27
584500 -- (-1047.540) (-1048.464) [-1048.886] (-1048.636) * (-1049.293) [-1048.136] (-1049.795) (-1048.760) -- 0:00:27
585000 -- (-1049.609) (-1049.126) (-1049.620) [-1047.952] * (-1048.997) (-1050.110) (-1051.080) [-1052.756] -- 0:00:27
Average standard deviation of split frequencies: 0.008425
585500 -- [-1055.637] (-1049.470) (-1048.754) (-1048.928) * (-1048.400) [-1048.823] (-1050.518) (-1050.730) -- 0:00:27
586000 -- (-1048.252) (-1049.739) [-1048.245] (-1050.277) * [-1047.449] (-1048.564) (-1046.839) (-1052.647) -- 0:00:27
586500 -- (-1047.494) (-1049.173) [-1048.016] (-1048.979) * (-1048.605) [-1046.723] (-1047.621) (-1049.746) -- 0:00:27
587000 -- (-1048.398) (-1049.831) [-1047.688] (-1049.590) * [-1049.068] (-1052.552) (-1047.894) (-1048.482) -- 0:00:27
587500 -- [-1047.432] (-1048.540) (-1056.559) (-1048.467) * [-1046.767] (-1052.017) (-1049.511) (-1047.515) -- 0:00:27
588000 -- [-1050.156] (-1048.871) (-1051.069) (-1050.382) * [-1049.960] (-1049.875) (-1048.686) (-1051.056) -- 0:00:27
588500 -- [-1047.937] (-1048.655) (-1049.223) (-1047.978) * (-1046.850) [-1051.493] (-1049.369) (-1047.859) -- 0:00:27
589000 -- (-1050.665) (-1049.806) [-1050.066] (-1051.216) * (-1048.498) (-1049.303) (-1049.586) [-1048.619] -- 0:00:27
589500 -- [-1048.528] (-1049.578) (-1049.213) (-1049.505) * (-1049.767) (-1052.496) [-1049.812] (-1049.409) -- 0:00:27
590000 -- [-1048.393] (-1047.805) (-1050.245) (-1055.999) * (-1048.544) (-1050.208) [-1049.322] (-1048.649) -- 0:00:27
Average standard deviation of split frequencies: 0.008107
590500 -- (-1047.781) (-1049.033) [-1048.913] (-1050.935) * (-1049.606) [-1047.040] (-1050.120) (-1049.171) -- 0:00:27
591000 -- (-1052.541) [-1048.664] (-1047.703) (-1055.214) * (-1051.394) [-1048.512] (-1049.599) (-1048.995) -- 0:00:26
591500 -- (-1053.539) [-1049.662] (-1048.201) (-1051.146) * (-1050.236) (-1049.269) [-1049.158] (-1052.532) -- 0:00:26
592000 -- (-1048.557) (-1047.184) (-1049.144) [-1048.764] * (-1050.322) (-1048.576) (-1048.830) [-1047.386] -- 0:00:26
592500 -- (-1048.456) (-1049.819) (-1050.707) [-1049.419] * (-1050.273) (-1049.431) [-1049.170] (-1047.886) -- 0:00:26
593000 -- (-1046.512) (-1049.439) [-1049.317] (-1048.161) * (-1049.452) [-1049.299] (-1050.732) (-1047.302) -- 0:00:27
593500 -- [-1047.097] (-1049.161) (-1049.282) (-1049.486) * [-1049.836] (-1049.089) (-1049.294) (-1051.276) -- 0:00:27
594000 -- (-1047.481) (-1048.904) (-1049.389) [-1050.608] * (-1050.995) [-1050.012] (-1051.197) (-1050.987) -- 0:00:27
594500 -- (-1048.751) [-1049.915] (-1049.514) (-1053.087) * [-1052.769] (-1049.821) (-1053.055) (-1052.680) -- 0:00:27
595000 -- (-1052.164) (-1050.235) (-1049.032) [-1050.586] * [-1048.601] (-1049.150) (-1050.755) (-1048.646) -- 0:00:27
Average standard deviation of split frequencies: 0.008201
595500 -- [-1050.142] (-1048.568) (-1049.350) (-1050.808) * [-1048.925] (-1051.460) (-1049.573) (-1048.760) -- 0:00:27
596000 -- (-1045.864) (-1049.191) [-1049.442] (-1050.358) * (-1048.864) (-1055.549) (-1049.226) [-1050.526] -- 0:00:27
596500 -- [-1045.972] (-1052.599) (-1048.533) (-1049.909) * (-1051.731) (-1054.308) (-1048.932) [-1047.846] -- 0:00:27
597000 -- (-1047.739) (-1053.555) [-1049.369] (-1052.065) * (-1049.160) (-1053.585) [-1051.203] (-1051.673) -- 0:00:27
597500 -- (-1047.857) (-1051.631) [-1051.205] (-1049.120) * [-1050.844] (-1050.309) (-1050.088) (-1049.131) -- 0:00:26
598000 -- (-1049.383) (-1057.032) [-1049.544] (-1052.893) * (-1049.169) (-1050.953) [-1052.022] (-1048.676) -- 0:00:26
598500 -- (-1049.811) (-1049.677) (-1050.534) [-1050.682] * (-1050.947) [-1053.684] (-1050.058) (-1051.203) -- 0:00:26
599000 -- (-1051.371) (-1048.186) (-1050.749) [-1048.643] * (-1049.871) (-1046.629) [-1050.508] (-1052.196) -- 0:00:26
599500 -- (-1050.069) [-1048.297] (-1053.049) (-1048.097) * (-1050.606) [-1047.276] (-1052.510) (-1051.042) -- 0:00:26
600000 -- (-1049.291) [-1047.749] (-1050.915) (-1048.802) * (-1048.974) [-1050.618] (-1050.659) (-1045.568) -- 0:00:26
Average standard deviation of split frequencies: 0.008633
600500 -- [-1050.113] (-1050.027) (-1050.475) (-1048.968) * [-1047.487] (-1052.083) (-1050.661) (-1050.920) -- 0:00:26
601000 -- [-1048.842] (-1047.835) (-1054.381) (-1055.244) * (-1048.184) (-1052.482) [-1053.512] (-1050.686) -- 0:00:26
601500 -- [-1048.708] (-1048.755) (-1048.621) (-1051.633) * (-1049.085) (-1049.026) [-1052.348] (-1050.521) -- 0:00:26
602000 -- [-1046.260] (-1050.993) (-1050.984) (-1049.402) * (-1049.043) (-1048.470) (-1053.372) [-1049.835] -- 0:00:26
602500 -- (-1048.179) (-1049.987) [-1049.812] (-1050.253) * [-1049.030] (-1049.286) (-1053.648) (-1050.723) -- 0:00:26
603000 -- (-1051.616) [-1049.295] (-1049.187) (-1048.970) * [-1049.433] (-1050.209) (-1052.158) (-1050.708) -- 0:00:26
603500 -- (-1050.023) [-1049.420] (-1050.475) (-1049.857) * (-1050.407) (-1051.261) (-1056.016) [-1048.161] -- 0:00:26
604000 -- [-1049.056] (-1049.572) (-1051.506) (-1052.763) * (-1048.295) (-1052.054) (-1051.382) [-1050.440] -- 0:00:26
604500 -- (-1048.644) [-1049.925] (-1050.735) (-1053.619) * (-1050.109) [-1049.206] (-1052.279) (-1052.571) -- 0:00:26
605000 -- (-1048.304) [-1049.285] (-1048.722) (-1051.121) * (-1047.377) [-1048.681] (-1048.977) (-1048.430) -- 0:00:26
Average standard deviation of split frequencies: 0.008557
605500 -- [-1050.621] (-1049.830) (-1049.986) (-1049.739) * (-1054.198) (-1049.278) (-1051.004) [-1049.587] -- 0:00:26
606000 -- [-1048.862] (-1049.979) (-1049.789) (-1049.534) * (-1049.640) (-1050.188) (-1053.596) [-1049.888] -- 0:00:26
606500 -- [-1053.570] (-1049.768) (-1049.209) (-1050.367) * (-1049.547) (-1049.147) [-1048.900] (-1053.725) -- 0:00:25
607000 -- (-1049.989) (-1049.250) (-1052.734) [-1049.106] * [-1048.240] (-1048.856) (-1048.314) (-1051.433) -- 0:00:25
607500 -- (-1050.503) (-1048.621) (-1053.013) [-1050.106] * [-1049.241] (-1048.459) (-1049.670) (-1050.941) -- 0:00:25
608000 -- (-1049.835) (-1049.517) (-1051.158) [-1048.612] * (-1054.208) [-1050.765] (-1050.869) (-1059.615) -- 0:00:26
608500 -- (-1049.772) [-1048.367] (-1050.777) (-1049.994) * [-1048.477] (-1049.756) (-1051.964) (-1049.433) -- 0:00:26
609000 -- (-1052.101) [-1049.520] (-1054.750) (-1048.871) * (-1050.053) (-1048.191) (-1048.629) [-1050.645] -- 0:00:26
609500 -- [-1049.321] (-1050.096) (-1055.011) (-1050.091) * (-1049.443) (-1049.772) (-1048.062) [-1047.802] -- 0:00:26
610000 -- [-1049.518] (-1054.635) (-1052.695) (-1050.551) * [-1049.178] (-1052.452) (-1047.129) (-1055.385) -- 0:00:26
Average standard deviation of split frequencies: 0.008898
610500 -- (-1050.811) (-1052.203) (-1051.425) [-1052.248] * [-1050.214] (-1050.351) (-1049.111) (-1055.373) -- 0:00:26
611000 -- (-1050.601) (-1051.705) [-1049.977] (-1051.728) * (-1051.137) [-1049.203] (-1050.309) (-1052.532) -- 0:00:26
611500 -- (-1051.576) (-1048.950) [-1050.897] (-1053.312) * (-1050.560) (-1049.487) [-1048.523] (-1053.879) -- 0:00:26
612000 -- [-1048.502] (-1052.062) (-1049.292) (-1054.741) * (-1050.470) (-1048.706) [-1047.657] (-1049.652) -- 0:00:25
612500 -- (-1048.359) (-1050.493) [-1055.512] (-1050.225) * (-1049.546) [-1049.983] (-1048.752) (-1049.753) -- 0:00:25
613000 -- (-1049.211) [-1050.017] (-1056.947) (-1050.741) * (-1046.553) [-1050.093] (-1047.579) (-1048.935) -- 0:00:25
613500 -- [-1048.509] (-1049.159) (-1057.711) (-1048.954) * (-1049.262) [-1047.287] (-1051.655) (-1049.627) -- 0:00:25
614000 -- (-1050.460) (-1049.104) [-1050.688] (-1052.013) * (-1048.234) [-1047.881] (-1048.493) (-1049.778) -- 0:00:25
614500 -- (-1050.704) [-1047.841] (-1050.269) (-1052.987) * [-1048.189] (-1048.022) (-1049.720) (-1048.968) -- 0:00:25
615000 -- (-1048.464) (-1049.671) [-1051.522] (-1054.353) * [-1046.209] (-1049.246) (-1049.371) (-1056.963) -- 0:00:25
Average standard deviation of split frequencies: 0.009103
615500 -- (-1049.136) (-1052.283) [-1050.404] (-1052.106) * [-1047.473] (-1050.327) (-1051.191) (-1053.549) -- 0:00:25
616000 -- (-1050.703) (-1052.177) (-1051.003) [-1048.418] * [-1045.131] (-1050.997) (-1049.350) (-1056.449) -- 0:00:25
616500 -- (-1050.702) [-1051.472] (-1050.185) (-1049.558) * [-1048.899] (-1050.460) (-1052.320) (-1052.912) -- 0:00:25
617000 -- (-1051.750) (-1048.744) (-1049.230) [-1047.690] * (-1049.903) [-1046.742] (-1048.821) (-1051.324) -- 0:00:25
617500 -- (-1050.847) [-1050.159] (-1050.992) (-1051.672) * (-1052.252) [-1047.985] (-1051.561) (-1050.818) -- 0:00:25
618000 -- (-1049.610) [-1048.638] (-1051.294) (-1051.844) * (-1051.051) (-1050.093) (-1049.204) [-1052.840] -- 0:00:25
618500 -- (-1050.560) [-1050.000] (-1050.231) (-1046.855) * (-1050.212) (-1049.376) [-1046.383] (-1055.459) -- 0:00:25
619000 -- (-1055.219) (-1049.146) (-1050.973) [-1050.546] * [-1049.951] (-1049.563) (-1049.490) (-1053.669) -- 0:00:25
619500 -- (-1051.568) [-1049.652] (-1050.718) (-1048.466) * (-1050.722) (-1050.026) (-1048.711) [-1049.790] -- 0:00:25
620000 -- (-1048.604) [-1050.294] (-1050.382) (-1048.863) * (-1051.317) (-1050.476) (-1047.986) [-1046.151] -- 0:00:25
Average standard deviation of split frequencies: 0.009354
620500 -- (-1053.978) (-1049.797) [-1049.182] (-1048.263) * [-1045.920] (-1049.934) (-1052.756) (-1047.776) -- 0:00:25
621000 -- (-1052.653) [-1048.665] (-1050.507) (-1049.859) * (-1048.749) [-1048.885] (-1049.536) (-1050.604) -- 0:00:25
621500 -- [-1051.612] (-1048.040) (-1050.380) (-1049.401) * [-1047.644] (-1049.061) (-1050.176) (-1047.976) -- 0:00:24
622000 -- (-1046.985) (-1047.218) (-1048.250) [-1048.683] * (-1051.157) (-1050.441) (-1049.400) [-1049.109] -- 0:00:24
622500 -- (-1052.296) [-1048.986] (-1048.266) (-1047.472) * [-1046.647] (-1052.274) (-1055.373) (-1048.806) -- 0:00:24
623000 -- (-1052.179) (-1048.319) [-1050.712] (-1053.587) * (-1050.339) (-1054.296) (-1050.362) [-1052.787] -- 0:00:24
623500 -- (-1050.436) (-1049.893) [-1048.177] (-1052.077) * (-1049.976) (-1051.923) [-1050.301] (-1047.842) -- 0:00:25
624000 -- (-1052.403) [-1048.314] (-1051.208) (-1049.563) * (-1048.889) (-1050.835) [-1049.450] (-1048.755) -- 0:00:25
624500 -- [-1050.111] (-1049.527) (-1052.107) (-1048.276) * (-1048.873) (-1051.876) [-1048.962] (-1050.317) -- 0:00:25
625000 -- (-1048.398) (-1049.760) (-1051.311) [-1048.076] * (-1053.402) (-1050.879) [-1056.104] (-1053.891) -- 0:00:25
Average standard deviation of split frequencies: 0.009314
625500 -- (-1054.553) (-1049.101) (-1049.482) [-1048.862] * (-1055.032) (-1049.693) [-1050.844] (-1049.765) -- 0:00:25
626000 -- [-1050.098] (-1049.402) (-1055.012) (-1049.790) * (-1049.217) (-1050.409) [-1052.764] (-1050.892) -- 0:00:25
626500 -- (-1051.685) [-1049.854] (-1048.961) (-1048.942) * (-1052.695) [-1050.019] (-1049.296) (-1049.279) -- 0:00:25
627000 -- (-1051.020) (-1051.431) (-1049.806) [-1048.999] * (-1054.958) (-1054.027) (-1046.488) [-1046.940] -- 0:00:24
627500 -- [-1049.340] (-1052.819) (-1052.367) (-1049.670) * (-1049.151) (-1052.695) [-1047.855] (-1048.941) -- 0:00:24
628000 -- (-1048.479) (-1049.928) (-1049.424) [-1049.019] * (-1050.540) (-1048.599) (-1047.547) [-1050.314] -- 0:00:24
628500 -- [-1049.449] (-1057.944) (-1049.929) (-1052.411) * (-1049.655) (-1046.344) (-1053.494) [-1050.399] -- 0:00:24
629000 -- (-1050.096) (-1051.911) (-1052.036) [-1048.180] * (-1048.479) [-1047.876] (-1051.417) (-1054.789) -- 0:00:24
629500 -- [-1048.575] (-1049.034) (-1054.988) (-1052.375) * (-1049.747) [-1051.122] (-1051.406) (-1051.210) -- 0:00:24
630000 -- (-1051.610) (-1049.596) [-1048.248] (-1046.301) * (-1049.649) [-1049.695] (-1049.520) (-1050.226) -- 0:00:24
Average standard deviation of split frequencies: 0.009953
630500 -- (-1050.012) (-1050.044) (-1050.310) [-1047.306] * (-1048.694) (-1050.475) (-1050.956) [-1051.891] -- 0:00:24
631000 -- (-1048.848) (-1048.931) (-1050.629) [-1047.580] * (-1048.811) (-1050.429) (-1052.798) [-1049.300] -- 0:00:24
631500 -- [-1049.851] (-1051.620) (-1050.159) (-1049.221) * [-1047.927] (-1049.777) (-1049.164) (-1050.182) -- 0:00:24
632000 -- (-1048.993) (-1052.157) (-1050.008) [-1054.051] * (-1051.300) (-1050.497) (-1048.840) [-1048.648] -- 0:00:24
632500 -- [-1048.629] (-1049.544) (-1054.544) (-1049.261) * [-1050.712] (-1055.863) (-1049.536) (-1050.183) -- 0:00:24
633000 -- (-1049.160) (-1048.266) [-1049.089] (-1047.454) * (-1049.462) [-1053.011] (-1053.781) (-1050.202) -- 0:00:24
633500 -- [-1050.591] (-1053.992) (-1049.611) (-1048.977) * (-1049.672) [-1047.421] (-1050.649) (-1048.426) -- 0:00:24
634000 -- [-1048.092] (-1049.143) (-1049.186) (-1049.260) * (-1048.990) (-1048.655) (-1048.618) [-1050.368] -- 0:00:24
634500 -- (-1050.663) (-1049.771) [-1050.241] (-1049.841) * (-1050.026) [-1049.264] (-1047.467) (-1050.537) -- 0:00:24
635000 -- (-1050.310) (-1051.280) [-1050.509] (-1050.812) * (-1049.008) (-1050.849) (-1049.754) [-1049.088] -- 0:00:24
Average standard deviation of split frequencies: 0.010416
635500 -- (-1047.892) (-1049.041) [-1048.827] (-1051.001) * (-1049.421) (-1055.359) [-1049.918] (-1050.728) -- 0:00:24
636000 -- [-1046.900] (-1054.600) (-1049.961) (-1050.219) * (-1052.462) (-1053.446) [-1048.842] (-1049.321) -- 0:00:24
636500 -- (-1051.867) (-1051.747) (-1049.254) [-1051.205] * [-1050.238] (-1050.724) (-1049.692) (-1049.983) -- 0:00:23
637000 -- (-1048.743) [-1051.659] (-1049.878) (-1050.909) * (-1047.934) (-1050.415) [-1049.659] (-1050.880) -- 0:00:23
637500 -- (-1049.071) (-1051.538) [-1048.586] (-1049.500) * (-1051.027) (-1053.332) (-1048.760) [-1050.193] -- 0:00:23
638000 -- [-1050.124] (-1049.868) (-1056.752) (-1047.486) * (-1049.034) [-1046.672] (-1054.522) (-1048.731) -- 0:00:23
638500 -- (-1050.674) [-1049.200] (-1049.628) (-1049.148) * (-1048.750) [-1049.571] (-1051.352) (-1049.462) -- 0:00:24
639000 -- (-1049.863) (-1048.504) [-1048.851] (-1049.821) * [-1051.002] (-1051.539) (-1048.278) (-1051.947) -- 0:00:24
639500 -- (-1047.879) (-1048.429) [-1047.900] (-1049.293) * (-1049.502) (-1051.049) [-1051.379] (-1056.782) -- 0:00:24
640000 -- [-1049.155] (-1048.888) (-1051.264) (-1046.552) * (-1051.700) [-1051.135] (-1048.805) (-1050.701) -- 0:00:24
Average standard deviation of split frequencies: 0.010263
640500 -- [-1049.625] (-1050.758) (-1049.230) (-1050.321) * (-1050.062) (-1048.490) [-1049.306] (-1048.548) -- 0:00:24
641000 -- (-1049.696) [-1050.030] (-1053.267) (-1048.603) * [-1047.577] (-1054.537) (-1047.530) (-1052.666) -- 0:00:24
641500 -- [-1049.013] (-1050.304) (-1050.595) (-1052.154) * (-1048.039) (-1052.890) [-1052.547] (-1048.927) -- 0:00:24
642000 -- (-1050.060) [-1054.225] (-1055.198) (-1048.717) * (-1052.112) (-1050.908) (-1049.581) [-1048.709] -- 0:00:23
642500 -- [-1054.475] (-1050.863) (-1052.978) (-1048.809) * (-1047.801) (-1051.242) [-1050.845] (-1051.892) -- 0:00:23
643000 -- (-1049.680) [-1051.123] (-1048.711) (-1048.593) * (-1047.968) (-1048.564) (-1054.383) [-1051.330] -- 0:00:23
643500 -- [-1050.639] (-1052.753) (-1048.430) (-1048.384) * (-1048.765) (-1048.899) (-1051.187) [-1048.176] -- 0:00:23
644000 -- (-1055.407) (-1053.187) [-1048.794] (-1048.663) * [-1053.464] (-1050.470) (-1053.755) (-1049.348) -- 0:00:23
644500 -- (-1049.805) [-1054.576] (-1049.529) (-1049.779) * (-1051.448) (-1049.763) (-1050.021) [-1050.877] -- 0:00:23
645000 -- (-1050.773) (-1049.280) [-1047.663] (-1052.518) * (-1049.990) (-1049.228) [-1049.120] (-1052.798) -- 0:00:23
Average standard deviation of split frequencies: 0.010523
645500 -- (-1047.117) (-1052.361) [-1049.608] (-1051.057) * [-1048.928] (-1051.012) (-1051.377) (-1050.467) -- 0:00:23
646000 -- (-1047.697) (-1052.865) [-1048.194] (-1046.599) * (-1049.531) (-1049.358) [-1051.290] (-1048.223) -- 0:00:23
646500 -- (-1048.464) [-1050.386] (-1050.086) (-1047.722) * (-1054.763) (-1048.230) (-1049.131) [-1047.952] -- 0:00:23
647000 -- [-1049.585] (-1050.818) (-1050.768) (-1051.956) * [-1050.498] (-1046.694) (-1047.282) (-1050.772) -- 0:00:23
647500 -- (-1054.656) (-1049.862) [-1048.105] (-1048.624) * (-1053.648) (-1049.392) [-1048.718] (-1050.439) -- 0:00:23
648000 -- (-1050.180) (-1049.215) [-1050.410] (-1051.438) * (-1051.871) (-1049.448) (-1048.704) [-1049.346] -- 0:00:23
648500 -- (-1049.252) [-1051.983] (-1050.609) (-1054.237) * (-1047.773) [-1051.160] (-1049.450) (-1049.476) -- 0:00:23
649000 -- [-1047.710] (-1050.188) (-1053.100) (-1054.050) * (-1052.384) (-1052.313) [-1051.884] (-1050.221) -- 0:00:23
649500 -- [-1049.043] (-1048.177) (-1050.324) (-1049.773) * (-1049.531) (-1049.360) [-1050.217] (-1055.218) -- 0:00:23
650000 -- (-1048.516) (-1050.851) (-1048.652) [-1049.355] * (-1051.406) (-1051.922) [-1048.133] (-1053.466) -- 0:00:23
Average standard deviation of split frequencies: 0.010257
650500 -- (-1049.079) (-1050.391) (-1053.302) [-1048.211] * [-1051.996] (-1048.960) (-1051.688) (-1050.518) -- 0:00:23
651000 -- (-1048.187) (-1053.694) [-1049.522] (-1050.615) * (-1048.041) [-1051.216] (-1051.852) (-1049.198) -- 0:00:23
651500 -- (-1049.034) [-1051.257] (-1050.077) (-1054.253) * (-1049.703) [-1049.798] (-1049.980) (-1049.482) -- 0:00:23
652000 -- (-1049.336) (-1050.948) (-1048.826) [-1056.014] * (-1050.475) (-1047.408) [-1047.351] (-1048.378) -- 0:00:22
652500 -- (-1050.494) (-1050.455) [-1048.586] (-1049.939) * [-1046.852] (-1048.949) (-1049.229) (-1051.126) -- 0:00:22
653000 -- (-1052.760) [-1050.800] (-1050.997) (-1053.463) * (-1048.942) [-1052.344] (-1049.311) (-1050.852) -- 0:00:22
653500 -- (-1052.170) (-1045.961) [-1047.276] (-1058.372) * (-1047.224) (-1047.411) (-1049.511) [-1048.477] -- 0:00:23
654000 -- [-1049.066] (-1050.094) (-1048.670) (-1052.081) * (-1050.447) (-1048.650) (-1051.532) [-1047.258] -- 0:00:23
654500 -- (-1049.748) (-1050.735) (-1048.926) [-1049.169] * (-1048.842) (-1047.044) [-1048.108] (-1049.559) -- 0:00:23
655000 -- (-1049.396) [-1049.301] (-1050.389) (-1049.950) * [-1049.759] (-1051.475) (-1048.961) (-1050.477) -- 0:00:23
Average standard deviation of split frequencies: 0.009985
655500 -- [-1048.257] (-1050.102) (-1047.826) (-1051.402) * [-1051.263] (-1048.844) (-1049.590) (-1051.170) -- 0:00:23
656000 -- (-1048.781) (-1049.360) (-1049.398) [-1052.784] * (-1050.376) (-1047.023) [-1049.659] (-1053.002) -- 0:00:23
656500 -- [-1047.028] (-1053.921) (-1048.013) (-1048.567) * (-1052.887) [-1047.131] (-1046.356) (-1050.400) -- 0:00:23
657000 -- (-1052.989) [-1049.266] (-1051.214) (-1048.894) * (-1049.931) (-1050.612) [-1049.115] (-1053.166) -- 0:00:22
657500 -- (-1054.600) (-1047.958) [-1049.398] (-1049.793) * (-1049.077) (-1048.982) [-1046.952] (-1049.695) -- 0:00:22
658000 -- [-1050.551] (-1049.163) (-1048.410) (-1052.348) * (-1049.284) (-1050.002) (-1048.463) [-1051.131] -- 0:00:22
658500 -- (-1051.017) (-1049.834) (-1049.301) [-1054.865] * (-1051.392) (-1051.579) [-1050.072] (-1045.442) -- 0:00:22
659000 -- (-1048.472) (-1053.756) (-1050.081) [-1047.770] * (-1050.972) (-1050.409) (-1049.660) [-1049.523] -- 0:00:22
659500 -- (-1049.068) (-1050.762) [-1052.095] (-1047.124) * (-1051.381) (-1049.354) (-1051.955) [-1050.233] -- 0:00:22
660000 -- [-1049.269] (-1049.571) (-1051.018) (-1049.135) * (-1050.433) (-1049.614) [-1052.047] (-1051.387) -- 0:00:22
Average standard deviation of split frequencies: 0.009351
660500 -- (-1048.562) (-1050.732) [-1048.596] (-1048.728) * (-1052.837) (-1050.825) (-1055.000) [-1056.727] -- 0:00:22
661000 -- (-1051.060) (-1051.016) (-1051.042) [-1047.616] * (-1048.913) (-1053.826) [-1050.837] (-1051.328) -- 0:00:22
661500 -- [-1047.678] (-1051.607) (-1050.576) (-1052.015) * [-1049.810] (-1051.078) (-1051.793) (-1048.875) -- 0:00:22
662000 -- (-1049.151) (-1050.019) [-1049.003] (-1052.258) * (-1050.140) (-1050.609) [-1049.097] (-1048.927) -- 0:00:22
662500 -- (-1049.113) [-1050.665] (-1049.591) (-1048.860) * (-1049.126) (-1052.320) (-1050.882) [-1050.648] -- 0:00:22
663000 -- (-1050.087) (-1049.333) [-1048.632] (-1050.265) * (-1049.452) [-1047.279] (-1047.796) (-1048.520) -- 0:00:22
663500 -- (-1053.768) (-1050.105) [-1047.944] (-1050.256) * (-1048.877) [-1049.790] (-1051.791) (-1051.047) -- 0:00:22
664000 -- (-1048.591) (-1051.494) [-1050.966] (-1049.074) * (-1048.421) (-1048.612) (-1051.043) [-1051.466] -- 0:00:22
664500 -- (-1049.547) [-1049.227] (-1048.113) (-1049.488) * [-1048.796] (-1053.230) (-1053.737) (-1049.328) -- 0:00:22
665000 -- (-1053.625) [-1048.886] (-1049.539) (-1050.787) * [-1052.768] (-1047.775) (-1048.253) (-1050.490) -- 0:00:22
Average standard deviation of split frequencies: 0.009127
665500 -- (-1050.405) [-1052.179] (-1047.545) (-1051.664) * (-1053.506) (-1050.440) [-1052.863] (-1051.006) -- 0:00:22
666000 -- [-1050.639] (-1049.136) (-1047.906) (-1053.009) * (-1050.068) (-1052.773) (-1053.377) [-1055.038] -- 0:00:22
666500 -- [-1049.409] (-1047.766) (-1050.412) (-1056.034) * (-1049.914) (-1051.653) (-1051.591) [-1050.842] -- 0:00:22
667000 -- (-1049.571) (-1048.827) [-1050.686] (-1050.952) * [-1050.430] (-1047.534) (-1052.504) (-1048.571) -- 0:00:21
667500 -- [-1049.191] (-1049.339) (-1045.240) (-1048.999) * [-1047.867] (-1048.388) (-1049.613) (-1049.446) -- 0:00:21
668000 -- (-1050.400) (-1052.008) [-1046.764] (-1048.831) * (-1055.835) [-1047.901] (-1049.054) (-1048.824) -- 0:00:21
668500 -- [-1049.512] (-1058.451) (-1051.021) (-1049.771) * (-1050.926) (-1049.939) (-1049.607) [-1048.919] -- 0:00:22
669000 -- [-1047.912] (-1051.389) (-1054.853) (-1049.528) * [-1050.622] (-1051.578) (-1051.102) (-1049.621) -- 0:00:22
669500 -- [-1049.380] (-1050.706) (-1051.904) (-1049.260) * (-1049.715) (-1049.449) [-1049.000] (-1052.374) -- 0:00:22
670000 -- (-1049.175) (-1050.806) [-1048.882] (-1050.002) * [-1052.070] (-1047.619) (-1048.215) (-1052.088) -- 0:00:22
Average standard deviation of split frequencies: 0.009360
670500 -- (-1050.052) (-1046.882) (-1047.391) [-1049.859] * (-1049.701) [-1050.108] (-1053.273) (-1053.248) -- 0:00:22
671000 -- [-1051.155] (-1048.095) (-1052.697) (-1052.104) * (-1049.290) (-1054.866) (-1051.807) [-1051.625] -- 0:00:22
671500 -- (-1050.928) (-1049.004) [-1049.989] (-1050.576) * (-1052.389) [-1052.629] (-1051.342) (-1051.944) -- 0:00:22
672000 -- (-1050.088) (-1052.578) [-1046.056] (-1050.317) * (-1050.815) (-1049.169) (-1051.057) [-1049.235] -- 0:00:21
672500 -- (-1049.331) (-1052.564) [-1046.890] (-1051.959) * (-1052.355) (-1050.298) [-1049.003] (-1048.780) -- 0:00:21
673000 -- (-1050.249) (-1052.609) [-1049.149] (-1051.694) * (-1053.165) (-1050.105) [-1051.033] (-1048.922) -- 0:00:21
673500 -- (-1049.956) (-1049.857) [-1049.042] (-1051.138) * (-1054.500) [-1049.372] (-1055.052) (-1052.059) -- 0:00:21
674000 -- (-1048.762) (-1050.481) [-1049.290] (-1052.423) * (-1051.187) (-1049.293) [-1052.164] (-1049.896) -- 0:00:21
674500 -- (-1050.086) (-1050.643) (-1048.853) [-1049.007] * [-1050.570] (-1049.910) (-1050.229) (-1050.002) -- 0:00:21
675000 -- (-1048.952) (-1051.036) [-1051.265] (-1049.621) * (-1049.968) (-1049.945) [-1053.364] (-1050.613) -- 0:00:21
Average standard deviation of split frequencies: 0.008919
675500 -- (-1049.096) (-1049.146) (-1051.130) [-1049.526] * (-1050.803) [-1048.736] (-1052.028) (-1050.137) -- 0:00:21
676000 -- (-1049.178) [-1048.880] (-1050.952) (-1051.872) * (-1049.389) [-1048.271] (-1055.376) (-1049.865) -- 0:00:21
676500 -- [-1050.761] (-1049.634) (-1051.443) (-1051.145) * [-1049.087] (-1047.768) (-1055.574) (-1048.789) -- 0:00:21
677000 -- [-1051.669] (-1049.278) (-1048.645) (-1048.330) * [-1051.371] (-1049.104) (-1054.472) (-1049.051) -- 0:00:21
677500 -- (-1049.080) (-1046.420) [-1050.248] (-1050.286) * (-1052.338) (-1048.986) [-1049.973] (-1052.103) -- 0:00:21
678000 -- (-1051.488) (-1050.339) [-1049.809] (-1051.889) * [-1049.693] (-1049.456) (-1050.423) (-1053.040) -- 0:00:21
678500 -- [-1047.316] (-1053.543) (-1049.983) (-1051.703) * (-1049.548) (-1050.361) [-1049.589] (-1050.958) -- 0:00:21
679000 -- (-1048.266) (-1048.449) [-1048.760] (-1050.560) * (-1052.060) [-1048.120] (-1049.311) (-1051.543) -- 0:00:21
679500 -- (-1048.397) [-1049.727] (-1050.115) (-1050.472) * (-1050.518) [-1051.901] (-1048.895) (-1049.313) -- 0:00:21
680000 -- [-1049.055] (-1055.143) (-1048.246) (-1048.968) * (-1050.204) [-1049.913] (-1049.051) (-1048.955) -- 0:00:21
Average standard deviation of split frequencies: 0.008930
680500 -- (-1051.464) [-1050.168] (-1053.298) (-1048.360) * (-1051.439) (-1049.853) [-1048.353] (-1047.848) -- 0:00:21
681000 -- (-1049.532) [-1051.197] (-1049.719) (-1047.127) * (-1047.564) (-1053.824) (-1051.911) [-1048.814] -- 0:00:21
681500 -- (-1048.866) [-1049.765] (-1049.456) (-1048.412) * [-1049.652] (-1050.627) (-1048.320) (-1050.162) -- 0:00:21
682000 -- (-1051.257) (-1050.014) (-1049.047) [-1048.173] * (-1050.179) (-1049.463) (-1050.344) [-1056.332] -- 0:00:20
682500 -- (-1050.548) (-1055.479) [-1049.961] (-1050.379) * (-1049.215) (-1049.122) [-1050.037] (-1049.064) -- 0:00:20
683000 -- (-1052.371) (-1057.233) (-1050.506) [-1049.272] * (-1051.549) [-1048.960] (-1048.318) (-1049.015) -- 0:00:20
683500 -- (-1049.553) (-1056.039) [-1047.642] (-1048.972) * (-1050.566) (-1051.060) [-1050.792] (-1049.573) -- 0:00:20
684000 -- (-1049.788) (-1053.689) [-1051.438] (-1049.250) * (-1050.750) [-1049.067] (-1051.552) (-1051.883) -- 0:00:21
684500 -- [-1050.905] (-1049.088) (-1052.998) (-1052.229) * (-1050.873) (-1049.340) [-1051.016] (-1050.760) -- 0:00:21
685000 -- [-1050.339] (-1048.952) (-1051.242) (-1050.699) * [-1050.672] (-1052.779) (-1050.939) (-1053.987) -- 0:00:21
Average standard deviation of split frequencies: 0.009295
685500 -- (-1051.124) [-1049.122] (-1051.210) (-1049.369) * (-1048.848) (-1052.081) (-1049.930) [-1049.656] -- 0:00:21
686000 -- (-1051.500) [-1051.007] (-1055.014) (-1049.829) * [-1048.890] (-1050.872) (-1049.697) (-1052.610) -- 0:00:21
686500 -- (-1051.901) (-1051.088) (-1050.534) [-1049.269] * (-1051.061) (-1048.986) (-1050.644) [-1047.721] -- 0:00:21
687000 -- (-1055.333) (-1049.366) [-1047.869] (-1052.996) * (-1048.006) (-1050.481) [-1048.266] (-1048.621) -- 0:00:20
687500 -- (-1050.926) (-1049.417) (-1049.215) [-1049.800] * (-1048.666) (-1051.707) (-1047.708) [-1051.243] -- 0:00:20
688000 -- (-1050.236) (-1051.074) [-1052.368] (-1048.135) * (-1048.467) [-1051.870] (-1048.590) (-1052.223) -- 0:00:20
688500 -- (-1049.130) (-1051.878) [-1048.610] (-1048.701) * [-1048.672] (-1049.507) (-1047.373) (-1050.414) -- 0:00:20
689000 -- (-1052.657) (-1051.385) (-1048.878) [-1049.189] * (-1049.372) (-1049.921) (-1049.511) [-1048.604] -- 0:00:20
689500 -- (-1052.937) [-1050.914] (-1050.594) (-1051.699) * [-1047.590] (-1050.929) (-1051.797) (-1053.294) -- 0:00:20
690000 -- (-1050.736) [-1049.100] (-1051.543) (-1054.489) * [-1050.734] (-1050.304) (-1050.489) (-1053.021) -- 0:00:20
Average standard deviation of split frequencies: 0.009340
690500 -- (-1049.098) [-1048.277] (-1049.506) (-1049.021) * (-1049.832) (-1052.413) [-1049.984] (-1052.405) -- 0:00:20
691000 -- (-1053.192) (-1047.456) [-1049.781] (-1049.079) * (-1049.875) (-1050.265) [-1050.519] (-1049.183) -- 0:00:20
691500 -- [-1050.035] (-1048.646) (-1048.949) (-1053.522) * (-1047.232) (-1049.789) [-1049.814] (-1049.940) -- 0:00:20
692000 -- [-1050.410] (-1049.389) (-1048.998) (-1051.439) * (-1049.236) (-1049.379) [-1048.709] (-1049.904) -- 0:00:20
692500 -- [-1049.476] (-1049.192) (-1050.340) (-1054.116) * (-1050.101) (-1050.623) (-1049.564) [-1048.861] -- 0:00:20
693000 -- [-1048.998] (-1048.582) (-1048.932) (-1050.652) * (-1049.252) (-1049.107) (-1050.616) [-1049.623] -- 0:00:20
693500 -- [-1049.038] (-1053.806) (-1051.357) (-1052.803) * (-1051.465) (-1048.009) (-1049.488) [-1047.879] -- 0:00:20
694000 -- [-1049.253] (-1050.496) (-1049.852) (-1051.857) * (-1052.426) [-1049.762] (-1049.953) (-1049.917) -- 0:00:20
694500 -- (-1049.900) (-1049.719) [-1050.969] (-1050.791) * (-1049.942) (-1048.250) (-1048.451) [-1048.672] -- 0:00:20
695000 -- [-1048.566] (-1048.531) (-1051.043) (-1050.931) * (-1049.278) [-1048.894] (-1050.264) (-1046.996) -- 0:00:20
Average standard deviation of split frequencies: 0.008448
695500 -- (-1049.107) [-1049.813] (-1049.524) (-1049.315) * (-1046.983) (-1049.785) [-1048.465] (-1048.701) -- 0:00:20
696000 -- (-1047.472) (-1049.440) (-1049.948) [-1051.641] * (-1049.601) (-1048.216) [-1047.225] (-1048.771) -- 0:00:20
696500 -- (-1047.183) (-1049.779) (-1052.039) [-1050.999] * [-1049.287] (-1047.281) (-1052.080) (-1050.805) -- 0:00:20
697000 -- (-1048.942) [-1050.232] (-1049.292) (-1049.657) * [-1047.745] (-1049.949) (-1050.148) (-1053.382) -- 0:00:19
697500 -- (-1049.348) [-1055.719] (-1049.374) (-1049.433) * [-1049.955] (-1049.891) (-1049.573) (-1049.355) -- 0:00:19
698000 -- (-1048.497) (-1051.992) [-1049.205] (-1052.773) * (-1050.321) (-1047.553) (-1053.391) [-1049.024] -- 0:00:19
698500 -- (-1049.434) (-1048.481) (-1049.713) [-1050.677] * (-1049.563) (-1049.355) [-1048.904] (-1051.905) -- 0:00:19
699000 -- (-1052.858) (-1049.796) (-1050.937) [-1049.156] * (-1049.635) [-1050.792] (-1049.053) (-1049.661) -- 0:00:20
699500 -- (-1048.828) (-1050.038) [-1049.985] (-1049.080) * [-1050.631] (-1050.146) (-1048.720) (-1048.314) -- 0:00:20
700000 -- (-1048.343) [-1048.745] (-1049.699) (-1049.049) * (-1053.700) [-1049.115] (-1048.937) (-1050.322) -- 0:00:20
Average standard deviation of split frequencies: 0.008357
700500 -- (-1050.870) [-1049.080] (-1049.032) (-1049.897) * (-1052.827) (-1050.075) [-1048.835] (-1052.468) -- 0:00:20
701000 -- [-1051.484] (-1048.835) (-1049.765) (-1052.624) * [-1051.190] (-1050.383) (-1049.366) (-1051.441) -- 0:00:20
701500 -- (-1048.726) [-1051.990] (-1049.056) (-1055.484) * (-1050.923) (-1050.605) (-1052.380) [-1049.047] -- 0:00:19
702000 -- [-1050.940] (-1049.186) (-1050.126) (-1052.799) * (-1051.786) (-1050.628) (-1050.493) [-1049.295] -- 0:00:19
702500 -- (-1050.897) (-1047.557) (-1048.475) [-1051.504] * (-1051.377) [-1051.026] (-1048.543) (-1050.089) -- 0:00:19
703000 -- [-1048.781] (-1052.497) (-1048.828) (-1050.779) * (-1050.981) [-1049.060] (-1051.603) (-1052.787) -- 0:00:19
703500 -- (-1049.917) (-1048.562) (-1050.871) [-1051.561] * (-1048.797) (-1049.507) (-1050.223) [-1048.347] -- 0:00:19
704000 -- (-1049.511) (-1052.000) (-1049.579) [-1049.105] * (-1048.822) (-1049.235) (-1050.103) [-1047.499] -- 0:00:19
704500 -- (-1049.698) (-1048.494) (-1050.830) [-1046.649] * (-1052.716) [-1049.593] (-1053.748) (-1050.139) -- 0:00:19
705000 -- (-1051.338) [-1049.437] (-1052.448) (-1052.408) * (-1049.651) (-1050.956) (-1049.048) [-1048.900] -- 0:00:19
Average standard deviation of split frequencies: 0.009032
705500 -- [-1049.697] (-1050.522) (-1050.217) (-1049.766) * (-1050.097) (-1050.151) (-1049.895) [-1051.586] -- 0:00:19
706000 -- (-1051.395) (-1049.441) (-1049.503) [-1049.166] * (-1049.872) [-1048.699] (-1048.905) (-1053.754) -- 0:00:19
706500 -- (-1051.275) [-1048.821] (-1049.748) (-1047.859) * (-1049.014) [-1051.460] (-1050.828) (-1049.582) -- 0:00:19
707000 -- (-1050.769) (-1048.594) (-1049.674) [-1048.303] * (-1049.646) (-1049.584) (-1051.452) [-1050.320] -- 0:00:19
707500 -- (-1048.613) (-1049.137) [-1050.206] (-1050.065) * [-1048.624] (-1047.353) (-1054.667) (-1048.883) -- 0:00:19
708000 -- (-1054.531) [-1051.620] (-1051.835) (-1053.136) * (-1048.232) (-1047.396) [-1049.864] (-1049.307) -- 0:00:19
708500 -- (-1049.436) (-1050.075) (-1049.338) [-1048.180] * (-1050.892) (-1048.971) [-1052.856] (-1048.045) -- 0:00:19
709000 -- (-1050.475) (-1047.339) [-1046.756] (-1049.394) * [-1050.045] (-1054.110) (-1049.670) (-1048.434) -- 0:00:19
709500 -- (-1049.971) [-1051.361] (-1050.132) (-1055.647) * [-1050.233] (-1048.291) (-1049.620) (-1049.365) -- 0:00:19
710000 -- [-1049.018] (-1052.122) (-1050.111) (-1053.402) * (-1048.081) (-1048.790) (-1049.493) [-1046.311] -- 0:00:19
Average standard deviation of split frequencies: 0.009112
710500 -- (-1048.169) [-1052.311] (-1050.439) (-1048.664) * (-1051.650) [-1047.542] (-1049.292) (-1051.673) -- 0:00:19
711000 -- (-1050.254) (-1051.563) [-1052.623] (-1050.741) * (-1052.038) [-1051.034] (-1048.968) (-1050.629) -- 0:00:19
711500 -- (-1054.599) (-1050.570) (-1057.620) [-1049.522] * (-1049.549) [-1048.721] (-1048.554) (-1050.558) -- 0:00:19
712000 -- (-1054.951) (-1049.412) (-1050.310) [-1048.975] * (-1048.931) [-1049.467] (-1048.105) (-1050.351) -- 0:00:19
712500 -- (-1053.435) [-1049.781] (-1051.484) (-1050.706) * (-1050.230) (-1049.310) (-1049.106) [-1048.256] -- 0:00:18
713000 -- (-1050.377) (-1048.368) [-1047.857] (-1051.838) * (-1049.160) [-1053.596] (-1051.260) (-1049.416) -- 0:00:18
713500 -- (-1053.054) (-1049.151) (-1053.459) [-1049.868] * (-1050.401) (-1056.234) (-1054.411) [-1046.906] -- 0:00:18
714000 -- (-1050.448) (-1048.679) [-1047.640] (-1051.157) * [-1048.254] (-1049.048) (-1050.415) (-1050.092) -- 0:00:19
714500 -- (-1048.287) (-1048.742) [-1049.309] (-1051.109) * [-1052.687] (-1052.058) (-1051.620) (-1051.911) -- 0:00:19
715000 -- (-1052.308) (-1049.949) [-1050.033] (-1049.692) * (-1053.218) (-1048.749) (-1049.338) [-1051.194] -- 0:00:19
Average standard deviation of split frequencies: 0.009044
715500 -- (-1051.015) [-1050.522] (-1049.806) (-1050.629) * (-1046.551) (-1053.188) [-1048.974] (-1049.773) -- 0:00:19
716000 -- (-1049.214) [-1053.301] (-1050.006) (-1048.452) * (-1046.774) (-1050.146) (-1051.773) [-1046.665] -- 0:00:19
716500 -- (-1047.834) (-1055.423) (-1048.050) [-1048.997] * (-1048.633) [-1048.693] (-1049.449) (-1048.489) -- 0:00:18
717000 -- [-1050.263] (-1053.791) (-1051.849) (-1049.613) * [-1051.600] (-1048.621) (-1048.908) (-1050.000) -- 0:00:18
717500 -- [-1048.425] (-1050.658) (-1049.112) (-1048.781) * [-1046.740] (-1048.619) (-1048.999) (-1050.910) -- 0:00:18
718000 -- (-1049.324) [-1048.401] (-1050.172) (-1049.274) * (-1050.318) (-1048.051) (-1054.569) [-1051.310] -- 0:00:18
718500 -- [-1048.455] (-1053.612) (-1052.061) (-1049.277) * (-1051.550) (-1054.663) [-1049.198] (-1049.316) -- 0:00:18
719000 -- (-1049.334) [-1050.082] (-1053.076) (-1050.320) * (-1050.586) (-1050.817) (-1048.723) [-1051.196] -- 0:00:18
719500 -- (-1048.362) [-1050.917] (-1056.146) (-1049.822) * [-1051.559] (-1051.985) (-1049.061) (-1051.159) -- 0:00:18
720000 -- (-1048.690) (-1049.923) [-1048.975] (-1050.106) * (-1048.137) (-1051.655) (-1048.677) [-1049.408] -- 0:00:18
Average standard deviation of split frequencies: 0.009640
720500 -- [-1046.987] (-1048.894) (-1050.460) (-1050.989) * [-1049.714] (-1052.975) (-1051.481) (-1048.379) -- 0:00:18
721000 -- (-1053.609) [-1048.568] (-1045.747) (-1049.669) * (-1048.936) (-1049.194) (-1054.827) [-1048.722] -- 0:00:18
721500 -- [-1051.856] (-1050.275) (-1047.027) (-1052.872) * [-1048.819] (-1049.215) (-1060.221) (-1051.262) -- 0:00:18
722000 -- (-1048.628) [-1049.860] (-1047.450) (-1054.144) * [-1049.702] (-1049.308) (-1052.213) (-1049.870) -- 0:00:18
722500 -- [-1050.363] (-1048.559) (-1048.308) (-1051.608) * [-1050.390] (-1049.806) (-1051.758) (-1050.209) -- 0:00:18
723000 -- (-1050.783) [-1048.777] (-1047.687) (-1054.942) * (-1049.763) (-1048.447) (-1051.920) [-1049.499] -- 0:00:18
723500 -- (-1047.823) (-1051.501) (-1049.121) [-1047.155] * (-1050.410) (-1050.311) (-1049.890) [-1047.721] -- 0:00:18
724000 -- (-1049.239) (-1050.178) [-1049.950] (-1048.453) * (-1049.342) (-1049.831) [-1050.690] (-1051.410) -- 0:00:18
724500 -- [-1046.399] (-1050.716) (-1050.411) (-1047.307) * (-1049.827) (-1049.840) [-1049.663] (-1050.558) -- 0:00:18
725000 -- (-1046.510) [-1050.652] (-1050.502) (-1049.001) * (-1047.571) (-1049.144) [-1048.670] (-1051.449) -- 0:00:18
Average standard deviation of split frequencies: 0.009261
725500 -- [-1049.596] (-1048.948) (-1052.529) (-1053.669) * (-1052.580) [-1050.421] (-1049.452) (-1049.637) -- 0:00:18
726000 -- (-1049.065) [-1049.272] (-1048.107) (-1054.607) * [-1054.073] (-1050.147) (-1049.718) (-1048.795) -- 0:00:18
726500 -- (-1051.404) (-1050.994) [-1050.421] (-1052.189) * (-1050.554) (-1050.527) (-1049.275) [-1050.087] -- 0:00:18
727000 -- (-1057.036) (-1052.992) (-1054.205) [-1053.063] * (-1053.389) [-1049.611] (-1049.237) (-1049.049) -- 0:00:18
727500 -- (-1050.208) (-1049.882) (-1049.200) [-1049.238] * (-1055.155) (-1049.986) (-1051.739) [-1051.154] -- 0:00:17
728000 -- (-1048.980) (-1050.056) (-1052.398) [-1051.347] * (-1050.438) (-1050.887) [-1049.665] (-1047.386) -- 0:00:17
728500 -- (-1049.629) (-1048.698) [-1048.464] (-1052.477) * [-1048.123] (-1054.312) (-1049.244) (-1049.989) -- 0:00:17
729000 -- (-1050.986) [-1048.637] (-1050.433) (-1054.497) * [-1049.739] (-1048.789) (-1049.778) (-1052.841) -- 0:00:18
729500 -- (-1050.323) [-1050.169] (-1052.807) (-1053.449) * [-1049.438] (-1048.276) (-1048.778) (-1050.310) -- 0:00:18
730000 -- (-1048.378) [-1050.529] (-1049.185) (-1051.282) * (-1048.628) (-1048.409) (-1048.912) [-1047.960] -- 0:00:18
Average standard deviation of split frequencies: 0.009712
730500 -- (-1047.463) (-1053.557) (-1051.602) [-1048.997] * [-1053.160] (-1048.410) (-1048.372) (-1048.823) -- 0:00:18
731000 -- [-1047.796] (-1049.274) (-1050.279) (-1050.402) * (-1054.466) (-1054.166) [-1049.686] (-1049.574) -- 0:00:18
731500 -- (-1049.249) (-1050.664) (-1051.504) [-1045.091] * (-1051.447) (-1050.419) (-1049.217) [-1049.962] -- 0:00:17
732000 -- (-1049.025) [-1051.194] (-1052.413) (-1049.433) * [-1048.360] (-1049.805) (-1048.682) (-1048.581) -- 0:00:17
732500 -- (-1051.322) (-1050.402) (-1051.481) [-1049.371] * (-1049.308) (-1052.357) (-1053.025) [-1048.292] -- 0:00:17
733000 -- (-1048.377) (-1048.605) (-1050.673) [-1053.322] * (-1054.009) [-1049.499] (-1053.194) (-1046.309) -- 0:00:17
733500 -- (-1051.730) (-1049.696) (-1045.872) [-1048.104] * (-1049.444) [-1048.659] (-1050.158) (-1047.912) -- 0:00:17
734000 -- [-1046.919] (-1049.722) (-1049.329) (-1049.744) * (-1051.583) [-1046.951] (-1053.199) (-1048.392) -- 0:00:17
734500 -- (-1047.945) [-1045.709] (-1049.088) (-1051.603) * (-1049.743) (-1048.936) [-1051.860] (-1049.774) -- 0:00:17
735000 -- (-1048.894) (-1048.682) (-1050.145) [-1048.091] * [-1049.996] (-1049.126) (-1051.086) (-1053.527) -- 0:00:17
Average standard deviation of split frequencies: 0.009338
735500 -- [-1047.941] (-1048.484) (-1050.646) (-1049.281) * [-1050.136] (-1048.924) (-1052.005) (-1053.813) -- 0:00:17
736000 -- [-1049.145] (-1049.705) (-1048.830) (-1049.674) * [-1049.174] (-1050.315) (-1052.625) (-1048.550) -- 0:00:17
736500 -- [-1046.842] (-1054.860) (-1053.834) (-1048.386) * (-1047.835) [-1049.980] (-1047.478) (-1049.137) -- 0:00:17
737000 -- (-1050.795) (-1051.823) (-1056.867) [-1046.805] * (-1046.615) (-1049.788) (-1049.633) [-1050.452] -- 0:00:17
737500 -- (-1049.465) (-1046.623) [-1054.826] (-1050.835) * (-1048.973) (-1050.846) (-1048.243) [-1049.948] -- 0:00:17
738000 -- (-1048.142) (-1051.213) [-1050.255] (-1049.018) * (-1052.179) [-1049.403] (-1049.425) (-1048.879) -- 0:00:17
738500 -- [-1048.788] (-1050.893) (-1048.430) (-1049.299) * (-1050.777) [-1050.813] (-1050.681) (-1054.892) -- 0:00:17
739000 -- [-1049.901] (-1048.413) (-1051.784) (-1050.325) * [-1047.273] (-1049.773) (-1049.436) (-1052.466) -- 0:00:17
739500 -- (-1050.728) (-1048.924) [-1045.975] (-1055.289) * (-1051.440) (-1048.647) (-1046.280) [-1049.145] -- 0:00:17
740000 -- (-1048.384) [-1049.911] (-1049.168) (-1049.572) * (-1049.296) (-1049.295) [-1048.776] (-1050.021) -- 0:00:17
Average standard deviation of split frequencies: 0.009647
740500 -- (-1053.208) [-1051.269] (-1047.211) (-1051.824) * (-1050.623) (-1050.580) [-1052.951] (-1048.805) -- 0:00:17
741000 -- (-1049.928) (-1049.044) [-1050.687] (-1053.315) * (-1049.563) [-1048.608] (-1048.253) (-1049.294) -- 0:00:17
741500 -- (-1048.619) (-1048.184) (-1050.490) [-1050.586] * (-1048.538) (-1050.730) [-1046.592] (-1050.339) -- 0:00:17
742000 -- (-1052.281) (-1049.666) [-1048.597] (-1049.978) * (-1045.875) (-1050.579) (-1048.270) [-1049.044] -- 0:00:17
742500 -- (-1055.734) [-1049.490] (-1053.139) (-1050.306) * (-1044.700) [-1050.026] (-1048.078) (-1047.581) -- 0:00:16
743000 -- (-1051.786) [-1048.363] (-1050.477) (-1049.489) * (-1050.929) [-1052.795] (-1049.958) (-1049.250) -- 0:00:16
743500 -- (-1050.007) (-1048.059) (-1047.352) [-1048.523] * (-1055.954) (-1049.574) [-1048.179] (-1048.300) -- 0:00:16
744000 -- (-1049.104) [-1050.690] (-1051.552) (-1049.233) * [-1045.826] (-1047.960) (-1049.140) (-1050.351) -- 0:00:16
744500 -- (-1049.279) (-1049.547) [-1047.314] (-1050.080) * (-1046.350) (-1047.459) (-1050.283) [-1048.681] -- 0:00:17
745000 -- [-1050.957] (-1051.055) (-1050.098) (-1050.102) * (-1050.798) (-1049.389) [-1047.087] (-1049.808) -- 0:00:17
Average standard deviation of split frequencies: 0.009612
745500 -- [-1052.982] (-1049.481) (-1049.091) (-1050.288) * (-1053.370) [-1046.334] (-1047.893) (-1051.418) -- 0:00:17
746000 -- (-1048.853) (-1050.168) (-1051.664) [-1049.817] * (-1050.149) (-1049.435) (-1056.551) [-1049.816] -- 0:00:17
746500 -- (-1051.177) (-1052.275) [-1048.558] (-1051.734) * (-1050.965) (-1055.093) (-1048.574) [-1049.002] -- 0:00:16
747000 -- (-1051.281) (-1048.433) [-1051.844] (-1052.197) * [-1049.649] (-1050.646) (-1048.910) (-1055.627) -- 0:00:16
747500 -- (-1048.489) (-1051.495) [-1049.800] (-1050.176) * (-1049.062) [-1048.608] (-1050.817) (-1052.403) -- 0:00:16
748000 -- [-1051.898] (-1048.073) (-1051.422) (-1050.943) * (-1052.582) (-1048.483) [-1049.052] (-1051.791) -- 0:00:16
748500 -- (-1050.872) (-1047.877) (-1051.488) [-1051.058] * (-1051.870) (-1048.006) [-1048.454] (-1048.848) -- 0:00:16
749000 -- (-1050.597) (-1047.962) [-1050.272] (-1049.324) * [-1048.826] (-1048.920) (-1049.535) (-1052.473) -- 0:00:16
749500 -- (-1051.139) (-1046.794) [-1049.731] (-1050.335) * (-1045.530) (-1051.277) (-1052.899) [-1049.293] -- 0:00:16
750000 -- [-1048.946] (-1047.026) (-1050.909) (-1048.009) * (-1048.793) [-1047.922] (-1052.697) (-1050.073) -- 0:00:16
Average standard deviation of split frequencies: 0.010246
750500 -- (-1051.062) (-1050.541) [-1051.076] (-1048.465) * (-1048.361) [-1047.281] (-1053.692) (-1049.987) -- 0:00:16
751000 -- (-1049.945) [-1048.928] (-1052.040) (-1055.636) * (-1054.493) (-1048.355) (-1049.700) [-1050.998] -- 0:00:16
751500 -- (-1051.674) (-1049.841) [-1048.729] (-1049.558) * (-1050.749) (-1050.327) [-1050.825] (-1051.543) -- 0:00:16
752000 -- (-1049.472) (-1050.413) (-1049.376) [-1049.944] * (-1050.220) (-1048.074) [-1047.189] (-1049.912) -- 0:00:16
752500 -- (-1048.683) [-1050.779] (-1050.820) (-1049.043) * (-1049.342) [-1048.225] (-1050.363) (-1051.757) -- 0:00:16
753000 -- (-1050.695) [-1048.635] (-1047.977) (-1052.025) * (-1051.091) [-1050.078] (-1051.659) (-1049.414) -- 0:00:16
753500 -- [-1049.025] (-1049.331) (-1049.379) (-1051.273) * (-1052.641) (-1050.009) (-1050.622) [-1048.562] -- 0:00:16
754000 -- (-1051.482) [-1049.654] (-1049.514) (-1049.371) * (-1052.439) (-1050.392) (-1054.248) [-1045.767] -- 0:00:16
754500 -- (-1049.723) [-1049.636] (-1052.731) (-1048.863) * (-1048.548) (-1049.821) (-1048.759) [-1048.029] -- 0:00:16
755000 -- [-1052.263] (-1050.266) (-1049.085) (-1049.555) * [-1048.613] (-1048.134) (-1049.520) (-1049.562) -- 0:00:16
Average standard deviation of split frequencies: 0.009977
755500 -- (-1052.200) (-1048.426) [-1048.378] (-1051.415) * (-1052.498) [-1049.586] (-1048.835) (-1049.723) -- 0:00:16
756000 -- (-1047.949) [-1046.639] (-1050.865) (-1048.674) * (-1056.698) (-1050.039) [-1048.732] (-1048.465) -- 0:00:16
756500 -- (-1047.833) [-1050.360] (-1054.002) (-1049.469) * (-1052.560) (-1048.654) [-1048.355] (-1048.941) -- 0:00:16
757000 -- (-1048.240) [-1048.580] (-1050.522) (-1050.016) * (-1052.398) [-1051.732] (-1048.949) (-1048.362) -- 0:00:16
757500 -- (-1051.416) [-1051.029] (-1048.515) (-1048.484) * [-1051.756] (-1050.947) (-1049.481) (-1050.697) -- 0:00:16
758000 -- (-1050.292) [-1049.752] (-1048.415) (-1048.914) * (-1051.154) (-1048.638) [-1048.956] (-1048.920) -- 0:00:15
758500 -- (-1054.959) (-1051.296) (-1050.562) [-1049.897] * (-1049.461) (-1049.423) [-1053.247] (-1048.719) -- 0:00:15
759000 -- (-1049.040) [-1047.147] (-1048.789) (-1051.144) * (-1049.341) (-1049.314) (-1051.740) [-1049.506] -- 0:00:15
759500 -- (-1048.850) [-1048.891] (-1049.056) (-1053.061) * [-1048.800] (-1049.510) (-1050.039) (-1048.254) -- 0:00:16
760000 -- (-1052.493) [-1049.790] (-1051.591) (-1048.999) * (-1048.810) [-1049.205] (-1051.815) (-1049.675) -- 0:00:16
Average standard deviation of split frequencies: 0.010209
760500 -- (-1049.615) [-1048.798] (-1053.563) (-1049.501) * (-1051.411) (-1049.110) [-1053.053] (-1051.092) -- 0:00:16
761000 -- (-1049.077) (-1048.163) (-1050.020) [-1049.378] * [-1052.024] (-1052.484) (-1054.775) (-1050.377) -- 0:00:16
761500 -- [-1048.376] (-1047.968) (-1050.779) (-1049.714) * (-1052.027) (-1048.527) (-1049.480) [-1047.339] -- 0:00:15
762000 -- (-1048.591) (-1050.546) [-1050.118] (-1049.136) * (-1051.099) (-1049.550) (-1049.268) [-1046.960] -- 0:00:15
762500 -- (-1049.556) (-1050.834) [-1050.263] (-1048.845) * (-1050.407) [-1049.027] (-1048.927) (-1048.048) -- 0:00:15
763000 -- [-1050.405] (-1052.024) (-1052.742) (-1050.151) * (-1051.028) (-1049.796) [-1049.413] (-1050.068) -- 0:00:15
763500 -- (-1049.888) [-1048.650] (-1049.137) (-1050.463) * [-1052.329] (-1050.651) (-1049.199) (-1049.637) -- 0:00:15
764000 -- [-1052.329] (-1047.616) (-1048.527) (-1050.310) * (-1051.431) (-1047.395) (-1049.222) [-1050.808] -- 0:00:15
764500 -- (-1050.301) [-1048.109] (-1048.559) (-1051.526) * [-1049.592] (-1048.476) (-1051.349) (-1050.454) -- 0:00:15
765000 -- (-1052.438) (-1048.831) [-1049.829] (-1051.168) * (-1047.945) [-1051.034] (-1053.029) (-1052.234) -- 0:00:15
Average standard deviation of split frequencies: 0.010235
765500 -- (-1049.594) (-1047.389) [-1050.140] (-1048.925) * (-1048.742) [-1052.564] (-1050.468) (-1050.639) -- 0:00:15
766000 -- [-1048.856] (-1048.866) (-1055.747) (-1049.424) * (-1053.875) (-1050.831) (-1054.381) [-1052.260] -- 0:00:15
766500 -- (-1053.586) (-1049.817) (-1050.234) [-1048.968] * [-1051.668] (-1050.182) (-1050.185) (-1049.294) -- 0:00:15
767000 -- (-1054.115) [-1047.540] (-1049.302) (-1049.216) * [-1048.957] (-1049.785) (-1054.468) (-1049.899) -- 0:00:15
767500 -- (-1048.448) [-1048.155] (-1050.302) (-1050.996) * [-1048.647] (-1050.032) (-1050.836) (-1056.458) -- 0:00:15
768000 -- (-1049.191) (-1052.113) (-1051.539) [-1048.467] * (-1049.593) [-1048.583] (-1051.266) (-1058.499) -- 0:00:15
768500 -- (-1050.025) [-1052.883] (-1051.983) (-1050.318) * (-1049.418) [-1050.532] (-1051.064) (-1050.151) -- 0:00:15
769000 -- (-1050.347) (-1048.744) (-1049.118) [-1053.165] * (-1050.517) [-1050.975] (-1048.823) (-1049.777) -- 0:00:15
769500 -- (-1049.318) (-1046.589) [-1051.783] (-1048.187) * (-1050.243) [-1049.473] (-1051.290) (-1053.083) -- 0:00:15
770000 -- (-1049.389) (-1052.538) (-1050.233) [-1050.519] * (-1053.387) (-1050.807) (-1052.746) [-1049.974] -- 0:00:15
Average standard deviation of split frequencies: 0.010431
770500 -- (-1049.902) (-1048.574) (-1050.382) [-1049.450] * [-1050.184] (-1049.148) (-1051.239) (-1052.288) -- 0:00:15
771000 -- (-1048.452) [-1052.396] (-1052.511) (-1047.829) * (-1049.445) [-1052.330] (-1048.838) (-1049.811) -- 0:00:15
771500 -- (-1049.568) (-1048.751) [-1052.455] (-1048.318) * (-1049.398) (-1049.320) (-1048.971) [-1051.575] -- 0:00:15
772000 -- [-1049.390] (-1051.088) (-1051.721) (-1055.815) * (-1049.094) (-1051.909) [-1051.525] (-1055.520) -- 0:00:15
772500 -- [-1051.379] (-1051.966) (-1053.205) (-1053.537) * (-1053.948) (-1048.875) [-1049.953] (-1050.164) -- 0:00:15
773000 -- (-1050.435) (-1048.221) (-1052.538) [-1050.197] * (-1050.304) (-1050.653) [-1052.117] (-1049.216) -- 0:00:14
773500 -- (-1051.168) (-1047.345) (-1050.242) [-1052.055] * (-1052.425) (-1051.096) [-1047.934] (-1049.104) -- 0:00:14
774000 -- [-1046.847] (-1052.659) (-1051.567) (-1050.333) * (-1052.073) (-1049.650) (-1049.472) [-1047.047] -- 0:00:14
774500 -- (-1051.381) (-1050.623) [-1048.309] (-1047.981) * [-1049.405] (-1048.953) (-1051.005) (-1048.563) -- 0:00:15
775000 -- (-1050.163) (-1050.000) (-1051.919) [-1048.570] * (-1049.674) (-1051.012) (-1050.575) [-1051.865] -- 0:00:15
Average standard deviation of split frequencies: 0.010231
775500 -- (-1049.031) [-1050.710] (-1052.090) (-1048.801) * (-1050.023) (-1051.764) [-1048.774] (-1047.337) -- 0:00:15
776000 -- (-1048.945) (-1052.383) (-1049.571) [-1050.497] * [-1050.088] (-1050.069) (-1051.222) (-1049.307) -- 0:00:15
776500 -- (-1050.770) (-1051.152) [-1053.393] (-1048.904) * (-1047.162) (-1049.171) [-1051.457] (-1047.268) -- 0:00:14
777000 -- (-1050.176) (-1050.773) (-1051.527) [-1047.554] * (-1050.165) (-1051.333) [-1049.988] (-1050.005) -- 0:00:14
777500 -- [-1051.376] (-1050.513) (-1052.316) (-1049.423) * (-1052.706) (-1049.641) (-1052.185) [-1050.240] -- 0:00:14
778000 -- (-1054.698) (-1050.296) (-1049.699) [-1048.290] * (-1053.308) [-1054.095] (-1048.799) (-1050.973) -- 0:00:14
778500 -- [-1049.737] (-1049.362) (-1048.799) (-1048.343) * (-1049.567) [-1051.772] (-1050.150) (-1049.647) -- 0:00:14
779000 -- (-1048.196) (-1051.617) (-1048.842) [-1046.870] * (-1047.780) (-1049.658) [-1049.274] (-1046.557) -- 0:00:14
779500 -- (-1048.838) (-1049.199) [-1048.856] (-1047.657) * (-1051.430) [-1051.388] (-1052.908) (-1049.372) -- 0:00:14
780000 -- [-1047.950] (-1049.159) (-1050.226) (-1052.769) * (-1052.202) [-1048.678] (-1050.820) (-1050.705) -- 0:00:14
Average standard deviation of split frequencies: 0.009820
780500 -- [-1049.537] (-1051.696) (-1049.933) (-1052.045) * (-1050.668) (-1050.924) (-1048.792) [-1048.898] -- 0:00:14
781000 -- (-1047.219) (-1049.334) (-1050.574) [-1051.098] * [-1050.772] (-1049.273) (-1050.117) (-1048.405) -- 0:00:14
781500 -- [-1050.627] (-1052.734) (-1053.728) (-1048.486) * (-1051.559) (-1048.779) [-1051.315] (-1048.493) -- 0:00:14
782000 -- (-1050.032) [-1051.645] (-1053.467) (-1050.057) * (-1048.211) (-1051.519) [-1049.548] (-1048.808) -- 0:00:14
782500 -- [-1048.254] (-1051.736) (-1049.135) (-1051.842) * [-1049.034] (-1049.437) (-1056.659) (-1049.743) -- 0:00:14
783000 -- (-1051.832) [-1050.437] (-1049.160) (-1053.400) * [-1052.269] (-1048.353) (-1051.710) (-1048.927) -- 0:00:14
783500 -- (-1051.057) (-1053.303) (-1047.411) [-1049.109] * (-1049.488) (-1050.832) (-1051.220) [-1048.780] -- 0:00:14
784000 -- (-1049.518) [-1049.774] (-1049.575) (-1049.287) * [-1049.171] (-1048.709) (-1049.388) (-1048.600) -- 0:00:14
784500 -- (-1050.567) (-1049.695) [-1050.052] (-1047.948) * (-1051.841) (-1048.929) (-1050.718) [-1046.840] -- 0:00:14
785000 -- (-1049.833) (-1048.562) (-1050.614) [-1048.171] * [-1050.333] (-1049.426) (-1052.937) (-1047.351) -- 0:00:14
Average standard deviation of split frequencies: 0.009880
785500 -- [-1051.417] (-1046.692) (-1048.930) (-1049.986) * [-1048.184] (-1048.353) (-1050.895) (-1050.554) -- 0:00:14
786000 -- (-1051.116) (-1049.794) (-1051.359) [-1049.201] * (-1050.664) (-1048.984) (-1049.659) [-1047.052] -- 0:00:14
786500 -- (-1052.221) [-1049.739] (-1051.335) (-1052.130) * (-1049.365) (-1048.946) [-1049.582] (-1051.804) -- 0:00:14
787000 -- (-1054.762) [-1047.587] (-1048.693) (-1049.885) * [-1047.330] (-1047.762) (-1048.516) (-1049.854) -- 0:00:14
787500 -- (-1050.004) (-1051.950) [-1050.180] (-1050.395) * (-1048.820) (-1049.767) [-1049.659] (-1050.758) -- 0:00:14
788000 -- (-1052.714) (-1050.667) [-1048.684] (-1053.873) * [-1051.369] (-1050.265) (-1049.526) (-1051.488) -- 0:00:13
788500 -- (-1053.833) (-1049.762) (-1052.130) [-1049.330] * (-1051.965) (-1052.066) (-1049.444) [-1049.599] -- 0:00:13
789000 -- (-1051.595) [-1049.496] (-1048.782) (-1050.250) * (-1046.250) (-1051.107) (-1051.495) [-1049.364] -- 0:00:13
789500 -- (-1053.652) (-1050.072) [-1048.004] (-1051.296) * [-1047.571] (-1052.735) (-1052.390) (-1048.229) -- 0:00:13
790000 -- (-1050.722) (-1050.772) [-1048.907] (-1051.151) * (-1048.316) [-1050.477] (-1053.001) (-1049.150) -- 0:00:14
Average standard deviation of split frequencies: 0.009759
790500 -- (-1052.709) [-1051.428] (-1049.829) (-1050.964) * [-1048.832] (-1054.082) (-1049.284) (-1052.209) -- 0:00:14
791000 -- (-1049.036) (-1048.633) (-1049.518) [-1051.924] * (-1053.332) [-1049.046] (-1050.892) (-1052.717) -- 0:00:14
791500 -- [-1048.735] (-1050.403) (-1050.258) (-1056.024) * (-1048.547) [-1053.355] (-1048.809) (-1048.744) -- 0:00:13
792000 -- (-1051.576) (-1046.242) [-1051.640] (-1051.183) * (-1049.368) (-1049.790) (-1050.303) [-1051.978] -- 0:00:13
792500 -- (-1051.164) (-1049.223) (-1053.380) [-1050.355] * [-1050.119] (-1051.134) (-1047.162) (-1050.756) -- 0:00:13
793000 -- (-1052.051) (-1050.236) (-1048.472) [-1048.963] * [-1050.505] (-1049.427) (-1048.692) (-1048.380) -- 0:00:13
793500 -- (-1049.170) (-1048.741) (-1049.869) [-1049.172] * [-1048.743] (-1050.857) (-1050.128) (-1047.682) -- 0:00:13
794000 -- [-1050.332] (-1049.107) (-1052.911) (-1048.134) * (-1047.281) [-1049.941] (-1048.949) (-1048.323) -- 0:00:13
794500 -- (-1049.504) (-1051.359) [-1052.134] (-1050.538) * [-1044.410] (-1052.406) (-1049.176) (-1048.072) -- 0:00:13
795000 -- [-1050.701] (-1051.854) (-1049.957) (-1051.427) * (-1048.068) (-1051.183) [-1049.054] (-1049.858) -- 0:00:13
Average standard deviation of split frequencies: 0.009382
795500 -- [-1048.541] (-1048.677) (-1051.851) (-1053.825) * (-1048.180) (-1052.867) (-1048.900) [-1050.027] -- 0:00:13
796000 -- (-1048.003) (-1048.899) (-1050.457) [-1049.478] * (-1049.432) (-1055.927) [-1048.536] (-1049.499) -- 0:00:13
796500 -- [-1051.442] (-1049.878) (-1050.958) (-1050.828) * (-1050.097) (-1056.686) [-1048.362] (-1049.389) -- 0:00:13
797000 -- (-1052.406) (-1049.237) [-1050.044] (-1047.312) * [-1047.823] (-1053.275) (-1049.459) (-1048.658) -- 0:00:13
797500 -- [-1048.716] (-1051.826) (-1051.372) (-1054.078) * (-1050.947) (-1054.326) (-1048.987) [-1051.430] -- 0:00:13
798000 -- (-1048.777) (-1050.686) [-1050.864] (-1054.139) * [-1049.919] (-1053.394) (-1047.646) (-1050.381) -- 0:00:13
798500 -- [-1050.852] (-1047.320) (-1049.801) (-1050.058) * [-1049.674] (-1050.273) (-1051.440) (-1051.299) -- 0:00:13
799000 -- (-1048.856) (-1048.793) [-1048.524] (-1049.160) * (-1051.474) (-1052.132) [-1050.430] (-1047.531) -- 0:00:13
799500 -- (-1048.297) (-1049.135) (-1048.562) [-1050.940] * (-1049.801) (-1054.446) (-1048.094) [-1049.624] -- 0:00:13
800000 -- (-1049.035) [-1054.512] (-1048.063) (-1049.730) * (-1047.952) (-1055.104) [-1048.808] (-1050.302) -- 0:00:13
Average standard deviation of split frequencies: 0.009389
800500 -- [-1049.333] (-1049.678) (-1050.738) (-1048.034) * (-1048.477) (-1049.385) (-1048.733) [-1047.524] -- 0:00:13
801000 -- (-1049.423) [-1052.726] (-1049.761) (-1051.198) * (-1049.183) (-1049.804) (-1048.688) [-1048.639] -- 0:00:13
801500 -- [-1051.515] (-1050.393) (-1050.461) (-1050.144) * (-1053.529) (-1048.515) [-1047.569] (-1046.195) -- 0:00:13
802000 -- [-1049.366] (-1051.333) (-1049.746) (-1049.880) * (-1048.552) (-1048.510) (-1050.075) [-1048.331] -- 0:00:13
802500 -- [-1047.177] (-1049.844) (-1047.294) (-1049.654) * [-1055.254] (-1049.197) (-1050.574) (-1047.792) -- 0:00:13
803000 -- [-1049.564] (-1053.863) (-1051.175) (-1049.144) * (-1053.871) (-1052.462) [-1049.927] (-1050.170) -- 0:00:13
803500 -- [-1049.795] (-1048.232) (-1050.316) (-1048.730) * (-1048.453) (-1052.583) [-1049.189] (-1050.267) -- 0:00:12
804000 -- (-1050.354) (-1047.955) [-1049.074] (-1048.192) * (-1054.241) [-1050.886] (-1048.596) (-1047.865) -- 0:00:12
804500 -- [-1048.826] (-1048.304) (-1054.645) (-1050.597) * (-1053.221) (-1052.862) (-1049.938) [-1048.877] -- 0:00:12
805000 -- (-1047.664) (-1048.776) (-1054.382) [-1048.975] * [-1049.008] (-1054.072) (-1049.936) (-1049.456) -- 0:00:13
Average standard deviation of split frequencies: 0.009142
805500 -- (-1051.761) (-1050.538) (-1053.240) [-1049.317] * (-1052.206) (-1056.773) (-1049.150) [-1046.588] -- 0:00:13
806000 -- [-1049.933] (-1050.508) (-1050.885) (-1049.830) * (-1051.652) (-1049.678) [-1057.434] (-1049.679) -- 0:00:12
806500 -- (-1048.684) (-1055.256) (-1052.116) [-1046.982] * [-1050.728] (-1054.853) (-1052.460) (-1047.988) -- 0:00:12
807000 -- (-1050.986) (-1051.683) [-1049.360] (-1047.691) * [-1050.365] (-1051.320) (-1053.015) (-1053.359) -- 0:00:12
807500 -- (-1046.614) (-1052.519) [-1053.923] (-1048.710) * (-1047.682) [-1047.999] (-1050.778) (-1051.920) -- 0:00:12
808000 -- (-1047.478) [-1047.880] (-1049.439) (-1050.955) * (-1048.859) [-1051.733] (-1052.505) (-1050.846) -- 0:00:12
808500 -- (-1052.805) (-1049.796) [-1051.729] (-1048.595) * (-1051.654) (-1049.499) [-1046.118] (-1049.766) -- 0:00:12
809000 -- (-1047.521) (-1049.688) (-1051.897) [-1047.403] * (-1050.593) (-1049.364) (-1051.214) [-1050.851] -- 0:00:12
809500 -- (-1049.031) [-1052.128] (-1051.173) (-1051.067) * [-1050.088] (-1049.728) (-1054.222) (-1053.180) -- 0:00:12
810000 -- [-1049.264] (-1051.207) (-1052.245) (-1048.865) * (-1048.830) (-1049.031) (-1051.647) [-1053.196] -- 0:00:12
Average standard deviation of split frequencies: 0.009335
810500 -- [-1048.981] (-1048.857) (-1049.412) (-1051.680) * [-1050.139] (-1048.988) (-1048.251) (-1050.558) -- 0:00:12
811000 -- (-1048.421) (-1053.682) [-1049.507] (-1050.232) * (-1050.936) (-1049.275) [-1049.932] (-1048.956) -- 0:00:12
811500 -- (-1051.543) [-1048.993] (-1049.916) (-1046.817) * (-1051.116) (-1052.052) (-1048.606) [-1049.347] -- 0:00:12
812000 -- (-1052.654) (-1048.897) (-1048.773) [-1049.138] * (-1052.776) (-1048.836) [-1049.506] (-1049.523) -- 0:00:12
812500 -- (-1050.613) (-1050.305) [-1050.396] (-1049.299) * (-1047.822) [-1049.154] (-1049.745) (-1049.711) -- 0:00:12
813000 -- [-1048.948] (-1048.967) (-1049.694) (-1049.082) * (-1051.953) (-1049.366) (-1050.689) [-1047.971] -- 0:00:12
813500 -- [-1049.918] (-1052.213) (-1051.781) (-1048.966) * (-1049.731) (-1054.184) [-1049.221] (-1054.144) -- 0:00:12
814000 -- (-1048.538) [-1047.331] (-1049.147) (-1052.520) * (-1049.257) (-1055.269) [-1047.901] (-1050.338) -- 0:00:12
814500 -- (-1049.090) [-1048.604] (-1052.527) (-1048.477) * (-1055.280) (-1052.255) [-1049.109] (-1050.123) -- 0:00:12
815000 -- (-1053.180) (-1050.249) (-1049.995) [-1048.041] * (-1053.297) (-1050.352) [-1050.392] (-1050.703) -- 0:00:12
Average standard deviation of split frequencies: 0.009091
815500 -- (-1050.263) [-1049.978] (-1048.584) (-1050.852) * (-1052.705) (-1048.980) [-1049.476] (-1050.143) -- 0:00:12
816000 -- [-1048.218] (-1051.611) (-1051.796) (-1047.871) * [-1050.258] (-1058.463) (-1049.921) (-1050.604) -- 0:00:12
816500 -- [-1048.281] (-1051.536) (-1051.963) (-1045.706) * (-1048.766) (-1049.864) [-1049.491] (-1055.871) -- 0:00:12
817000 -- (-1049.714) (-1049.897) (-1048.572) [-1047.391] * (-1048.413) [-1049.592] (-1048.873) (-1051.248) -- 0:00:12
817500 -- (-1050.555) (-1050.521) [-1047.974] (-1049.831) * (-1052.295) (-1049.708) [-1051.663] (-1049.379) -- 0:00:12
818000 -- [-1045.065] (-1051.090) (-1051.177) (-1050.010) * (-1049.606) [-1048.781] (-1053.465) (-1049.642) -- 0:00:12
818500 -- (-1049.528) [-1049.483] (-1053.923) (-1047.875) * (-1049.723) [-1048.501] (-1050.174) (-1053.633) -- 0:00:11
819000 -- (-1051.983) [-1051.053] (-1050.445) (-1047.736) * (-1047.172) (-1048.901) (-1050.252) [-1051.290] -- 0:00:11
819500 -- (-1048.887) (-1052.294) (-1048.333) [-1048.637] * (-1048.569) [-1046.894] (-1050.354) (-1051.170) -- 0:00:11
820000 -- [-1049.405] (-1049.262) (-1050.294) (-1050.681) * (-1049.856) (-1049.406) (-1050.416) [-1050.603] -- 0:00:12
Average standard deviation of split frequencies: 0.008737
820500 -- (-1049.316) (-1050.595) (-1052.369) [-1049.204] * (-1052.598) (-1050.627) [-1050.217] (-1047.559) -- 0:00:12
821000 -- [-1050.010] (-1049.039) (-1053.306) (-1049.953) * [-1048.684] (-1050.828) (-1049.431) (-1050.449) -- 0:00:11
821500 -- (-1049.911) [-1049.202] (-1048.748) (-1046.139) * (-1049.499) (-1050.222) [-1052.280] (-1050.237) -- 0:00:11
822000 -- (-1050.598) [-1054.065] (-1049.333) (-1048.891) * [-1049.509] (-1048.654) (-1048.735) (-1051.321) -- 0:00:11
822500 -- (-1052.957) (-1051.975) [-1050.740] (-1051.370) * (-1049.346) (-1048.530) [-1048.554] (-1051.073) -- 0:00:11
823000 -- (-1049.858) [-1053.865] (-1051.135) (-1049.969) * (-1048.762) [-1049.410] (-1049.375) (-1050.345) -- 0:00:11
823500 -- (-1051.750) (-1047.831) [-1046.784] (-1049.448) * (-1050.890) (-1050.232) [-1050.139] (-1050.743) -- 0:00:11
824000 -- (-1050.861) [-1049.005] (-1049.004) (-1048.548) * (-1052.455) (-1049.557) [-1048.059] (-1053.702) -- 0:00:11
824500 -- (-1050.835) [-1048.157] (-1050.427) (-1049.092) * (-1052.715) (-1050.360) (-1051.647) [-1048.062] -- 0:00:11
825000 -- [-1052.765] (-1049.495) (-1051.630) (-1047.921) * (-1048.305) [-1050.050] (-1049.755) (-1048.917) -- 0:00:11
Average standard deviation of split frequencies: 0.008891
825500 -- (-1049.131) (-1048.993) (-1050.051) [-1051.651] * (-1053.039) [-1049.295] (-1050.688) (-1048.432) -- 0:00:11
826000 -- (-1048.922) [-1048.613] (-1050.812) (-1048.371) * [-1051.351] (-1055.095) (-1049.762) (-1049.227) -- 0:00:11
826500 -- (-1050.617) [-1048.137] (-1048.700) (-1047.960) * [-1049.437] (-1053.626) (-1049.957) (-1048.082) -- 0:00:11
827000 -- (-1050.177) (-1048.733) (-1047.345) [-1048.048] * (-1049.578) (-1054.445) (-1053.717) [-1049.098] -- 0:00:11
827500 -- (-1051.430) (-1049.590) [-1049.447] (-1047.580) * (-1049.346) (-1050.557) [-1048.836] (-1050.675) -- 0:00:11
828000 -- (-1050.979) [-1050.160] (-1049.176) (-1050.868) * (-1048.890) [-1050.486] (-1053.030) (-1051.054) -- 0:00:11
828500 -- [-1049.765] (-1050.837) (-1048.696) (-1049.167) * [-1048.470] (-1050.848) (-1049.830) (-1056.438) -- 0:00:11
829000 -- (-1055.282) (-1052.058) (-1049.282) [-1047.395] * (-1048.490) (-1049.661) [-1048.482] (-1050.786) -- 0:00:11
829500 -- (-1053.474) [-1053.618] (-1048.806) (-1050.479) * [-1050.441] (-1048.666) (-1048.026) (-1048.602) -- 0:00:11
830000 -- [-1049.910] (-1054.843) (-1050.670) (-1055.544) * [-1049.420] (-1050.791) (-1051.208) (-1051.896) -- 0:00:11
Average standard deviation of split frequencies: 0.008423
830500 -- (-1049.816) (-1047.622) [-1051.088] (-1052.378) * (-1048.965) [-1048.159] (-1048.877) (-1050.514) -- 0:00:11
831000 -- [-1049.497] (-1051.874) (-1046.819) (-1049.318) * (-1049.255) (-1050.341) [-1048.688] (-1050.381) -- 0:00:11
831500 -- (-1054.499) (-1052.033) (-1051.678) [-1048.612] * (-1049.998) (-1051.584) [-1047.106] (-1051.854) -- 0:00:11
832000 -- (-1051.288) (-1050.323) [-1046.825] (-1048.439) * (-1052.984) [-1057.673] (-1047.329) (-1050.561) -- 0:00:11
832500 -- (-1051.928) (-1050.133) [-1049.279] (-1048.236) * [-1049.059] (-1049.493) (-1050.905) (-1051.855) -- 0:00:11
833000 -- (-1048.923) [-1049.374] (-1049.571) (-1047.667) * (-1048.849) (-1050.596) (-1048.754) [-1052.006] -- 0:00:11
833500 -- (-1046.131) [-1050.509] (-1051.712) (-1049.988) * (-1049.265) (-1047.790) [-1049.329] (-1052.709) -- 0:00:10
834000 -- (-1049.418) [-1049.161] (-1047.824) (-1049.856) * (-1051.401) (-1049.550) [-1049.018] (-1051.652) -- 0:00:10
834500 -- [-1049.605] (-1050.198) (-1051.658) (-1050.527) * (-1051.784) (-1051.017) (-1051.202) [-1049.532] -- 0:00:10
835000 -- (-1048.802) (-1051.373) [-1048.783] (-1048.081) * (-1050.007) (-1048.824) (-1051.785) [-1047.082] -- 0:00:11
Average standard deviation of split frequencies: 0.008696
835500 -- (-1049.251) (-1055.868) [-1048.029] (-1049.075) * [-1047.920] (-1055.184) (-1050.065) (-1047.767) -- 0:00:11
836000 -- (-1049.634) [-1052.452] (-1048.716) (-1050.087) * (-1048.573) [-1054.288] (-1049.939) (-1048.516) -- 0:00:10
836500 -- (-1048.060) (-1048.628) [-1049.090] (-1049.944) * (-1049.639) (-1050.088) [-1051.829] (-1048.794) -- 0:00:10
837000 -- (-1051.659) [-1049.387] (-1048.915) (-1050.692) * (-1049.092) (-1048.972) [-1049.374] (-1048.899) -- 0:00:10
837500 -- (-1053.294) (-1051.200) [-1047.341] (-1049.547) * (-1049.981) [-1048.993] (-1048.107) (-1047.164) -- 0:00:10
838000 -- (-1048.892) (-1050.433) [-1048.277] (-1049.911) * (-1048.492) (-1050.161) (-1049.739) [-1048.479] -- 0:00:10
838500 -- (-1048.480) (-1050.078) (-1052.851) [-1050.159] * (-1050.885) [-1051.894] (-1054.138) (-1049.813) -- 0:00:10
839000 -- (-1048.946) (-1048.564) [-1052.681] (-1049.179) * (-1052.571) (-1053.950) (-1051.731) [-1049.303] -- 0:00:10
839500 -- (-1053.942) [-1049.815] (-1051.418) (-1051.668) * (-1051.791) (-1053.336) (-1046.448) [-1050.199] -- 0:00:10
840000 -- [-1056.260] (-1049.252) (-1051.647) (-1051.974) * (-1050.302) (-1052.091) [-1050.467] (-1045.349) -- 0:00:10
Average standard deviation of split frequencies: 0.008500
840500 -- (-1049.879) (-1048.697) (-1051.360) [-1053.412] * (-1050.839) (-1050.027) [-1050.863] (-1048.901) -- 0:00:10
841000 -- [-1053.338] (-1048.638) (-1047.403) (-1052.852) * [-1049.993] (-1048.987) (-1052.720) (-1052.809) -- 0:00:10
841500 -- (-1050.234) [-1046.788] (-1049.913) (-1049.204) * (-1051.915) (-1050.991) (-1051.588) [-1050.092] -- 0:00:10
842000 -- [-1050.838] (-1049.616) (-1050.935) (-1048.093) * (-1050.272) (-1050.033) [-1048.858] (-1051.443) -- 0:00:10
842500 -- (-1050.936) [-1055.776] (-1048.077) (-1048.965) * (-1049.280) (-1047.480) [-1050.667] (-1048.508) -- 0:00:10
843000 -- (-1049.652) (-1051.532) [-1050.313] (-1048.857) * (-1048.247) (-1049.733) [-1050.185] (-1050.023) -- 0:00:10
843500 -- (-1051.523) (-1050.989) [-1050.342] (-1046.992) * (-1050.555) (-1049.617) (-1049.475) [-1048.999] -- 0:00:10
844000 -- [-1050.417] (-1050.640) (-1052.196) (-1050.199) * (-1050.286) [-1053.888] (-1049.017) (-1049.196) -- 0:00:10
844500 -- (-1050.280) [-1048.385] (-1051.613) (-1049.714) * (-1051.680) (-1049.460) [-1049.138] (-1048.268) -- 0:00:10
845000 -- (-1050.500) (-1049.194) (-1052.285) [-1047.784] * (-1048.005) (-1049.509) (-1051.610) [-1045.679] -- 0:00:10
Average standard deviation of split frequencies: 0.008769
845500 -- (-1049.754) (-1049.257) (-1050.321) [-1050.499] * [-1048.049] (-1051.644) (-1051.757) (-1051.057) -- 0:00:10
846000 -- (-1047.927) (-1050.286) (-1048.241) [-1046.346] * (-1051.169) [-1052.645] (-1052.635) (-1048.441) -- 0:00:10
846500 -- (-1049.501) (-1048.576) (-1049.532) [-1051.827] * (-1052.064) [-1051.997] (-1056.628) (-1051.965) -- 0:00:10
847000 -- (-1049.105) (-1049.758) (-1050.485) [-1055.419] * (-1053.876) (-1049.412) (-1051.699) [-1047.713] -- 0:00:10
847500 -- (-1050.029) (-1049.600) [-1049.410] (-1049.941) * (-1052.793) (-1050.411) [-1047.221] (-1049.226) -- 0:00:10
848000 -- (-1047.844) [-1051.500] (-1049.119) (-1049.095) * (-1048.404) (-1052.379) (-1050.207) [-1048.190] -- 0:00:10
848500 -- (-1048.831) (-1057.793) [-1050.013] (-1051.660) * (-1053.589) (-1049.371) [-1046.013] (-1046.962) -- 0:00:09
849000 -- (-1049.077) (-1051.755) (-1050.020) [-1048.119] * (-1049.693) [-1049.591] (-1047.422) (-1053.143) -- 0:00:09
849500 -- (-1048.754) (-1049.002) (-1051.959) [-1050.293] * (-1047.579) [-1050.145] (-1046.149) (-1053.560) -- 0:00:09
850000 -- [-1049.323] (-1052.443) (-1050.083) (-1049.935) * (-1046.218) (-1049.222) [-1047.999] (-1050.220) -- 0:00:10
Average standard deviation of split frequencies: 0.009158
850500 -- [-1050.165] (-1050.009) (-1050.571) (-1048.074) * (-1050.236) [-1051.886] (-1048.181) (-1048.329) -- 0:00:10
851000 -- (-1049.363) (-1049.614) [-1050.431] (-1051.815) * [-1047.902] (-1050.051) (-1048.256) (-1050.764) -- 0:00:09
851500 -- [-1049.022] (-1052.214) (-1049.943) (-1048.811) * [-1048.807] (-1049.948) (-1048.949) (-1049.068) -- 0:00:09
852000 -- (-1049.575) (-1051.656) (-1049.609) [-1048.297] * (-1049.137) (-1050.628) (-1052.493) [-1050.573] -- 0:00:09
852500 -- (-1049.549) (-1048.053) [-1050.312] (-1050.279) * (-1050.024) (-1050.515) [-1050.745] (-1048.642) -- 0:00:09
853000 -- (-1050.904) [-1052.936] (-1053.204) (-1051.170) * (-1055.478) (-1048.221) (-1051.089) [-1049.063] -- 0:00:09
853500 -- (-1053.975) (-1050.825) (-1057.371) [-1048.704] * [-1048.833] (-1052.308) (-1051.582) (-1052.821) -- 0:00:09
854000 -- (-1051.463) (-1050.956) (-1051.037) [-1047.869] * (-1048.625) [-1048.685] (-1049.511) (-1047.284) -- 0:00:09
854500 -- (-1051.257) (-1051.754) (-1051.007) [-1050.225] * [-1048.217] (-1051.576) (-1051.323) (-1048.540) -- 0:00:09
855000 -- (-1051.142) (-1050.681) [-1049.002] (-1049.280) * (-1051.925) [-1052.518] (-1048.378) (-1048.881) -- 0:00:09
Average standard deviation of split frequencies: 0.009362
855500 -- (-1052.297) [-1049.483] (-1051.764) (-1050.088) * [-1047.874] (-1046.640) (-1046.262) (-1050.327) -- 0:00:09
856000 -- (-1046.907) (-1051.354) [-1049.257] (-1047.549) * (-1049.463) [-1049.236] (-1049.907) (-1048.390) -- 0:00:09
856500 -- (-1048.429) (-1050.317) (-1050.999) [-1049.184] * (-1049.548) (-1048.419) (-1049.481) [-1048.243] -- 0:00:09
857000 -- (-1049.203) (-1051.378) [-1051.853] (-1053.287) * (-1050.468) (-1048.871) [-1050.452] (-1048.290) -- 0:00:09
857500 -- [-1049.653] (-1052.616) (-1052.714) (-1050.369) * (-1049.802) (-1048.466) (-1050.217) [-1048.801] -- 0:00:09
858000 -- (-1050.257) [-1051.359] (-1051.270) (-1049.278) * (-1049.198) (-1051.510) (-1052.913) [-1048.139] -- 0:00:09
858500 -- (-1051.513) [-1048.644] (-1048.901) (-1051.797) * (-1048.814) (-1052.362) (-1050.547) [-1049.294] -- 0:00:09
859000 -- (-1051.134) (-1047.819) (-1048.625) [-1049.767] * (-1052.471) (-1054.706) [-1048.298] (-1049.511) -- 0:00:09
859500 -- (-1051.816) (-1050.818) [-1048.868] (-1050.627) * (-1048.617) (-1054.708) (-1048.542) [-1048.397] -- 0:00:09
860000 -- [-1050.612] (-1049.913) (-1050.351) (-1048.565) * (-1054.083) (-1055.705) (-1049.850) [-1047.973] -- 0:00:09
Average standard deviation of split frequencies: 0.009311
860500 -- (-1055.499) (-1050.952) [-1048.470] (-1046.213) * (-1050.116) [-1047.740] (-1049.029) (-1049.873) -- 0:00:09
861000 -- (-1051.496) (-1050.605) (-1048.463) [-1048.744] * [-1052.542] (-1049.880) (-1051.113) (-1054.267) -- 0:00:09
861500 -- [-1048.534] (-1048.521) (-1049.062) (-1048.637) * (-1050.959) [-1047.675] (-1047.173) (-1048.504) -- 0:00:09
862000 -- [-1048.925] (-1051.212) (-1051.339) (-1044.739) * (-1047.893) (-1053.990) [-1049.538] (-1048.075) -- 0:00:09
862500 -- (-1049.200) (-1049.510) [-1050.850] (-1052.036) * (-1049.909) (-1050.139) (-1048.670) [-1047.120] -- 0:00:09
863000 -- (-1050.694) [-1047.344] (-1049.307) (-1047.408) * (-1049.257) (-1051.099) [-1049.227] (-1049.096) -- 0:00:09
863500 -- (-1051.385) (-1050.486) (-1051.885) [-1049.214] * (-1047.958) (-1049.566) [-1049.312] (-1047.692) -- 0:00:09
864000 -- [-1048.971] (-1050.115) (-1051.524) (-1049.248) * (-1047.892) (-1048.090) (-1049.247) [-1047.755] -- 0:00:08
864500 -- (-1047.917) [-1049.075] (-1050.198) (-1046.121) * (-1045.004) [-1048.757] (-1048.996) (-1048.997) -- 0:00:08
865000 -- (-1051.269) (-1050.745) (-1049.714) [-1049.716] * (-1048.180) (-1052.442) [-1049.165] (-1050.875) -- 0:00:09
Average standard deviation of split frequencies: 0.009483
865500 -- [-1051.883] (-1049.327) (-1048.569) (-1050.896) * (-1049.228) (-1050.208) (-1052.534) [-1050.910] -- 0:00:09
866000 -- [-1050.522] (-1050.569) (-1050.155) (-1048.636) * (-1047.503) [-1049.551] (-1049.619) (-1052.163) -- 0:00:08
866500 -- (-1051.554) (-1053.833) [-1047.824] (-1047.470) * (-1050.414) (-1049.492) (-1048.564) [-1051.983] -- 0:00:08
867000 -- [-1048.260] (-1049.665) (-1049.266) (-1047.975) * (-1050.874) (-1050.565) [-1049.493] (-1052.932) -- 0:00:08
867500 -- (-1046.655) (-1051.064) (-1049.045) [-1047.472] * [-1050.669] (-1054.152) (-1052.300) (-1049.454) -- 0:00:08
868000 -- (-1051.739) [-1048.479] (-1048.712) (-1050.411) * [-1046.966] (-1051.282) (-1051.580) (-1052.191) -- 0:00:08
868500 -- (-1048.943) (-1048.884) (-1050.847) [-1051.927] * [-1049.355] (-1051.008) (-1048.903) (-1049.323) -- 0:00:08
869000 -- (-1052.611) (-1048.151) [-1049.144] (-1049.617) * (-1047.410) (-1049.844) (-1049.637) [-1048.767] -- 0:00:08
869500 -- (-1049.903) [-1048.991] (-1051.933) (-1051.345) * (-1048.158) (-1049.864) (-1048.872) [-1050.110] -- 0:00:08
870000 -- (-1049.224) (-1052.488) (-1049.814) [-1049.278] * (-1047.141) (-1050.108) [-1054.926] (-1049.095) -- 0:00:08
Average standard deviation of split frequencies: 0.009489
870500 -- (-1048.292) (-1048.187) (-1047.447) [-1049.760] * [-1048.940] (-1051.109) (-1050.060) (-1052.323) -- 0:00:08
871000 -- (-1049.179) (-1049.691) (-1050.624) [-1049.549] * [-1047.636] (-1050.121) (-1051.313) (-1048.642) -- 0:00:08
871500 -- (-1047.907) (-1049.077) [-1052.021] (-1053.230) * (-1050.183) [-1049.187] (-1048.084) (-1056.256) -- 0:00:08
872000 -- (-1048.565) (-1050.631) [-1051.747] (-1050.974) * [-1052.847] (-1055.487) (-1051.121) (-1051.087) -- 0:00:08
872500 -- (-1051.937) (-1049.859) (-1055.006) [-1048.343] * (-1051.903) [-1049.150] (-1048.864) (-1051.710) -- 0:00:08
873000 -- [-1050.308] (-1049.738) (-1054.500) (-1056.334) * (-1049.221) (-1048.274) [-1049.407] (-1050.952) -- 0:00:08
873500 -- [-1049.075] (-1054.071) (-1052.226) (-1054.471) * (-1051.257) (-1048.287) (-1047.916) [-1049.976] -- 0:00:08
874000 -- (-1049.925) [-1050.019] (-1049.148) (-1050.646) * (-1048.183) [-1047.344] (-1047.696) (-1050.796) -- 0:00:08
874500 -- (-1049.197) (-1049.114) [-1049.068] (-1049.945) * (-1051.746) [-1051.688] (-1046.351) (-1049.737) -- 0:00:08
875000 -- (-1049.009) [-1048.211] (-1053.131) (-1052.944) * (-1051.156) [-1049.845] (-1049.877) (-1049.565) -- 0:00:08
Average standard deviation of split frequencies: 0.009658
875500 -- (-1049.838) [-1049.827] (-1052.948) (-1049.769) * (-1049.429) [-1050.424] (-1051.931) (-1053.973) -- 0:00:08
876000 -- [-1049.188] (-1048.025) (-1051.981) (-1050.651) * [-1048.531] (-1052.689) (-1051.286) (-1054.782) -- 0:00:08
876500 -- (-1051.536) [-1046.660] (-1051.072) (-1049.352) * [-1049.619] (-1049.591) (-1051.640) (-1053.386) -- 0:00:08
877000 -- (-1051.399) [-1049.449] (-1054.543) (-1052.251) * (-1050.249) (-1049.895) (-1048.484) [-1049.312] -- 0:00:08
877500 -- (-1049.577) (-1055.231) (-1053.325) [-1051.467] * (-1047.986) (-1051.279) (-1049.853) [-1048.751] -- 0:00:08
878000 -- [-1050.156] (-1048.696) (-1052.276) (-1055.254) * (-1049.981) (-1051.834) [-1050.552] (-1050.951) -- 0:00:08
878500 -- (-1050.987) (-1053.796) (-1049.179) [-1048.420] * (-1051.003) [-1049.594] (-1054.540) (-1050.243) -- 0:00:08
879000 -- (-1049.788) (-1049.089) [-1048.337] (-1051.034) * (-1051.350) (-1050.881) (-1051.165) [-1050.125] -- 0:00:07
879500 -- (-1047.922) [-1048.697] (-1050.872) (-1048.820) * (-1052.225) (-1046.278) [-1050.113] (-1050.734) -- 0:00:07
880000 -- (-1049.714) (-1049.213) (-1052.713) [-1046.546] * (-1050.289) [-1049.752] (-1053.473) (-1053.175) -- 0:00:08
Average standard deviation of split frequencies: 0.009691
880500 -- (-1049.358) (-1048.692) [-1050.774] (-1048.425) * (-1049.645) (-1050.181) (-1047.837) [-1051.553] -- 0:00:08
881000 -- (-1049.356) (-1049.400) (-1049.882) [-1047.147] * (-1049.795) (-1048.899) (-1056.572) [-1051.551] -- 0:00:07
881500 -- (-1049.467) (-1049.634) (-1050.170) [-1050.032] * (-1052.100) (-1049.101) [-1049.397] (-1048.799) -- 0:00:07
882000 -- (-1050.135) [-1051.704] (-1049.770) (-1052.718) * (-1048.700) [-1047.660] (-1053.344) (-1049.118) -- 0:00:07
882500 -- (-1046.731) (-1049.205) (-1047.914) [-1048.632] * (-1057.258) (-1048.874) (-1053.172) [-1049.357] -- 0:00:07
883000 -- (-1050.456) (-1047.966) (-1048.976) [-1051.467] * (-1051.186) (-1049.097) [-1049.824] (-1049.914) -- 0:00:07
883500 -- [-1047.004] (-1049.604) (-1048.877) (-1047.710) * (-1050.555) [-1048.442] (-1052.241) (-1050.249) -- 0:00:07
884000 -- (-1049.188) (-1048.790) (-1049.497) [-1049.184] * (-1051.401) [-1049.425] (-1051.192) (-1049.862) -- 0:00:07
884500 -- [-1050.792] (-1051.188) (-1049.049) (-1050.914) * (-1048.961) [-1048.369] (-1048.152) (-1055.401) -- 0:00:07
885000 -- (-1048.938) (-1048.173) [-1049.476] (-1047.858) * [-1049.303] (-1049.442) (-1050.010) (-1049.903) -- 0:00:07
Average standard deviation of split frequencies: 0.009941
885500 -- (-1047.365) [-1048.896] (-1049.255) (-1048.540) * (-1052.257) [-1047.377] (-1050.167) (-1052.282) -- 0:00:07
886000 -- (-1047.752) (-1049.493) (-1054.192) [-1047.920] * [-1048.650] (-1053.488) (-1048.672) (-1049.127) -- 0:00:07
886500 -- [-1049.521] (-1051.868) (-1048.837) (-1052.245) * (-1048.365) (-1051.406) (-1047.173) [-1049.700] -- 0:00:07
887000 -- (-1050.544) [-1050.067] (-1049.102) (-1048.842) * [-1048.379] (-1050.463) (-1049.871) (-1053.997) -- 0:00:07
887500 -- (-1051.217) (-1051.357) (-1049.723) [-1050.319] * (-1050.264) [-1046.755] (-1052.798) (-1051.798) -- 0:00:07
888000 -- (-1048.216) (-1049.429) (-1053.938) [-1049.920] * (-1050.921) [-1050.233] (-1049.654) (-1050.572) -- 0:00:07
888500 -- (-1051.626) (-1049.615) (-1049.765) [-1049.015] * (-1051.465) (-1051.401) [-1050.011] (-1050.265) -- 0:00:07
889000 -- (-1049.973) (-1050.293) [-1049.356] (-1049.477) * [-1049.345] (-1052.618) (-1050.134) (-1048.099) -- 0:00:07
889500 -- (-1050.367) (-1048.526) (-1048.604) [-1050.937] * (-1047.972) (-1050.691) (-1050.588) [-1049.270] -- 0:00:07
890000 -- (-1049.415) [-1049.918] (-1050.112) (-1049.115) * (-1049.613) (-1050.509) (-1053.286) [-1050.205] -- 0:00:07
Average standard deviation of split frequencies: 0.009750
890500 -- (-1050.419) (-1056.547) [-1049.652] (-1049.468) * (-1047.417) (-1047.452) [-1052.200] (-1050.328) -- 0:00:07
891000 -- (-1051.441) (-1051.012) [-1047.425] (-1051.160) * (-1049.606) [-1052.540] (-1048.231) (-1052.117) -- 0:00:07
891500 -- (-1049.842) (-1049.855) [-1049.460] (-1050.025) * [-1049.213] (-1054.888) (-1048.971) (-1051.589) -- 0:00:07
892000 -- (-1051.925) [-1050.118] (-1049.882) (-1056.317) * (-1048.694) (-1052.869) [-1048.801] (-1049.244) -- 0:00:07
892500 -- (-1050.976) [-1050.482] (-1049.757) (-1050.717) * (-1050.064) (-1055.342) [-1051.404] (-1051.119) -- 0:00:07
893000 -- (-1049.122) [-1050.029] (-1050.553) (-1047.047) * [-1049.498] (-1049.460) (-1049.063) (-1048.591) -- 0:00:07
893500 -- [-1051.721] (-1049.994) (-1049.906) (-1052.436) * (-1048.450) (-1049.047) (-1050.503) [-1049.686] -- 0:00:07
894000 -- (-1050.209) [-1048.673] (-1049.153) (-1050.765) * (-1049.281) (-1051.288) [-1049.562] (-1050.950) -- 0:00:06
894500 -- [-1050.150] (-1049.191) (-1053.247) (-1050.442) * [-1049.651] (-1049.660) (-1049.362) (-1049.453) -- 0:00:06
895000 -- (-1050.566) (-1048.909) (-1050.272) [-1051.401] * (-1049.336) [-1052.065] (-1049.295) (-1048.311) -- 0:00:06
Average standard deviation of split frequencies: 0.009387
895500 -- [-1051.286] (-1051.308) (-1052.482) (-1050.304) * (-1048.974) [-1051.430] (-1048.830) (-1053.087) -- 0:00:07
896000 -- (-1050.389) (-1051.626) (-1052.917) [-1046.864] * (-1051.650) (-1051.236) (-1051.549) [-1050.866] -- 0:00:06
896500 -- [-1049.273] (-1050.625) (-1050.431) (-1049.826) * (-1052.507) (-1051.129) [-1050.916] (-1050.378) -- 0:00:06
897000 -- [-1053.773] (-1052.539) (-1050.947) (-1049.610) * [-1046.261] (-1053.992) (-1050.026) (-1049.106) -- 0:00:06
897500 -- (-1054.145) (-1051.240) (-1047.542) [-1049.959] * [-1047.409] (-1049.380) (-1047.505) (-1048.747) -- 0:00:06
898000 -- (-1049.408) (-1049.765) (-1049.441) [-1049.809] * [-1048.159] (-1049.632) (-1052.363) (-1050.018) -- 0:00:06
898500 -- (-1051.111) (-1049.957) (-1048.466) [-1050.394] * (-1053.323) [-1048.590] (-1050.566) (-1052.018) -- 0:00:06
899000 -- (-1049.468) (-1050.297) (-1050.279) [-1049.384] * (-1049.250) [-1048.553] (-1049.599) (-1053.947) -- 0:00:06
899500 -- (-1049.101) (-1051.079) [-1048.675] (-1051.930) * (-1053.853) (-1049.323) (-1049.414) [-1056.223] -- 0:00:06
900000 -- (-1050.844) [-1053.995] (-1048.393) (-1051.813) * (-1048.671) (-1049.294) (-1049.642) [-1049.687] -- 0:00:06
Average standard deviation of split frequencies: 0.008925
900500 -- (-1050.063) (-1050.825) [-1049.295] (-1051.143) * [-1053.389] (-1051.117) (-1048.605) (-1047.846) -- 0:00:06
901000 -- (-1050.146) (-1049.773) (-1048.974) [-1048.895] * (-1051.447) [-1050.263] (-1048.094) (-1049.559) -- 0:00:06
901500 -- [-1051.968] (-1050.611) (-1052.866) (-1048.997) * (-1050.099) [-1050.066] (-1046.096) (-1051.470) -- 0:00:06
902000 -- (-1050.787) (-1049.549) (-1048.700) [-1050.225] * (-1047.217) (-1052.354) (-1049.677) [-1049.281] -- 0:00:06
902500 -- (-1054.490) (-1050.008) [-1050.632] (-1051.146) * (-1046.702) (-1049.420) [-1048.636] (-1049.791) -- 0:00:06
903000 -- [-1050.350] (-1055.159) (-1050.880) (-1049.258) * [-1049.230] (-1051.067) (-1048.706) (-1048.271) -- 0:00:06
903500 -- [-1049.386] (-1052.369) (-1050.196) (-1051.718) * (-1048.452) [-1055.970] (-1054.207) (-1051.965) -- 0:00:06
904000 -- (-1048.855) (-1048.949) [-1049.976] (-1049.896) * (-1045.782) (-1050.101) (-1050.187) [-1049.352] -- 0:00:06
904500 -- (-1048.190) [-1049.133] (-1051.172) (-1048.839) * (-1049.063) [-1051.957] (-1049.822) (-1054.476) -- 0:00:06
905000 -- [-1048.987] (-1049.803) (-1049.100) (-1051.068) * (-1049.292) (-1049.576) (-1046.396) [-1053.296] -- 0:00:06
Average standard deviation of split frequencies: 0.008517
905500 -- (-1049.400) [-1050.915] (-1050.295) (-1051.105) * (-1047.122) [-1049.346] (-1050.469) (-1048.716) -- 0:00:06
906000 -- [-1049.833] (-1048.338) (-1050.956) (-1050.409) * [-1056.033] (-1050.460) (-1048.517) (-1048.031) -- 0:00:06
906500 -- (-1050.248) [-1052.635] (-1050.098) (-1049.480) * (-1048.563) (-1049.573) (-1050.734) [-1051.145] -- 0:00:06
907000 -- (-1049.107) [-1056.502] (-1048.310) (-1049.361) * (-1049.148) [-1049.685] (-1050.781) (-1050.043) -- 0:00:06
907500 -- (-1050.310) (-1049.703) [-1050.896] (-1049.225) * (-1049.583) (-1050.470) [-1048.385] (-1050.941) -- 0:00:06
908000 -- (-1049.442) (-1047.826) [-1047.902] (-1048.055) * (-1048.895) (-1049.188) (-1048.475) [-1047.757] -- 0:00:06
908500 -- [-1048.810] (-1050.370) (-1048.405) (-1054.116) * [-1050.299] (-1049.238) (-1049.089) (-1046.622) -- 0:00:06
909000 -- [-1050.087] (-1048.216) (-1049.724) (-1051.843) * (-1050.130) (-1054.734) (-1051.801) [-1051.021] -- 0:00:06
909500 -- (-1051.330) [-1050.109] (-1048.758) (-1049.677) * (-1050.894) [-1049.302] (-1052.385) (-1049.970) -- 0:00:05
910000 -- (-1050.348) [-1050.414] (-1049.517) (-1050.018) * (-1049.763) (-1049.493) [-1050.190] (-1049.421) -- 0:00:05
Average standard deviation of split frequencies: 0.008500
910500 -- (-1053.645) (-1049.362) [-1047.188] (-1050.219) * [-1049.206] (-1052.980) (-1051.208) (-1048.089) -- 0:00:05
911000 -- [-1048.431] (-1050.582) (-1051.356) (-1056.802) * (-1048.410) (-1050.136) (-1048.702) [-1047.812] -- 0:00:05
911500 -- (-1049.472) (-1047.238) [-1049.918] (-1051.138) * [-1049.664] (-1048.293) (-1048.283) (-1048.574) -- 0:00:05
912000 -- (-1050.517) [-1049.050] (-1050.374) (-1050.458) * (-1050.562) (-1050.271) [-1049.534] (-1049.524) -- 0:00:05
912500 -- (-1049.810) (-1051.317) (-1051.284) [-1051.354] * (-1050.934) [-1050.234] (-1049.319) (-1048.583) -- 0:00:05
913000 -- [-1047.977] (-1048.630) (-1051.375) (-1048.579) * (-1051.910) (-1049.660) (-1049.420) [-1049.303] -- 0:00:05
913500 -- (-1052.592) (-1048.234) (-1052.557) [-1048.925] * (-1051.906) (-1048.734) (-1050.976) [-1048.121] -- 0:00:05
914000 -- (-1048.752) [-1048.176] (-1049.999) (-1049.005) * [-1049.706] (-1051.313) (-1048.614) (-1049.600) -- 0:00:05
914500 -- [-1050.573] (-1047.096) (-1049.389) (-1051.852) * (-1050.399) (-1050.530) (-1051.954) [-1050.424] -- 0:00:05
915000 -- [-1048.371] (-1049.311) (-1046.166) (-1051.713) * (-1053.125) (-1051.826) [-1050.575] (-1047.540) -- 0:00:05
Average standard deviation of split frequencies: 0.008532
915500 -- [-1049.813] (-1051.020) (-1049.150) (-1051.519) * [-1050.646] (-1051.857) (-1050.781) (-1056.703) -- 0:00:05
916000 -- (-1054.544) (-1051.924) [-1050.676] (-1049.158) * [-1048.200] (-1051.587) (-1052.564) (-1054.485) -- 0:00:05
916500 -- [-1052.523] (-1051.292) (-1052.911) (-1050.918) * (-1049.978) [-1053.345] (-1052.098) (-1051.636) -- 0:00:05
917000 -- (-1049.433) (-1049.922) [-1050.751] (-1050.000) * (-1048.216) [-1048.828] (-1048.595) (-1049.610) -- 0:00:05
917500 -- (-1047.880) (-1048.551) (-1049.553) [-1049.355] * (-1052.962) (-1049.286) [-1049.713] (-1048.842) -- 0:00:05
918000 -- (-1050.671) (-1049.767) [-1049.320] (-1050.754) * (-1050.666) [-1049.482] (-1052.747) (-1049.500) -- 0:00:05
918500 -- [-1049.494] (-1046.569) (-1048.306) (-1045.971) * (-1051.885) (-1051.379) (-1053.735) [-1046.535] -- 0:00:05
919000 -- (-1049.194) (-1048.833) (-1049.721) [-1048.685] * (-1050.216) (-1049.889) [-1049.256] (-1050.358) -- 0:00:05
919500 -- [-1049.589] (-1047.843) (-1051.191) (-1048.904) * [-1049.515] (-1051.458) (-1054.146) (-1050.156) -- 0:00:05
920000 -- (-1050.308) (-1049.333) [-1050.827] (-1048.610) * [-1049.704] (-1052.019) (-1050.338) (-1049.708) -- 0:00:05
Average standard deviation of split frequencies: 0.008327
920500 -- [-1053.746] (-1048.954) (-1049.630) (-1049.213) * (-1049.110) (-1049.815) [-1049.433] (-1052.112) -- 0:00:05
921000 -- (-1056.132) (-1049.895) [-1048.018] (-1047.788) * (-1052.911) (-1048.254) [-1050.046] (-1054.357) -- 0:00:05
921500 -- (-1050.728) (-1047.932) (-1051.841) [-1051.307] * [-1049.913] (-1049.111) (-1049.762) (-1050.751) -- 0:00:05
922000 -- [-1048.230] (-1051.466) (-1054.367) (-1054.166) * (-1052.524) [-1052.207] (-1050.869) (-1051.657) -- 0:00:05
922500 -- (-1051.146) [-1052.787] (-1050.637) (-1050.219) * (-1050.757) (-1048.078) (-1049.750) [-1049.104] -- 0:00:05
923000 -- [-1049.997] (-1051.379) (-1049.535) (-1050.693) * (-1048.454) [-1050.899] (-1049.480) (-1049.249) -- 0:00:05
923500 -- [-1049.357] (-1051.815) (-1049.135) (-1050.001) * (-1050.606) (-1051.680) (-1051.321) [-1048.454] -- 0:00:05
924000 -- (-1051.388) [-1052.056] (-1050.201) (-1049.921) * (-1048.824) (-1050.068) [-1046.864] (-1054.625) -- 0:00:05
924500 -- (-1051.409) [-1049.427] (-1046.396) (-1045.571) * (-1052.480) [-1052.420] (-1048.979) (-1057.118) -- 0:00:04
925000 -- (-1050.085) (-1051.383) [-1049.579] (-1051.117) * (-1052.402) [-1050.392] (-1049.806) (-1052.747) -- 0:00:04
Average standard deviation of split frequencies: 0.008681
925500 -- (-1048.453) (-1050.759) (-1050.416) [-1050.705] * (-1053.133) (-1050.732) (-1049.434) [-1051.742] -- 0:00:04
926000 -- (-1050.368) (-1051.350) [-1051.899] (-1049.656) * (-1049.277) [-1046.434] (-1050.333) (-1050.909) -- 0:00:04
926500 -- (-1052.558) [-1047.481] (-1050.297) (-1049.526) * [-1053.445] (-1049.246) (-1049.384) (-1050.839) -- 0:00:04
927000 -- (-1059.277) (-1051.275) (-1052.244) [-1049.562] * [-1048.893] (-1048.025) (-1048.497) (-1051.799) -- 0:00:04
927500 -- (-1048.899) (-1050.451) (-1048.044) [-1052.413] * (-1050.798) [-1049.077] (-1048.029) (-1052.516) -- 0:00:04
928000 -- (-1048.913) (-1048.905) [-1049.872] (-1049.233) * [-1049.786] (-1049.704) (-1048.777) (-1048.920) -- 0:00:04
928500 -- (-1049.638) (-1050.001) (-1050.679) [-1047.870] * (-1050.416) (-1048.071) [-1049.802] (-1050.520) -- 0:00:04
929000 -- (-1049.329) [-1049.789] (-1050.043) (-1049.814) * [-1050.370] (-1050.476) (-1048.257) (-1052.171) -- 0:00:04
929500 -- (-1051.325) [-1049.676] (-1049.762) (-1049.872) * (-1049.004) (-1048.936) [-1047.025] (-1051.365) -- 0:00:04
930000 -- [-1050.929] (-1049.612) (-1050.143) (-1050.965) * (-1047.757) (-1049.750) (-1048.523) [-1049.149] -- 0:00:04
Average standard deviation of split frequencies: 0.008691
930500 -- [-1046.545] (-1051.583) (-1050.305) (-1050.675) * [-1051.329] (-1049.867) (-1051.265) (-1048.785) -- 0:00:04
931000 -- (-1051.374) [-1049.358] (-1046.698) (-1056.414) * (-1051.004) [-1052.686] (-1051.244) (-1049.964) -- 0:00:04
931500 -- (-1049.237) (-1050.098) [-1051.954] (-1051.766) * (-1050.238) (-1048.271) [-1050.487] (-1049.840) -- 0:00:04
932000 -- (-1053.814) (-1048.657) [-1052.427] (-1051.793) * (-1050.057) [-1047.799] (-1048.041) (-1050.023) -- 0:00:04
932500 -- [-1052.362] (-1049.358) (-1052.045) (-1051.428) * [-1049.297] (-1054.139) (-1049.201) (-1049.309) -- 0:00:04
933000 -- (-1055.541) [-1049.327] (-1050.444) (-1049.270) * (-1050.594) [-1048.807] (-1053.136) (-1048.663) -- 0:00:04
933500 -- (-1056.145) (-1054.605) [-1057.634] (-1049.472) * (-1058.030) [-1050.590] (-1047.719) (-1047.790) -- 0:00:04
934000 -- (-1049.300) (-1049.719) [-1052.999] (-1051.228) * (-1058.562) (-1050.409) (-1048.425) [-1052.342] -- 0:00:04
934500 -- (-1049.093) (-1055.468) (-1052.310) [-1050.006] * (-1052.641) [-1050.828] (-1050.019) (-1048.957) -- 0:00:04
935000 -- (-1049.052) (-1051.553) (-1053.020) [-1049.735] * [-1050.036] (-1050.253) (-1052.677) (-1052.928) -- 0:00:04
Average standard deviation of split frequencies: 0.008588
935500 -- (-1049.995) [-1052.951] (-1050.252) (-1049.234) * (-1050.810) (-1053.463) [-1053.144] (-1049.560) -- 0:00:04
936000 -- [-1048.846] (-1050.590) (-1053.875) (-1048.931) * [-1048.644] (-1052.219) (-1050.276) (-1048.926) -- 0:00:04
936500 -- [-1051.845] (-1051.253) (-1049.726) (-1048.752) * (-1049.570) [-1049.504] (-1046.678) (-1049.160) -- 0:00:04
937000 -- (-1050.919) (-1050.318) (-1048.579) [-1048.985] * (-1048.768) (-1050.767) (-1053.853) [-1051.838] -- 0:00:04
937500 -- (-1048.619) (-1049.046) (-1049.101) [-1049.255] * (-1049.136) (-1048.025) [-1048.173] (-1051.809) -- 0:00:04
938000 -- (-1050.743) [-1050.177] (-1053.298) (-1048.790) * [-1050.058] (-1051.106) (-1050.590) (-1049.895) -- 0:00:04
938500 -- (-1048.864) [-1052.053] (-1055.541) (-1049.485) * (-1049.891) [-1049.583] (-1051.835) (-1047.885) -- 0:00:04
939000 -- (-1048.144) (-1049.661) (-1053.868) [-1049.528] * [-1050.883] (-1050.456) (-1051.488) (-1048.300) -- 0:00:04
939500 -- (-1049.971) (-1051.575) [-1049.052] (-1049.586) * (-1050.641) [-1049.104] (-1051.551) (-1052.151) -- 0:00:03
940000 -- [-1048.344] (-1053.115) (-1049.554) (-1050.030) * [-1047.310] (-1048.475) (-1051.065) (-1049.737) -- 0:00:03
Average standard deviation of split frequencies: 0.008730
940500 -- [-1049.326] (-1051.404) (-1056.125) (-1049.817) * (-1048.999) [-1048.323] (-1047.825) (-1049.839) -- 0:00:03
941000 -- (-1050.990) (-1049.590) (-1048.675) [-1050.748] * (-1049.697) [-1048.679] (-1046.525) (-1050.918) -- 0:00:03
941500 -- [-1049.571] (-1047.823) (-1053.442) (-1050.353) * (-1049.288) (-1050.024) [-1049.171] (-1045.828) -- 0:00:03
942000 -- (-1048.951) [-1049.233] (-1050.855) (-1049.008) * (-1053.319) (-1050.551) [-1051.146] (-1047.348) -- 0:00:03
942500 -- [-1048.312] (-1049.343) (-1051.543) (-1053.491) * (-1053.042) [-1050.068] (-1058.814) (-1049.561) -- 0:00:03
943000 -- [-1051.266] (-1051.797) (-1050.051) (-1051.498) * (-1053.679) [-1051.153] (-1055.704) (-1050.198) -- 0:00:03
943500 -- [-1053.288] (-1052.675) (-1052.154) (-1050.976) * (-1057.194) (-1051.963) (-1055.882) [-1048.841] -- 0:00:03
944000 -- (-1050.997) (-1050.736) [-1050.416] (-1049.557) * (-1050.631) [-1050.081] (-1049.541) (-1048.976) -- 0:00:03
944500 -- (-1049.542) (-1049.916) (-1048.810) [-1051.068] * [-1049.849] (-1049.788) (-1049.442) (-1048.731) -- 0:00:03
945000 -- [-1050.115] (-1048.777) (-1052.546) (-1053.011) * [-1050.115] (-1052.627) (-1048.877) (-1047.120) -- 0:00:03
Average standard deviation of split frequencies: 0.008839
945500 -- (-1049.265) (-1049.167) [-1049.534] (-1051.770) * (-1054.058) [-1048.256] (-1050.293) (-1050.660) -- 0:00:03
946000 -- [-1048.104] (-1049.503) (-1049.697) (-1051.064) * (-1049.160) [-1045.995] (-1049.158) (-1048.569) -- 0:00:03
946500 -- (-1049.493) (-1048.648) (-1050.336) [-1049.749] * (-1050.986) (-1050.846) (-1050.080) [-1049.196] -- 0:00:03
947000 -- (-1054.513) (-1050.055) (-1049.981) [-1048.309] * (-1049.905) (-1049.340) (-1051.212) [-1049.251] -- 0:00:03
947500 -- (-1049.278) [-1048.644] (-1053.241) (-1049.385) * (-1049.238) (-1054.462) [-1051.906] (-1050.749) -- 0:00:03
948000 -- (-1052.189) [-1046.979] (-1048.721) (-1051.405) * [-1049.483] (-1049.088) (-1050.487) (-1050.967) -- 0:00:03
948500 -- (-1053.800) [-1050.133] (-1049.385) (-1049.996) * [-1047.849] (-1050.832) (-1049.140) (-1050.587) -- 0:00:03
949000 -- (-1052.760) (-1049.233) (-1049.722) [-1049.954] * (-1051.535) (-1048.636) [-1047.499] (-1053.274) -- 0:00:03
949500 -- (-1050.649) (-1051.087) [-1050.626] (-1049.666) * (-1048.476) (-1048.706) [-1051.700] (-1051.847) -- 0:00:03
950000 -- [-1052.504] (-1050.288) (-1049.577) (-1051.345) * (-1048.412) [-1048.594] (-1047.293) (-1050.043) -- 0:00:03
Average standard deviation of split frequencies: 0.008691
950500 -- (-1048.926) (-1049.612) [-1047.585] (-1050.606) * (-1050.786) (-1048.857) (-1050.919) [-1050.658] -- 0:00:03
951000 -- (-1049.843) [-1049.700] (-1049.101) (-1049.054) * (-1049.652) (-1051.149) [-1050.750] (-1051.938) -- 0:00:03
951500 -- (-1049.991) (-1050.043) (-1050.476) [-1049.783] * [-1048.712] (-1048.529) (-1048.503) (-1051.441) -- 0:00:03
952000 -- (-1045.345) [-1049.778] (-1050.279) (-1051.731) * [-1048.225] (-1049.632) (-1048.494) (-1049.145) -- 0:00:03
952500 -- [-1048.705] (-1049.476) (-1048.182) (-1049.977) * (-1048.645) (-1049.901) (-1047.822) [-1047.052] -- 0:00:03
953000 -- (-1048.810) [-1048.924] (-1048.380) (-1050.020) * (-1048.711) (-1050.378) (-1049.787) [-1049.733] -- 0:00:03
953500 -- (-1049.839) (-1048.888) (-1048.458) [-1052.083] * (-1050.286) (-1049.070) [-1052.618] (-1049.400) -- 0:00:03
954000 -- (-1050.648) [-1049.685] (-1050.229) (-1054.417) * (-1050.956) (-1048.505) [-1051.407] (-1049.737) -- 0:00:03
954500 -- (-1048.863) (-1049.605) (-1049.861) [-1046.825] * [-1048.358] (-1050.928) (-1051.026) (-1048.024) -- 0:00:03
955000 -- (-1049.863) (-1050.582) [-1052.693] (-1051.199) * [-1050.515] (-1051.122) (-1051.069) (-1050.326) -- 0:00:02
Average standard deviation of split frequencies: 0.008616
955500 -- (-1048.687) (-1049.781) (-1050.773) [-1050.818] * [-1047.420] (-1048.918) (-1051.029) (-1049.499) -- 0:00:02
956000 -- (-1048.367) (-1051.564) (-1051.128) [-1050.046] * [-1050.131] (-1052.344) (-1053.404) (-1050.418) -- 0:00:02
956500 -- [-1048.737] (-1050.052) (-1054.427) (-1049.800) * (-1054.548) (-1050.583) (-1052.008) [-1049.994] -- 0:00:02
957000 -- (-1049.160) (-1050.319) (-1051.865) [-1048.580] * (-1049.603) (-1048.770) [-1050.210] (-1049.829) -- 0:00:02
957500 -- (-1049.400) [-1051.708] (-1048.886) (-1050.570) * (-1048.865) (-1049.971) [-1050.518] (-1049.718) -- 0:00:02
958000 -- [-1051.514] (-1058.724) (-1049.996) (-1050.595) * (-1049.361) (-1049.030) [-1048.516] (-1051.664) -- 0:00:02
958500 -- (-1054.294) (-1049.584) (-1050.168) [-1047.758] * (-1049.374) [-1049.105] (-1048.953) (-1048.913) -- 0:00:02
959000 -- (-1049.415) (-1054.960) [-1049.062] (-1047.413) * (-1047.129) [-1049.647] (-1048.461) (-1050.670) -- 0:00:02
959500 -- [-1050.379] (-1049.525) (-1050.461) (-1050.068) * (-1052.022) (-1049.641) [-1048.754] (-1051.636) -- 0:00:02
960000 -- (-1051.805) (-1049.897) [-1051.685] (-1048.485) * (-1050.550) (-1049.541) [-1048.249] (-1051.859) -- 0:00:02
Average standard deviation of split frequencies: 0.008290
960500 -- (-1049.709) [-1048.919] (-1048.748) (-1050.686) * (-1052.659) (-1055.786) (-1049.051) [-1050.153] -- 0:00:02
961000 -- (-1051.872) (-1050.363) [-1049.594] (-1049.370) * (-1050.323) (-1049.078) [-1047.328] (-1053.421) -- 0:00:02
961500 -- (-1049.242) [-1050.477] (-1050.214) (-1050.808) * (-1050.798) (-1052.762) [-1047.714] (-1048.742) -- 0:00:02
962000 -- (-1050.119) (-1049.573) (-1050.518) [-1051.457] * (-1050.169) (-1053.894) [-1048.549] (-1053.519) -- 0:00:02
962500 -- [-1052.163] (-1054.420) (-1049.577) (-1048.040) * [-1049.220] (-1050.683) (-1050.365) (-1050.925) -- 0:00:02
963000 -- (-1051.539) (-1051.203) (-1052.523) [-1048.795] * (-1048.884) [-1049.069] (-1048.912) (-1049.261) -- 0:00:02
963500 -- (-1048.935) (-1050.791) [-1050.219] (-1048.421) * (-1050.885) (-1048.658) [-1049.453] (-1049.562) -- 0:00:02
964000 -- (-1049.245) (-1049.438) (-1053.997) [-1048.118] * (-1051.125) (-1050.249) (-1049.508) [-1049.736] -- 0:00:02
964500 -- (-1051.913) (-1050.005) [-1048.745] (-1054.753) * (-1051.997) (-1049.418) (-1050.332) [-1049.334] -- 0:00:02
965000 -- (-1051.253) (-1049.830) (-1046.558) [-1050.634] * [-1049.342] (-1049.763) (-1047.010) (-1049.796) -- 0:00:02
Average standard deviation of split frequencies: 0.008245
965500 -- (-1052.671) [-1051.055] (-1051.315) (-1048.106) * [-1049.284] (-1048.829) (-1048.649) (-1053.522) -- 0:00:02
966000 -- (-1048.525) [-1046.967] (-1048.874) (-1050.491) * [-1048.962] (-1049.389) (-1052.916) (-1050.942) -- 0:00:02
966500 -- (-1051.135) [-1049.468] (-1049.320) (-1051.671) * (-1050.036) [-1050.067] (-1053.179) (-1050.494) -- 0:00:02
967000 -- [-1049.168] (-1048.845) (-1052.331) (-1056.033) * (-1052.759) [-1048.442] (-1049.048) (-1049.343) -- 0:00:02
967500 -- (-1049.626) [-1047.987] (-1050.491) (-1047.645) * (-1055.094) (-1050.912) (-1047.985) [-1047.980] -- 0:00:02
968000 -- (-1054.091) (-1048.509) (-1050.009) [-1050.123] * (-1049.374) [-1049.169] (-1048.857) (-1049.218) -- 0:00:02
968500 -- (-1051.406) (-1050.751) (-1050.822) [-1048.472] * (-1048.914) (-1048.913) [-1049.265] (-1048.252) -- 0:00:02
969000 -- (-1048.621) [-1051.167] (-1051.407) (-1051.023) * (-1049.525) [-1050.002] (-1047.913) (-1053.822) -- 0:00:02
969500 -- (-1049.285) (-1053.082) [-1046.735] (-1050.097) * (-1049.164) [-1049.034] (-1049.048) (-1050.515) -- 0:00:02
970000 -- [-1048.598] (-1055.668) (-1046.208) (-1049.912) * (-1048.477) (-1051.361) [-1049.691] (-1050.202) -- 0:00:01
Average standard deviation of split frequencies: 0.008000
970500 -- (-1053.905) (-1056.448) (-1052.323) [-1049.177] * [-1047.730] (-1051.122) (-1052.014) (-1050.393) -- 0:00:01
971000 -- [-1053.019] (-1051.171) (-1053.175) (-1048.726) * (-1048.949) (-1049.995) [-1051.081] (-1051.553) -- 0:00:01
971500 -- (-1051.001) (-1051.169) [-1049.968] (-1049.978) * (-1051.047) (-1053.483) (-1048.066) [-1050.607] -- 0:00:01
972000 -- (-1049.577) [-1050.128] (-1049.224) (-1050.214) * (-1053.042) (-1053.814) (-1051.065) [-1046.497] -- 0:00:01
972500 -- (-1050.960) [-1048.840] (-1047.565) (-1051.728) * (-1047.840) [-1050.670] (-1048.701) (-1050.139) -- 0:00:01
973000 -- (-1048.524) (-1055.967) [-1049.214] (-1046.547) * (-1056.651) (-1048.987) [-1046.553] (-1050.729) -- 0:00:01
973500 -- (-1051.091) (-1048.408) (-1048.321) [-1047.802] * (-1049.609) [-1051.138] (-1048.901) (-1052.499) -- 0:00:01
974000 -- (-1051.962) [-1048.913] (-1048.090) (-1049.329) * (-1048.612) [-1048.169] (-1057.162) (-1049.832) -- 0:00:01
974500 -- (-1048.877) [-1047.685] (-1048.636) (-1051.525) * (-1048.459) (-1048.548) (-1052.859) [-1048.499] -- 0:00:01
975000 -- [-1050.074] (-1049.093) (-1049.038) (-1050.511) * [-1050.512] (-1048.608) (-1050.926) (-1049.534) -- 0:00:01
Average standard deviation of split frequencies: 0.008109
975500 -- (-1052.451) (-1055.755) [-1047.987] (-1052.822) * (-1046.372) (-1051.313) [-1046.812] (-1052.963) -- 0:00:01
976000 -- (-1052.370) [-1047.530] (-1046.847) (-1050.618) * [-1049.775] (-1052.288) (-1048.838) (-1052.587) -- 0:00:01
976500 -- (-1052.302) (-1048.846) [-1049.782] (-1049.999) * [-1050.532] (-1048.683) (-1052.869) (-1049.697) -- 0:00:01
977000 -- (-1050.679) [-1050.763] (-1050.337) (-1047.040) * (-1048.878) [-1049.743] (-1048.459) (-1049.533) -- 0:00:01
977500 -- (-1048.916) (-1051.760) (-1052.733) [-1048.653] * (-1050.128) [-1047.613] (-1051.046) (-1049.118) -- 0:00:01
978000 -- (-1048.785) [-1048.011] (-1050.487) (-1052.155) * (-1050.844) [-1049.307] (-1049.685) (-1056.161) -- 0:00:01
978500 -- (-1049.320) (-1048.991) [-1048.088] (-1050.841) * [-1049.074] (-1048.148) (-1049.140) (-1049.010) -- 0:00:01
979000 -- (-1054.215) (-1049.400) [-1046.918] (-1050.005) * [-1050.165] (-1048.958) (-1052.750) (-1048.406) -- 0:00:01
979500 -- (-1048.785) [-1046.325] (-1049.801) (-1048.989) * (-1049.981) [-1048.107] (-1048.460) (-1047.955) -- 0:00:01
980000 -- (-1049.088) (-1049.065) [-1050.806] (-1049.239) * (-1052.483) (-1048.810) (-1054.157) [-1049.489] -- 0:00:01
Average standard deviation of split frequencies: 0.008172
980500 -- (-1051.655) (-1048.860) (-1048.988) [-1046.932] * (-1051.605) (-1049.103) (-1051.881) [-1052.549] -- 0:00:01
981000 -- (-1050.206) [-1048.784] (-1051.229) (-1048.974) * [-1048.080] (-1050.468) (-1051.925) (-1051.069) -- 0:00:01
981500 -- (-1051.423) [-1049.565] (-1049.797) (-1048.709) * [-1047.943] (-1050.347) (-1047.259) (-1046.150) -- 0:00:01
982000 -- (-1046.920) (-1048.037) [-1050.870] (-1048.784) * [-1048.125] (-1051.491) (-1047.299) (-1052.665) -- 0:00:01
982500 -- (-1050.184) (-1048.321) (-1049.701) [-1049.287] * (-1049.668) (-1050.078) (-1055.201) [-1049.471] -- 0:00:01
983000 -- [-1049.045] (-1050.661) (-1052.359) (-1049.600) * (-1048.355) (-1052.831) (-1050.850) [-1048.914] -- 0:00:01
983500 -- [-1048.449] (-1051.619) (-1048.855) (-1049.518) * [-1049.614] (-1051.238) (-1049.275) (-1050.816) -- 0:00:01
984000 -- (-1048.770) (-1051.624) (-1049.701) [-1049.796] * (-1049.179) [-1048.604] (-1050.181) (-1048.626) -- 0:00:01
984500 -- (-1047.015) (-1049.621) (-1051.776) [-1049.810] * (-1049.509) [-1047.658] (-1049.387) (-1050.665) -- 0:00:01
985000 -- [-1046.488] (-1050.542) (-1051.692) (-1048.725) * (-1050.053) (-1049.853) (-1053.485) [-1048.561] -- 0:00:00
Average standard deviation of split frequencies: 0.008128
985500 -- (-1049.022) (-1051.143) [-1049.213] (-1051.745) * (-1049.539) [-1048.204] (-1050.160) (-1048.471) -- 0:00:00
986000 -- [-1049.412] (-1052.431) (-1050.649) (-1051.975) * (-1051.563) (-1051.106) (-1048.163) [-1050.947] -- 0:00:00
986500 -- (-1049.464) [-1048.348] (-1052.121) (-1055.323) * (-1049.955) [-1050.485] (-1048.008) (-1049.614) -- 0:00:00
987000 -- (-1049.946) (-1047.292) (-1047.807) [-1057.404] * (-1049.773) (-1053.937) [-1048.674] (-1049.887) -- 0:00:00
987500 -- [-1048.534] (-1049.845) (-1048.431) (-1050.389) * (-1049.451) (-1051.777) [-1050.778] (-1050.324) -- 0:00:00
988000 -- (-1048.109) (-1049.615) (-1049.891) [-1048.966] * (-1052.916) (-1048.489) [-1046.216] (-1049.811) -- 0:00:00
988500 -- (-1049.829) (-1049.543) [-1052.063] (-1050.557) * (-1050.280) [-1047.565] (-1052.592) (-1047.750) -- 0:00:00
989000 -- [-1049.985] (-1049.658) (-1049.464) (-1050.894) * (-1047.961) (-1049.519) [-1048.342] (-1052.273) -- 0:00:00
989500 -- [-1047.995] (-1050.592) (-1049.927) (-1050.807) * [-1047.549] (-1050.932) (-1049.212) (-1052.981) -- 0:00:00
990000 -- (-1049.111) [-1050.225] (-1050.274) (-1049.245) * (-1046.549) (-1051.452) [-1052.947] (-1045.548) -- 0:00:00
Average standard deviation of split frequencies: 0.008590
990500 -- (-1052.521) (-1050.913) (-1049.724) [-1049.689] * (-1056.382) (-1051.448) [-1052.720] (-1048.705) -- 0:00:00
991000 -- (-1052.561) (-1053.242) [-1051.444] (-1050.714) * (-1053.466) (-1051.383) [-1053.900] (-1050.298) -- 0:00:00
991500 -- (-1050.211) [-1048.631] (-1051.994) (-1050.275) * [-1050.563] (-1048.705) (-1047.502) (-1050.357) -- 0:00:00
992000 -- (-1049.047) (-1049.161) [-1051.371] (-1051.171) * (-1049.183) (-1048.674) [-1052.569] (-1048.750) -- 0:00:00
992500 -- (-1047.903) [-1051.687] (-1049.412) (-1050.020) * (-1051.252) [-1050.247] (-1048.038) (-1049.068) -- 0:00:00
993000 -- (-1049.287) (-1049.269) [-1053.339] (-1048.791) * (-1058.079) (-1048.425) [-1050.649] (-1048.524) -- 0:00:00
993500 -- [-1050.628] (-1047.757) (-1052.599) (-1050.227) * (-1050.613) (-1049.944) (-1053.342) [-1047.198] -- 0:00:00
994000 -- (-1048.330) (-1049.887) (-1051.141) [-1050.301] * (-1050.487) (-1049.968) (-1051.367) [-1051.820] -- 0:00:00
994500 -- [-1048.627] (-1048.669) (-1049.434) (-1048.643) * [-1050.212] (-1049.325) (-1051.281) (-1050.190) -- 0:00:00
995000 -- (-1050.399) (-1048.990) (-1049.989) [-1048.112] * (-1049.390) (-1050.410) [-1049.343] (-1050.828) -- 0:00:00
Average standard deviation of split frequencies: 0.008494
995500 -- (-1048.677) (-1046.711) [-1050.787] (-1049.251) * (-1049.901) [-1047.593] (-1050.956) (-1049.805) -- 0:00:00
996000 -- (-1049.589) [-1048.994] (-1049.876) (-1052.270) * (-1051.730) [-1045.729] (-1049.401) (-1050.917) -- 0:00:00
996500 -- (-1049.647) (-1047.400) [-1050.547] (-1049.280) * (-1051.011) [-1044.705] (-1048.652) (-1049.393) -- 0:00:00
997000 -- (-1048.005) (-1049.275) (-1051.307) [-1049.254] * (-1048.639) (-1050.985) [-1047.742] (-1052.551) -- 0:00:00
997500 -- [-1051.416] (-1053.515) (-1051.094) (-1048.628) * [-1048.447] (-1048.976) (-1050.027) (-1054.090) -- 0:00:00
998000 -- (-1048.686) (-1052.864) (-1049.832) [-1050.149] * [-1048.106] (-1050.791) (-1049.694) (-1052.037) -- 0:00:00
998500 -- (-1050.048) (-1050.041) [-1049.097] (-1051.180) * (-1050.846) (-1049.850) [-1048.057] (-1050.884) -- 0:00:00
999000 -- [-1055.171] (-1049.295) (-1048.470) (-1053.702) * (-1049.287) [-1048.466] (-1051.072) (-1050.229) -- 0:00:00
999500 -- [-1054.182] (-1049.816) (-1050.182) (-1048.537) * [-1047.698] (-1049.220) (-1048.743) (-1050.350) -- 0:00:00
1000000 -- (-1049.832) [-1048.940] (-1052.519) (-1048.655) * (-1049.960) [-1050.448] (-1048.799) (-1051.951) -- 0:00:00
Average standard deviation of split frequencies: 0.008777
Analysis completed in 1 mins 6 seconds
Analysis used 64.55 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1044.09
Likelihood of best state for "cold" chain of run 2 was -1043.88
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 71 %) Dirichlet(Revmat{all})
98.7 % ( 97 %) Slider(Revmat{all})
27.2 % ( 26 %) Dirichlet(Pi{all})
29.2 % ( 29 %) Slider(Pi{all})
72.1 % ( 54 %) Multiplier(Alpha{1,2})
79.3 % ( 54 %) Multiplier(Alpha{3})
27.2 % ( 26 %) Slider(Pinvar{all})
90.3 % ( 91 %) ExtSPR(Tau{all},V{all})
61.8 % ( 65 %) ExtTBR(Tau{all},V{all})
90.2 % ( 90 %) NNI(Tau{all},V{all})
78.8 % ( 84 %) ParsSPR(Tau{all},V{all})
28.1 % ( 17 %) Multiplier(V{all})
93.8 % ( 93 %) Nodeslider(V{all})
30.6 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 57 %) Dirichlet(Revmat{all})
98.7 % ( 97 %) Slider(Revmat{all})
27.7 % ( 35 %) Dirichlet(Pi{all})
29.1 % ( 31 %) Slider(Pi{all})
71.0 % ( 49 %) Multiplier(Alpha{1,2})
79.5 % ( 45 %) Multiplier(Alpha{3})
24.6 % ( 27 %) Slider(Pinvar{all})
90.8 % ( 91 %) ExtSPR(Tau{all},V{all})
62.6 % ( 67 %) ExtTBR(Tau{all},V{all})
90.8 % ( 91 %) NNI(Tau{all},V{all})
80.0 % ( 74 %) ParsSPR(Tau{all},V{all})
28.1 % ( 25 %) Multiplier(V{all})
94.2 % ( 94 %) Nodeslider(V{all})
30.4 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 166259 0.81 0.66
3 | 166244 166447 0.83
4 | 166710 167313 167027
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166942 0.82 0.66
3 | 166176 166113 0.83
4 | 166791 167622 166356
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1048.43
| 2 2 |
| |
| |
| 1 2 |
| 2 2 2 2 2 1 1 1 |
| 2 1 1 1 2 1 222|
| 2 1 22 1 1 1 2 1 * 2 2 221 |
| 12 2 2 212 * * 2 211 |
| 2 11 1 1 2 2 1 1 2 12 1 2 2 |
|2 1*1 2 1 1 2 1 2 2 1 2 1 |
| 1 1 1 1 1122 2 21 2 12 * 1 |
|11 1 2 1 1 1 12 |
| 2 2 2 1 |
| 2 1 2 1|
| 1 2 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1050.61
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1048.54 -1052.35
2 -1048.36 -1052.96
--------------------------------------
TOTAL -1048.44 -1052.70
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882020 0.086527 0.322637 1.447854 0.850960 1501.00 1501.00 1.002
r(A<->C){all} 0.164480 0.018826 0.000015 0.432994 0.129208 239.24 280.18 1.000
r(A<->G){all} 0.200859 0.024351 0.000190 0.499666 0.162464 109.08 120.31 1.018
r(A<->T){all} 0.168791 0.019816 0.000035 0.450054 0.131825 254.71 278.25 1.000
r(C<->G){all} 0.142895 0.016164 0.000151 0.403968 0.106227 140.78 201.31 1.004
r(C<->T){all} 0.167274 0.021554 0.000157 0.461951 0.127983 239.62 294.87 1.001
r(G<->T){all} 0.155700 0.019968 0.000041 0.437048 0.113003 173.88 251.06 1.004
pi(A){all} 0.207961 0.000210 0.181667 0.239358 0.207673 1276.66 1354.05 1.000
pi(C){all} 0.293996 0.000259 0.263044 0.325815 0.293898 1259.37 1278.65 1.000
pi(G){all} 0.286237 0.000255 0.253865 0.315040 0.285845 1170.86 1227.26 1.000
pi(T){all} 0.211805 0.000213 0.184571 0.240662 0.211681 1407.11 1409.80 1.000
alpha{1,2} 0.385696 0.202676 0.000112 1.293237 0.236710 857.77 1002.27 1.000
alpha{3} 0.419209 0.224495 0.000288 1.411156 0.244980 1078.75 1239.18 1.000
pinvar{all} 0.995784 0.000014 0.988635 0.999928 0.996819 1108.32 1245.01 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- ..****
9 -- .***.*
10 -- ....**
11 -- .*...*
12 -- .****.
13 -- .*..*.
14 -- ..*.*.
15 -- .*.*..
16 -- .***..
17 -- ..*..*
18 -- ..**.*
19 -- ...*.*
20 -- .*.***
21 -- .*..**
22 -- ...**.
23 -- ..***.
24 -- .**.**
25 -- .**...
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 952 0.317122 0.022612 0.301133 0.333111 2
8 505 0.168221 0.009893 0.161226 0.175217 2
9 501 0.166889 0.001413 0.165889 0.167888 2
10 495 0.164890 0.008009 0.159227 0.170553 2
11 478 0.159227 0.014133 0.149234 0.169221 2
12 444 0.147901 0.001884 0.146569 0.149234 2
13 435 0.144903 0.015546 0.133911 0.155896 2
14 363 0.120919 0.000471 0.120586 0.121252 2
15 356 0.118588 0.007537 0.113258 0.123917 2
16 353 0.117588 0.002355 0.115923 0.119254 2
17 346 0.115256 0.000942 0.114590 0.115923 2
18 334 0.111259 0.016959 0.099267 0.123251 2
19 334 0.111259 0.008480 0.105263 0.117255 2
20 331 0.110260 0.016488 0.098601 0.121919 2
21 321 0.106929 0.004240 0.103931 0.109927 2
22 320 0.106596 0.013191 0.097268 0.115923 2
23 313 0.104264 0.017430 0.091939 0.116589 2
24 312 0.103931 0.001884 0.102598 0.105263 2
25 309 0.102931 0.003298 0.100600 0.105263 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096676 0.009721 0.000028 0.292639 0.064214 1.002 2
length{all}[2] 0.094348 0.009024 0.000054 0.283689 0.064745 1.000 2
length{all}[3] 0.101389 0.010359 0.000004 0.306011 0.069125 1.000 2
length{all}[4] 0.095396 0.008853 0.000034 0.294229 0.066253 1.001 2
length{all}[5] 0.094791 0.008889 0.000005 0.282668 0.066552 1.000 2
length{all}[6] 0.092202 0.008330 0.000027 0.279127 0.062980 1.000 2
length{all}[7] 0.138305 0.015133 0.000018 0.378873 0.107140 1.000 2
length{all}[8] 0.089767 0.008693 0.000047 0.281638 0.059729 1.007 2
length{all}[9] 0.098624 0.010364 0.000002 0.288636 0.065001 0.998 2
length{all}[10] 0.094212 0.009633 0.000162 0.288015 0.064363 0.999 2
length{all}[11] 0.091937 0.007784 0.000617 0.266039 0.065082 0.999 2
length{all}[12] 0.104792 0.010675 0.000547 0.299278 0.075650 1.012 2
length{all}[13] 0.098892 0.009767 0.000268 0.280237 0.068639 0.998 2
length{all}[14] 0.097169 0.009500 0.000136 0.294188 0.069023 1.003 2
length{all}[15] 0.097026 0.009841 0.000379 0.307743 0.067638 0.997 2
length{all}[16] 0.100050 0.009428 0.000014 0.293632 0.066382 1.005 2
length{all}[17] 0.108582 0.012435 0.000079 0.336655 0.071412 0.997 2
length{all}[18] 0.110111 0.012350 0.000730 0.332976 0.075140 0.998 2
length{all}[19] 0.097582 0.009065 0.000249 0.295292 0.072349 0.998 2
length{all}[20] 0.090506 0.008581 0.000087 0.255111 0.064136 1.004 2
length{all}[21] 0.100801 0.011300 0.000045 0.307464 0.068035 0.997 2
length{all}[22] 0.095608 0.008752 0.001026 0.283824 0.065854 0.998 2
length{all}[23] 0.089483 0.007864 0.000120 0.262286 0.064182 0.997 2
length{all}[24] 0.097734 0.007643 0.000736 0.245743 0.075863 0.997 2
length{all}[25] 0.106672 0.013064 0.000271 0.343666 0.075243 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008777
Maximum standard deviation of split frequencies = 0.022612
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.012
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 34 trees
90 % credible set contains 87 trees
95 % credible set contains 96 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 753
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 251 / 251 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 251 / 251 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.051626 0.108790 0.032286 0.073060 0.026603 0.096153 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1106.884946
Iterating by ming2
Initial: fx= 1106.884946
x= 0.05163 0.10879 0.03229 0.07306 0.02660 0.09615 0.30000 1.30000
1 h-m-p 0.0000 0.0001 581.8037 ++ 1070.910388 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 2723.2833 ++ 1047.876527 m 0.0000 24 | 2/8
3 h-m-p 0.0000 0.0000 1989.3997 ++ 1024.219791 m 0.0000 35 | 3/8
4 h-m-p 0.0000 0.0000 6472.1637 ++ 1020.689226 m 0.0000 46 | 4/8
5 h-m-p 0.0003 0.1649 6.0890 ++++CYYCYCCC 1016.825324 7 0.1350 72 | 4/8
6 h-m-p 0.0267 0.1335 2.9229 YCYCCC 1016.317048 5 0.0665 91 | 4/8
7 h-m-p 0.1028 0.5142 0.3383 CYCCC 1016.210151 4 0.1664 109 | 4/8
8 h-m-p 0.0855 2.2018 0.6582 ++YYCCC 1015.758226 4 1.1184 132 | 4/8
9 h-m-p 0.7320 8.0000 1.0056 +YCCCC 1015.230830 4 1.8421 155 | 4/8
10 h-m-p 1.4816 7.4081 0.7451 YCYCCC 1014.739424 5 3.1967 174 | 4/8
11 h-m-p 1.6000 8.0000 1.0732 YCCC 1014.496224 3 3.5442 194 | 4/8
12 h-m-p 1.6000 8.0000 1.7332 YCCCC 1014.296604 4 3.0011 212 | 4/8
13 h-m-p 1.6000 8.0000 2.7165 CYC 1014.185539 2 1.9585 226 | 4/8
14 h-m-p 1.6000 8.0000 2.8071 YCCC 1014.096918 3 3.4900 242 | 4/8
15 h-m-p 1.6000 8.0000 4.9758 CCCC 1014.021309 3 2.5900 259 | 4/8
16 h-m-p 1.6000 8.0000 6.0828 YCCC 1013.971096 3 3.7291 275 | 4/8
17 h-m-p 1.6000 8.0000 10.0161 YC 1013.934000 1 3.2308 287 | 4/8
18 h-m-p 1.6000 8.0000 14.7401 YCCC 1013.911988 3 3.2074 303 | 4/8
19 h-m-p 1.6000 8.0000 22.3628 YC 1013.895087 1 3.1738 315 | 4/8
20 h-m-p 1.6000 8.0000 32.6830 YCC 1013.884694 2 3.2666 329 | 4/8
21 h-m-p 1.6000 8.0000 49.4240 YC 1013.877160 1 3.1269 341 | 4/8
22 h-m-p 1.6000 8.0000 70.2330 YC 1013.872347 1 3.3954 353 | 4/8
23 h-m-p 1.2620 6.3099 105.3574 YC 1013.869059 1 3.0194 365 | 4/8
24 h-m-p 0.4559 2.2795 152.0822 ++ 1013.867010 m 2.2795 376 | 5/8
25 h-m-p 0.0415 0.2073 214.1927 ++ 1013.866830 m 0.2073 387 | 6/8
26 h-m-p 0.0591 8.0000 0.0000 ++C 1013.866804 0 1.0180 400 | 6/8
27 h-m-p 1.6000 8.0000 0.0000 Y 1013.866804 0 0.7474 413
Out..
lnL = -1013.866804
414 lfun, 414 eigenQcodon, 2484 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.077649 0.029082 0.070409 0.014264 0.104944 0.018924 999.000000 0.741285 0.274179
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.029127
np = 9
lnL0 = -1083.479556
Iterating by ming2
Initial: fx= 1083.479556
x= 0.07765 0.02908 0.07041 0.01426 0.10494 0.01892 951.42857 0.74129 0.27418
1 h-m-p 0.0000 0.0001 532.7068 ++ 1062.084473 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 3992.3720 ++ 1053.169728 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0000 17780.1653 ++ 1029.402200 m 0.0000 38 | 2/9
4 h-m-p 0.0000 0.0000 422.9443 ++ 1027.320640 m 0.0000 50 | 3/9
5 h-m-p 0.0000 0.0002 168.1049 ++ 1020.340392 m 0.0002 62 | 4/9
6 h-m-p 0.0011 0.0184 14.1414 +++ 1019.181259 m 0.0184 75 | 5/9
7 h-m-p 0.2068 1.1298 0.2845 YCYCCC 1019.026718 5 0.4562 95 | 5/9
8 h-m-p 0.5174 2.5870 0.0596 ----------------.. | 5/9
9 h-m-p 0.0000 0.0002 316993.3491 ---YCYYCYCYC 1014.470604 8 0.0000 156 | 5/9
10 h-m-p 0.0000 0.0002 18.5182 CC 1014.467416 1 0.0000 170 | 5/9
11 h-m-p 0.0009 0.4315 1.8732 +++YCYC 1014.333483 3 0.1122 189 | 5/9
12 h-m-p 1.6000 8.0000 0.0005 Y 1014.333479 0 1.0806 201 | 5/9
13 h-m-p 1.4689 8.0000 0.0003 C 1014.333478 0 2.3444 217 | 5/9
14 h-m-p 1.6000 8.0000 0.0000 +Y 1014.333478 0 6.7772 234 | 5/9
15 h-m-p 1.6000 8.0000 0.0000 ++ 1014.333477 m 8.0000 250 | 5/9
16 h-m-p 0.1743 8.0000 0.0014 ++Y 1014.333473 0 1.9579 268 | 5/9
17 h-m-p 1.6000 8.0000 0.0008 Y 1014.333469 0 3.2938 284 | 5/9
18 h-m-p 1.6000 8.0000 0.0000 C 1014.333469 0 0.3587 300 | 5/9
19 h-m-p 0.5933 8.0000 0.0000 -Y 1014.333469 0 0.0371 317
Out..
lnL = -1014.333469
318 lfun, 954 eigenQcodon, 3816 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.089054 0.015208 0.021581 0.078498 0.083108 0.016498 951.433809 1.196753 0.269698 0.400999 1044.639525
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000149
np = 11
lnL0 = -1041.474246
Iterating by ming2
Initial: fx= 1041.474246
x= 0.08905 0.01521 0.02158 0.07850 0.08311 0.01650 951.43381 1.19675 0.26970 0.40100 951.42857
1 h-m-p 0.0000 0.0003 115.6635 +++ 1037.464583 m 0.0003 17 | 1/11
2 h-m-p 0.0001 0.0007 29.3743 ++ 1037.007301 m 0.0007 31 | 2/11
3 h-m-p 0.0002 0.0019 88.3853 ++ 1020.513123 m 0.0019 45 | 3/11
4 h-m-p 0.0001 0.0005 114.3418 ++ 1019.645546 m 0.0005 59 | 4/11
5 h-m-p 0.0001 0.0007 340.9650 +YYCYYYCYCC 1013.037579 10 0.0006 87 | 4/11
6 h-m-p 0.0057 0.0285 4.9413 +YYYCCC 1011.844243 5 0.0205 109 | 4/11
7 h-m-p 0.0236 0.1179 1.6978 CYC 1011.760540 2 0.0229 126 | 4/11
8 h-m-p 0.0983 8.0000 0.3964 ++++ 1009.552898 m 8.0000 142 | 4/11
9 h-m-p 0.0538 0.2692 0.8943 ++ 1009.252832 m 0.2692 163 | 5/11
10 h-m-p 0.0012 0.2940 4.7485 +++YCYYYYYC 1008.952941 7 0.1870 195 | 5/11
11 h-m-p 0.2612 1.3060 0.3912 YYCCCC 1008.939408 5 0.2922 217 | 5/11
12 h-m-p 1.6000 8.0000 0.0138 CYC 1008.901044 2 3.0838 240 | 5/11
13 h-m-p 0.2930 8.0000 0.1452 +CYCC 1008.875824 3 1.3138 266 | 5/11
14 h-m-p 1.6000 8.0000 0.0096 YYC 1008.871662 2 1.3994 288 | 5/11
15 h-m-p 0.3811 8.0000 0.0354 +++ 1008.831909 m 8.0000 309 | 5/11
16 h-m-p 1.6000 8.0000 0.0731 CYC 1008.823633 2 1.3904 332 | 5/11
17 h-m-p 1.6000 8.0000 0.0412 YC 1008.822453 1 1.0353 353 | 5/11
18 h-m-p 1.6000 8.0000 0.0055 Y 1008.822416 0 1.1494 373 | 5/11
19 h-m-p 1.6000 8.0000 0.0034 ++ 1008.822334 m 8.0000 393 | 5/11
20 h-m-p 0.2569 8.0000 0.1066 ++YC 1008.821874 1 2.9335 416 | 5/11
21 h-m-p 1.6000 8.0000 0.1461 ++ 1008.819714 m 8.0000 436 | 5/11
22 h-m-p 1.6000 8.0000 0.4310 YC 1008.819071 1 3.5415 457 | 5/11
23 h-m-p 1.6000 8.0000 0.3220 C 1008.818902 0 1.8085 477 | 5/11
24 h-m-p 1.6000 8.0000 0.3559 +YC 1008.818796 1 4.6185 499 | 5/11
25 h-m-p 1.6000 8.0000 0.5778 C 1008.818734 0 2.4093 519 | 5/11
26 h-m-p 1.5348 8.0000 0.9071 ++ 1008.818580 m 8.0000 539 | 5/11
27 h-m-p 0.6554 7.7284 11.0725 ++ 1008.816773 m 7.7284 559 | 5/11
28 h-m-p -0.0000 -0.0000 1061.9630
h-m-p: -0.00000000e+00 -0.00000000e+00 1.06196296e+03 1008.816773
.. | 5/11
29 h-m-p 0.0000 0.0086 0.9329 +C 1008.816737 0 0.0001 585 | 5/11
30 h-m-p 0.0015 0.1689 0.0526 -C 1008.816736 0 0.0001 606 | 5/11
31 h-m-p 0.0160 8.0000 0.0237 +++C 1008.816512 0 0.9313 629 | 5/11
32 h-m-p 1.6000 8.0000 0.0003 Y 1008.816512 0 3.6650 649 | 5/11
33 h-m-p 1.0772 8.0000 0.0010 ++ 1008.816510 m 8.0000 669 | 5/11
34 h-m-p 0.0160 8.0000 0.8304 +++YC 1008.816300 1 2.0162 693 | 5/11
35 h-m-p 1.6000 8.0000 0.8378 ++ 1008.814592 m 8.0000 713 | 5/11
36 h-m-p 0.0106 0.0529 568.4172 ++ 1008.807131 m 0.0529 733 | 6/11
37 h-m-p 0.1297 5.5186 8.3113 YC 1008.807060 1 0.2128 748 | 6/11
38 h-m-p 1.6000 8.0000 0.7910 CC 1008.806917 1 0.6198 764 | 6/11
39 h-m-p 1.6000 8.0000 0.2320 ++ 1008.806905 m 8.0000 783 | 6/11
40 h-m-p 0.1864 4.2913 9.9576 ++C 1008.806797 0 2.8455 804 | 6/11
41 h-m-p 0.1987 0.9935 14.4909 ++ 1008.806664 m 0.9935 818 | 7/11
42 h-m-p 0.0351 8.0000 0.0107 ++YC 1008.806524 1 1.1413 835 | 7/11
43 h-m-p 1.6000 8.0000 0.0011 Y 1008.806523 0 1.0162 853 | 7/11
44 h-m-p 1.6000 8.0000 0.0000 C 1008.806523 0 0.5372 871 | 7/11
45 h-m-p 1.1160 8.0000 0.0000 -Y 1008.806523 0 0.0401 890
Out..
lnL = -1008.806523
891 lfun, 3564 eigenQcodon, 16038 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1013.820368 S = -1009.849908 -5.236094
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:06
did 20 / 56 patterns 0:06
did 30 / 56 patterns 0:06
did 40 / 56 patterns 0:06
did 50 / 56 patterns 0:06
did 56 / 56 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.025886 0.030709 0.079135 0.061058 0.055781 0.041599 999.000000 0.253441 1.132040
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.043081
np = 9
lnL0 = -1076.624714
Iterating by ming2
Initial: fx= 1076.624714
x= 0.02589 0.03071 0.07913 0.06106 0.05578 0.04160 951.42857 0.25344 1.13204
1 h-m-p 0.0000 0.0001 539.1974 ++ 1043.106200 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0002 276.4129 +YYCYYYYYCC 1036.061085 10 0.0001 39 | 1/9
3 h-m-p 0.0001 0.0003 120.5204 +YYYYYYYYCC 1033.666966 10 0.0003 63 | 1/9
4 h-m-p 0.0018 0.0231 18.9296 ------------.. | 1/9
5 h-m-p 0.0000 0.0001 427.6965 ++ 1024.365567 m 0.0001 97 | 2/9
6 h-m-p 0.0000 0.0000 3598.1752 ++ 1019.123079 m 0.0000 109 | 3/9
7 h-m-p 0.0000 0.0001 188.1781 ++ 1015.902871 m 0.0001 121 | 4/9
8 h-m-p 0.0029 1.4325 14.0028 --YC 1015.900487 1 0.0000 136 | 4/9
9 h-m-p 0.0028 1.3888 2.0156 ++++
QuantileBeta(0.85, 2.81352, 0.00500) = 1.000000e+00 2000 rounds
+ 1014.787195 m 1.3888 151
QuantileBeta(0.85, 2.81352, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.81352, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.81352, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.81352, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.81352, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.81352, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.81352, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.81352, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.81352, 0.00500) = 1.000000e+00 2000 rounds
| 5/9
10 h-m-p 1.6000 8.0000 0.0959
QuantileBeta(0.85, 2.96691, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.42707, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.91203, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 2.89986, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.85669, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89176, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.87422, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89072, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.88247, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89050, 0.00500) = 1.000000e+00 2000 rounds
C 1014.693450 4 0.8030 170
QuantileBeta(0.85, 2.89050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89064, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89036, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.89050, 0.00500) = 1.000000e+00 2000 rounds
| 5/9
11 h-m-p 1.6000 8.0000 0.0273
QuantileBeta(0.85, 2.93413, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.06504, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.10868, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01684, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 3.01471, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.97442, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01109, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.99276, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01085, 0.00500) = 1.000000e+00 2000 rounds
C 1014.539543 3 4.4131 192
QuantileBeta(0.85, 3.01085, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01085, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01085, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01085, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01085, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01085, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01085, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01085, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01085, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01085, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01099, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01071, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.01085, 0.00500) = 1.000000e+00 2000 rounds
| 5/9
12 h-m-p 1.6000 8.0000 0.0103
QuantileBeta(0.85, 3.02740, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.07704, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02442, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 3.01764, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02367, 0.00500) = 1.000000e+00 2000 rounds
C 1014.537603 1 1.2396 210
QuantileBeta(0.85, 3.02367, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02367, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02367, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02367, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02367, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02367, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02367, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02367, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02367, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02367, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02381, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02353, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02367, 0.00500) = 1.000000e+00 2000 rounds
| 5/9
13 h-m-p 1.6000 8.0000 0.0024
QuantileBeta(0.85, 3.02754, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.03913, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02794, 0.00500) = 1.000000e+00 2000 rounds
C 1014.537508 0 1.7683 226
QuantileBeta(0.85, 3.02794, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02794, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02794, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02794, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02794, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02794, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02794, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02794, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02794, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02794, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02808, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02780, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02794, 0.00500) = 1.000000e+00 2000 rounds
| 5/9
14 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02769, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
C 1014.537508 0 1.6000 242
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02802, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02774, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
| 5/9
15 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 3.02792, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02789, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
C 1014.537508 0 0.0235 260
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -1014.537508
261 lfun, 2871 eigenQcodon, 15660 P(t)
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.02788, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.095348 0.085559 0.075907 0.016670 0.024449 0.097076 951.428628 0.900000 0.491099 1.893306 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000264
np = 11
lnL0 = -1032.136625
Iterating by ming2
Initial: fx= 1032.136625
x= 0.09535 0.08556 0.07591 0.01667 0.02445 0.09708 951.42863 0.90000 0.49110 1.89331 951.42857
1 h-m-p 0.0000 0.0005 192.3167 ++CYYYCYYCCC 1017.989248 10 0.0004 33 | 0/11
2 h-m-p 0.0004 0.0018 22.9830 ++ 1017.177115 m 0.0018 47 | 0/11
3 h-m-p 0.0000 0.0000 78.6830
h-m-p: 2.12467869e-20 1.06233934e-19 7.86830079e+01 1017.177115
.. | 0/11
4 h-m-p 0.0000 0.0004 55.6343 +CCCC 1017.072110 3 0.0001 79 | 0/11
5 h-m-p 0.0001 0.0033 39.8055 ++CYC 1016.693422 2 0.0012 99 | 0/11
6 h-m-p 0.0001 0.0007 105.2615 ++ 1013.906199 m 0.0007 113 | 1/11
7 h-m-p 0.0000 0.0000 802.3830 CYCCC 1013.852414 4 0.0000 134 | 1/11
8 h-m-p 0.0010 0.0092 5.1004 ++ 1012.964477 m 0.0092 148 | 2/11
9 h-m-p 0.0000 0.0002 58.8913 ++ 1012.584710 m 0.0002 162 | 3/11
10 h-m-p 0.0002 0.0012 32.0232 ++ 1011.116460 m 0.0012 176 | 4/11
11 h-m-p 0.0365 0.1827 0.7373 +YYYYYCYCYC 1009.454830 9 0.1580 203 | 4/11
12 h-m-p 0.1463 0.7316 0.5203 ++ 1009.152104 m 0.7316 224 | 5/11
13 h-m-p 0.0452 0.2262 0.7660
QuantileBeta(0.15, 0.00500, 2.14995) = 1.229301e-160 2000 rounds
CYCCC 1008.991115 4 0.0806 252 | 5/11
14 h-m-p 0.6144 3.0721 0.0126 YCYCYC 1008.839967 5 1.7308 280 | 5/11
15 h-m-p 0.8801 5.3744 0.0247
QuantileBeta(0.15, 0.00500, 2.17935) = 1.208387e-160 2000 rounds
YYC 1008.831867 2 0.6150 302 | 5/11
16 h-m-p 1.6000 8.0000 0.0056
QuantileBeta(0.15, 0.00500, 2.14318) = 1.234218e-160 2000 rounds
CC 1008.825694 1 1.9574 324 | 5/11
17 h-m-p 0.3883 3.2687 0.0281
QuantileBeta(0.15, 0.00500, 2.16196) = 1.220672e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.14570) = 1.232384e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.13852) = 1.237631e-160 2000 rounds
C 1008.819211 2 0.4666 348 | 5/11
18 h-m-p 1.6000 8.0000 0.0010 YC 1008.818883 1 0.7528 369 | 5/11
19 h-m-p 1.6000 8.0000 0.0003 Y 1008.818883 0 3.1019 389 | 5/11
20 h-m-p 1.5139 8.0000 0.0005 ++ 1008.818882 m 8.0000 409 | 5/11
21 h-m-p 0.4361 8.0000 0.0099 +++ 1008.818871 m 8.0000 430 | 5/11
22 h-m-p 0.6639 8.0000 0.1190 ++ 1008.818734 m 8.0000 450 | 5/11
23 h-m-p 0.5583 8.0000 1.7049
QuantileBeta(0.15, 0.00500, 2.13284) = 1.241806e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13656) = 1.239066e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.14937) = 1.229722e-160 2000 rounds
+ 1008.817458 m 8.0000 470
QuantileBeta(0.15, 0.00500, 2.14937) = 1.229722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14937) = 1.229722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14937) = 1.229722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14937) = 1.229722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14937) = 1.229722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14937) = 1.229722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14937) = 1.229722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14937) = 1.229722e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14937) = 1.229721e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14937) = 1.229722e-160 2000 rounds
| 5/11
24 h-m-p 0.8871 4.4357 7.4220
QuantileBeta(0.15, 0.00500, 2.15933) = 1.222552e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18921) = 1.201529e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19917) = 1.194679e-160 2000 rounds
+ 1008.808528 m 4.4357 484
QuantileBeta(0.15, 0.00500, 2.19917) = 1.194679e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19917) = 1.194679e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19917) = 1.194679e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19917) = 1.194679e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19917) = 1.194679e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19917) = 1.194679e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19917) = 1.194679e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19917) = 1.194679e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19917) = 1.236385e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19917) = 1.194678e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19917) = 1.194679e-160 2000 rounds
| 6/11
25 h-m-p 0.5698 8.0000 2.0369
QuantileBeta(0.15, 0.00500, 2.25333) = 1.158744e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41582) = 1.062723e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27545) = 1.144677e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.34563) = 1.102194e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27832) = 1.142875e-160 2000 rounds
C 1008.806969 1 0.8327 500
QuantileBeta(0.15, 0.00500, 2.27832) = 1.142875e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27832) = 1.142875e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27832) = 1.142875e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27832) = 1.142875e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27832) = 1.142875e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27832) = 1.142875e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27832) = 1.142875e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27832) = 1.142875e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27832) = 1.182773e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27832) = 1.142874e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27832) = 1.142875e-160 2000 rounds
| 6/11
26 h-m-p 1.6000 8.0000 0.2613
QuantileBeta(0.15, 0.00500, 2.25990) = 1.154534e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27371) = 1.145768e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26966) = 1.148327e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
C 1008.806917 1 0.7550 515
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26963) = 1.188436e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26975) = 1.148269e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26950) = 1.148426e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26963) = 1.148348e-160 2000 rounds
| 6/11
27 h-m-p 1.6000 8.0000 0.1012
QuantileBeta(0.15, 0.00500, 2.27612) = 1.144257e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29559) = 1.132155e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
Y 1008.806914 0 0.9680 534
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.185871e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27368) = 1.145791e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27343) = 1.145947e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27355) = 1.145869e-160 2000 rounds
| 6/11
28 h-m-p 1.6000 8.0000 0.0364
QuantileBeta(0.15, 0.00500, 2.27607) = 1.144288e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28361) = 1.139570e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
+ 1008.806912 m 8.0000 553
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28613) = 1.177734e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28625) = 1.137929e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28600) = 1.138084e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28613) = 1.138007e-160 2000 rounds
| 6/11
29 h-m-p 0.1994 8.0000 1.4603
QuantileBeta(0.15, 0.00500, 2.29876) = 1.130209e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33668) = 1.107440e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.48834) = 1.024776e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.79328) = 8.908219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47567) = 1.031208e-160 2000 rounds
C 1008.806896 0 2.9900 574
QuantileBeta(0.15, 0.00500, 2.47567) = 1.031208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47567) = 1.031208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47567) = 1.031208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47567) = 1.031208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47567) = 1.031208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47567) = 1.031208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47567) = 1.031208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47567) = 1.031208e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47567) = 1.067207e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47568) = 1.031207e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47567) = 1.031208e-160 2000 rounds
| 6/11
30 h-m-p 1.6000 8.0000 2.3540
QuantileBeta(0.15, 0.00500, 2.63991) = 9.535447e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.13263) = 7.775069e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.29687) = 7.323695e-161 2000 rounds
+ 1008.806724 m 8.0000 588
QuantileBeta(0.15, 0.00500, 3.29687) = 7.323695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29687) = 7.323695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29687) = 7.323695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29687) = 7.323695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29687) = 7.323695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29687) = 7.323695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29687) = 7.323695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29687) = 7.323695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29687) = 7.579362e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29687) = 7.323690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29687) = 7.323695e-161 2000 rounds
| 6/11
31 h-m-p 0.0087 0.0436 478.4676
QuantileBeta(0.15, 0.00500, 3.47870) = 6.881152e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02421) = 5.824330e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.20604) = 5.540484e-161 2000 rounds
+ 1008.806542 m 0.0436 602
QuantileBeta(0.15, 0.00500, 4.20604) = 5.540484e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.20604) = 5.540484e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.20604) = 5.540484e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.20604) = 5.540484e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.20604) = 5.540484e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.20604) = 5.540484e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.20604) = 5.540484e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.20604) = 5.540484e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.20604) = 5.733901e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.20604) = 5.540481e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.20604) = 5.540484e-161 2000 rounds
| 7/11
32 h-m-p 1.6000 8.0000 0.1689
QuantileBeta(0.15, 0.00500, 4.47629) = 5.166176e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.28701) = 4.295128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42240) = 5.236730e-161 2000 rounds
C 1008.806523 0 1.2810 616
QuantileBeta(0.15, 0.00500, 4.42240) = 5.236730e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42240) = 5.236730e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42240) = 5.236730e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42240) = 5.236730e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42240) = 5.236730e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42240) = 5.236730e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42240) = 5.236730e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42240) = 5.236730e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42240) = 5.236730e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42240) = 5.236730e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42240) = 5.236730e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42240) = 5.419543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42257) = 5.236500e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42223) = 5.236961e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42240) = 5.236730e-161 2000 rounds
| 7/11
33 h-m-p 0.5836 8.0000 0.3707
QuantileBeta(0.15, 0.00500, 4.63876) = 4.964478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.28783) = 4.294398e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.38816) = 2.988202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98944) = 4.578548e-161 2000 rounds
Y 1008.806522 0 1.5296 635
QuantileBeta(0.15, 0.00500, 4.98944) = 4.578548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98944) = 4.578548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98944) = 4.578548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98944) = 4.578548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98944) = 4.578548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98944) = 4.578548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98944) = 4.578548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98944) = 4.578548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98944) = 4.578548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98944) = 4.578548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98944) = 4.578548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98944) = 4.738383e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98962) = 4.578359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98925) = 4.578736e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98944) = 4.578548e-161 2000 rounds
| 7/11
34 h-m-p 1.6000 8.0000 0.0980
QuantileBeta(0.15, 0.00500, 5.14624) = 4.424707e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02864) = 4.539095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02054) = 4.547190e-161 2000 rounds
Y 1008.806522 0 0.3174 653
QuantileBeta(0.15, 0.00500, 5.02054) = 4.547190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02054) = 4.547190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02054) = 4.547190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02054) = 4.547190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02054) = 4.547190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02054) = 4.547190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02054) = 4.547190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02054) = 4.547190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02054) = 4.547190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02054) = 4.547190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02054) = 4.547190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02054) = 4.705931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02072) = 4.547004e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02035) = 4.547377e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.02054) = 4.547190e-161 2000 rounds
| 7/11
35 h-m-p 0.0776 8.0000 0.4008
QuantileBeta(0.15, 0.00500, 5.05164) = 4.516258e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.14495) = 4.425933e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.51818) = 4.098032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16659) = 4.405491e-161 2000 rounds
C 1008.806522 0 0.3644 672
QuantileBeta(0.15, 0.00500, 5.16659) = 4.405491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16659) = 4.405491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16659) = 4.405491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16659) = 4.405491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16659) = 4.405491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16659) = 4.405491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16659) = 4.405491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16659) = 4.405491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16659) = 4.405491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16659) = 4.405491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16659) = 4.405491e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16659) = 4.559286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16678) = 4.405313e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16640) = 4.405669e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16659) = 4.405491e-161 2000 rounds
| 7/11
36 h-m-p 0.2421 8.0000 0.6032
QuantileBeta(0.15, 0.00500, 5.31265) = 4.272342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.75082) = 3.917105e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43550) = 4.166411e-161 2000 rounds
Y 1008.806522 0 0.4458 690
QuantileBeta(0.15, 0.00500, 5.43550) = 4.166411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43550) = 4.166411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43550) = 4.166411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43550) = 4.166411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43550) = 4.166411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43550) = 4.166411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43550) = 4.166411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43550) = 4.166411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43550) = 4.166411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43550) = 4.166411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43550) = 4.166411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43550) = 4.311859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43570) = 4.166247e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43531) = 4.166575e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.43550) = 4.166411e-161 2000 rounds
| 7/11
37 h-m-p 0.2845 8.0000 0.9452
QuantileBeta(0.15, 0.00500, 5.70442) = 3.951908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.51115) = 3.423060e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98570) = 3.749932e-161 2000 rounds
Y 1008.806522 0 0.5821 708
QuantileBeta(0.15, 0.00500, 5.98570) = 3.749932e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98570) = 3.749932e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98570) = 3.749932e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98570) = 3.749932e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98570) = 3.749932e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98570) = 3.749932e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98570) = 3.749932e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98570) = 3.749932e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98570) = 3.749932e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98570) = 3.749932e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98570) = 3.749932e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98570) = 3.880841e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98590) = 3.749792e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98549) = 3.750072e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.98570) = 3.749932e-161 2000 rounds
| 7/11
38 h-m-p 0.4794 8.0000 1.1477
QuantileBeta(0.15, 0.00500, 6.53589) = 3.409065e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.18647) = 2.678410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.26109) = 3.044242e-161 2000 rounds
Y 1008.806522 0 1.1113 726
QuantileBeta(0.15, 0.00500, 7.26109) = 3.044242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.26109) = 3.044242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.26109) = 3.044242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.26109) = 3.044242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.26109) = 3.044242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.26109) = 3.044242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.26109) = 3.044242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.26109) = 3.044242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.26109) = 3.150515e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.26109) = 3.044240e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.26109) = 3.044242e-161 2000 rounds
| 7/11
39 h-m-p 1.6000 8.0000 0.7874
QuantileBeta(0.15, 0.00500, 6.00126) = 3.739360e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.22176) = 1.179430e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54844) = 3.402010e-161 2000 rounds
Y 1008.806522 0 0.9051 740
QuantileBeta(0.15, 0.00500, 6.54844) = 3.402010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54844) = 3.402010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54844) = 3.402010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54844) = 3.402010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54844) = 3.402010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54844) = 3.402010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54844) = 3.402010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54844) = 3.402010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54844) = 3.402010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54844) = 3.402010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54844) = 3.402010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54844) = 3.520773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54866) = 3.401889e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54823) = 3.402132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.54844) = 3.402010e-161 2000 rounds
| 7/11
40 h-m-p 1.6000 8.0000 0.2425
QuantileBeta(0.15, 0.00500, 6.93643) = 3.197438e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.10039) = 2.708691e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.48838) = 2.577348e-161 2000 rounds
+ 1008.806522 m 8.0000 758
QuantileBeta(0.15, 0.00500, 8.48838) = 2.577348e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48838) = 2.577348e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48838) = 2.577348e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48838) = 2.577348e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48838) = 2.577348e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48838) = 2.577348e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48838) = 2.577348e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48838) = 2.577348e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48838) = 2.577348e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48838) = 2.577348e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48838) = 2.577348e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48838) = 2.667323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48864) = 2.577267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48813) = 2.577430e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.48838) = 2.577348e-161 2000 rounds
| 7/11
41 h-m-p 1.6000 8.0000 1.1767
QuantileBeta(0.15, 0.00500, 10.37118) = 2.086346e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.01956) = 1.327474e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 17.90235) = 1.183915e-161 2000 rounds
+ 1008.806522 m 8.0000 776
QuantileBeta(0.15, 0.00500, 17.90235) = 1.183915e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.90235) = 1.183915e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.90235) = 1.183915e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.90235) = 1.183915e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.90235) = 1.183915e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.90235) = 1.183915e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.90235) = 1.183915e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.90235) = 1.183915e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.90235) = 1.225245e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.90236) = 1.183914e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.90235) = 1.183915e-161 2000 rounds
| 7/11
42 h-m-p 1.6000 8.0000 0.7999
QuantileBeta(0.15, 0.00500, 16.62256) = 1.277849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.58240) = 1.206080e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.82237) = 1.189379e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
Y 1008.806522 0 0.1754 791
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.235200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76244) = 1.193506e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76164) = 1.193562e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
| 7/11
43 h-m-p 0.0059 0.7452 23.8280
QuantileBeta(0.15, 0.00500, 17.62173) = 1.203311e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.72696) = 1.195963e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.75327) = 1.194140e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.75985) = 1.193685e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76149) = 1.193572e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76190) = 1.193543e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76201) = 1.193536e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76203) = 1.193535e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.235200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76205) = 1.193533e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
| 7/11
44 h-m-p 0.0035 1.7607 0.0208
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
Y 1008.806522 0 0.0000 838
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.235200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76244) = 1.193506e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76164) = 1.193562e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
| 7/11
45 h-m-p 0.0009 0.4503 0.0178
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
N 1008.806522 0 0.0000 864
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.235200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76244) = 1.193506e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76164) = 1.193562e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
| 7/11
46 h-m-p 0.0075 3.7398 0.0033
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
C 1008.806522 0 0.0001 884
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.235200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76244) = 1.193506e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76164) = 1.193562e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
| 7/11
47 h-m-p 0.1048 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
Y 1008.806522 0 0.0000 907
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
Out..
lnL = -1008.806522
908 lfun, 10896 eigenQcodon, 59928 P(t)
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1013.883758 S = -1009.849980 -4.756019
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:26
did 20 / 56 patterns 0:26
did 30 / 56 patterns 0:26
did 40 / 56 patterns 0:27
did 50 / 56 patterns 0:27
did 56 / 56 patterns 0:27
QuantileBeta(0.15, 0.00500, 17.76204) = 1.193534e-161 2000 rounds
Time used: 0:27
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=251
NC_011896_1_WP_010909018_1_2849_MLBR_RS13570 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
NC_002677_1_NP_302699_1_1571_ML2664 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
**************************************************
NC_011896_1_WP_010909018_1_2849_MLBR_RS13570 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
NC_002677_1_NP_302699_1_1571_ML2664 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005 GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
**************************************************
NC_011896_1_WP_010909018_1_2849_MLBR_RS13570 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
NC_002677_1_NP_302699_1_1571_ML2664 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005 YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
**************************************************
NC_011896_1_WP_010909018_1_2849_MLBR_RS13570 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
NC_002677_1_NP_302699_1_1571_ML2664 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005 SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
************************************** ***********
NC_011896_1_WP_010909018_1_2849_MLBR_RS13570 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
NC_002677_1_NP_302699_1_1571_ML2664 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005 TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
**************************************************
NC_011896_1_WP_010909018_1_2849_MLBR_RS13570 A
NC_002677_1_NP_302699_1_1571_ML2664 A
NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305 A
NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535 A
NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670 A
NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005 A
*
>NC_011896_1_WP_010909018_1_2849_MLBR_RS13570 ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG GCC >NC_002677_1_NP_302699_1_1571_ML2664 ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG GCC >NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305 ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC TAAATTCTCCCGAAGAGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG GCC >NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535 ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC TAAATTCTCCCGAAGAGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG GCC >NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670 ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG GCC >NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005 ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG GCC
>NC_011896_1_WP_010909018_1_2849_MLBR_RS13570 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV A >NC_002677_1_NP_302699_1_1571_ML2664 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV A >NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV A >NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV A >NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV A >NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005 MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV A
#NEXUS
[ID: 9217139409]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010909018_1_2849_MLBR_RS13570
NC_002677_1_NP_302699_1_1571_ML2664
NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305
NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535
NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670
NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005
;
end;
begin trees;
translate
1 NC_011896_1_WP_010909018_1_2849_MLBR_RS13570,
2 NC_002677_1_NP_302699_1_1571_ML2664,
3 NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305,
4 NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535,
5 NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670,
6 NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06421438,2:0.0647448,3:0.06912487,4:0.06625329,5:0.06655196,6:0.06298005);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06421438,2:0.0647448,3:0.06912487,4:0.06625329,5:0.06655196,6:0.06298005);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1048.54 -1052.35
2 -1048.36 -1052.96
--------------------------------------
TOTAL -1048.44 -1052.70
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882020 0.086527 0.322637 1.447854 0.850960 1501.00 1501.00 1.002
r(A<->C){all} 0.164480 0.018826 0.000015 0.432994 0.129208 239.24 280.18 1.000
r(A<->G){all} 0.200859 0.024351 0.000190 0.499666 0.162464 109.08 120.31 1.018
r(A<->T){all} 0.168791 0.019816 0.000035 0.450054 0.131825 254.71 278.25 1.000
r(C<->G){all} 0.142895 0.016164 0.000151 0.403968 0.106227 140.78 201.31 1.004
r(C<->T){all} 0.167274 0.021554 0.000157 0.461951 0.127983 239.62 294.87 1.001
r(G<->T){all} 0.155700 0.019968 0.000041 0.437048 0.113003 173.88 251.06 1.004
pi(A){all} 0.207961 0.000210 0.181667 0.239358 0.207673 1276.66 1354.05 1.000
pi(C){all} 0.293996 0.000259 0.263044 0.325815 0.293898 1259.37 1278.65 1.000
pi(G){all} 0.286237 0.000255 0.253865 0.315040 0.285845 1170.86 1227.26 1.000
pi(T){all} 0.211805 0.000213 0.184571 0.240662 0.211681 1407.11 1409.80 1.000
alpha{1,2} 0.385696 0.202676 0.000112 1.293237 0.236710 857.77 1002.27 1.000
alpha{3} 0.419209 0.224495 0.000288 1.411156 0.244980 1078.75 1239.18 1.000
pinvar{all} 0.995784 0.000014 0.988635 0.999928 0.996819 1108.32 1245.01 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/ML2664/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 251
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 5 5 5 5 5 5 | Cys TGT 1 1 1 1 1 1
TTC 6 6 6 6 6 6 | TCC 3 3 3 3 3 3 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 4 4 4 4 4 4 | His CAT 3 3 3 3 3 3 | Arg CGT 3 3 3 3 3 3
CTC 2 2 2 2 2 2 | CCC 3 3 3 3 3 3 | CAC 3 3 3 3 3 3 | CGC 2 2 2 2 2 2
CTA 4 4 4 4 4 4 | CCA 3 3 3 3 3 3 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 5 5 5 5 5 5 | CCG 8 8 8 8 8 8 | CAG 4 4 4 4 4 4 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 7 7 7 7 7 7 | ACC 16 16 16 16 16 16 | AAC 9 9 9 9 9 9 | AGC 6 6 6 6 6 6
ATA 2 2 2 2 2 2 | ACA 3 3 3 3 3 3 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 7 7 7 7 7 7 | ACG 5 5 5 5 5 5 | AAG 5 5 5 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 7 7 7 7 7 7 | Ala GCT 4 4 4 4 4 4 | Asp GAT 2 2 2 2 2 2 | Gly GGT 7 7 7 7 7 7
GTC 8 8 8 8 8 8 | GCC 8 8 8 8 8 8 | GAC 6 6 6 6 6 6 | GGC 6 6 6 6 6 6
GTA 3 3 3 3 3 3 | GCA 4 4 4 4 4 4 | Glu GAA 5 5 5 5 5 5 | GGA 3 3 3 3 3 3
GTG 15 15 15 15 15 15 | GCG 9 9 9 9 9 9 | GAG 5 5 6 6 5 5 | GGG 1 1 0 0 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570
position 1: T:0.15538 C:0.20319 A:0.27092 G:0.37052
position 2: T:0.29482 C:0.33068 A:0.21116 G:0.16335
position 3: T:0.18725 C:0.35458 A:0.13546 G:0.32271
Average T:0.21248 C:0.29615 A:0.20584 G:0.28552
#2: NC_002677_1_NP_302699_1_1571_ML2664
position 1: T:0.15538 C:0.20319 A:0.27092 G:0.37052
position 2: T:0.29482 C:0.33068 A:0.21116 G:0.16335
position 3: T:0.18725 C:0.35458 A:0.13546 G:0.32271
Average T:0.21248 C:0.29615 A:0.20584 G:0.28552
#3: NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305
position 1: T:0.15538 C:0.20319 A:0.27092 G:0.37052
position 2: T:0.29482 C:0.33068 A:0.21514 G:0.15936
position 3: T:0.18725 C:0.35458 A:0.13546 G:0.32271
Average T:0.21248 C:0.29615 A:0.20717 G:0.28420
#4: NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535
position 1: T:0.15538 C:0.20319 A:0.27092 G:0.37052
position 2: T:0.29482 C:0.33068 A:0.21514 G:0.15936
position 3: T:0.18725 C:0.35458 A:0.13546 G:0.32271
Average T:0.21248 C:0.29615 A:0.20717 G:0.28420
#5: NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670
position 1: T:0.15538 C:0.20319 A:0.27092 G:0.37052
position 2: T:0.29482 C:0.33068 A:0.21116 G:0.16335
position 3: T:0.18725 C:0.35458 A:0.13546 G:0.32271
Average T:0.21248 C:0.29615 A:0.20584 G:0.28552
#6: NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005
position 1: T:0.15538 C:0.20319 A:0.27092 G:0.37052
position 2: T:0.29482 C:0.33068 A:0.21116 G:0.16335
position 3: T:0.18725 C:0.35458 A:0.13546 G:0.32271
Average T:0.21248 C:0.29615 A:0.20584 G:0.28552
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 12 | Tyr Y TAT 30 | Cys C TGT 6
TTC 36 | TCC 18 | TAC 24 | TGC 0
Leu L TTA 0 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 30 | TAG 0 | Trp W TGG 36
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 24 | His H CAT 18 | Arg R CGT 18
CTC 12 | CCC 18 | CAC 18 | CGC 12
CTA 24 | CCA 18 | Gln Q CAA 6 | CGA 6
CTG 30 | CCG 48 | CAG 24 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 6
ATC 42 | ACC 96 | AAC 54 | AGC 36
ATA 12 | ACA 18 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 42 | ACG 30 | AAG 30 | AGG 0
------------------------------------------------------------------------------
Val V GTT 42 | Ala A GCT 24 | Asp D GAT 12 | Gly G GGT 42
GTC 48 | GCC 48 | GAC 36 | GGC 36
GTA 18 | GCA 24 | Glu E GAA 30 | GGA 18
GTG 90 | GCG 54 | GAG 32 | GGG 4
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15538 C:0.20319 A:0.27092 G:0.37052
position 2: T:0.29482 C:0.33068 A:0.21248 G:0.16202
position 3: T:0.18725 C:0.35458 A:0.13546 G:0.32271
Average T:0.21248 C:0.29615 A:0.20629 G:0.28508
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 8): -1013.866804 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.004006 0.004006 0.000004 0.000004 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.008029
(1: 0.000004, 2: 0.000004, 3: 0.004006, 4: 0.004006, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909018_1_2849_MLBR_RS13570: 0.000004, NC_002677_1_NP_302699_1_1571_ML2664: 0.000004, NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305: 0.004006, NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535: 0.004006, NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670: 0.000004, NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 535.4 217.6 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 535.4 217.6 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.004 535.4 217.6 999.0000 0.0019 0.0000 1.0 0.0
7..4 0.004 535.4 217.6 999.0000 0.0019 0.0000 1.0 0.0
7..5 0.000 535.4 217.6 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 535.4 217.6 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0038
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 9): -1014.333469 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.004052 0.004052 0.000004 0.000004 951.433809 0.599459 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.008120
(1: 0.000004, 2: 0.000004, 3: 0.004052, 4: 0.004052, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909018_1_2849_MLBR_RS13570: 0.000004, NC_002677_1_NP_302699_1_1571_ML2664: 0.000004, NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305: 0.004052, NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535: 0.004052, NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670: 0.000004, NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.43381
MLEs of dN/dS (w) for site classes (K=2)
p: 0.59946 0.40054
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 535.4 217.6 0.4005 0.0000 0.0000 0.0 0.0
7..2 0.000 535.4 217.6 0.4005 0.0000 0.0000 0.0 0.0
7..3 0.004 535.4 217.6 0.4005 0.0009 0.0024 0.5 0.5
7..4 0.004 535.4 217.6 0.4005 0.0009 0.0024 0.5 0.5
7..5 0.000 535.4 217.6 0.4005 0.0000 0.0000 0.0 0.0
7..6 0.000 535.4 217.6 0.4005 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 11): -1008.806523 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.006900 0.006900 0.000004 0.000004 999.000000 0.994689 0.000000 0.000001 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.013815
(1: 0.000004, 2: 0.000004, 3: 0.006900, 4: 0.006900, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909018_1_2849_MLBR_RS13570: 0.000004, NC_002677_1_NP_302699_1_1571_ML2664: 0.000004, NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305: 0.006900, NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535: 0.006900, NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670: 0.000004, NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99469 0.00000 0.00531
w: 0.00000 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 535.4 217.6 5.3056 0.0000 0.0000 0.0 0.0
7..2 0.000 535.4 217.6 5.3056 0.0000 0.0000 0.0 0.0
7..3 0.007 535.4 217.6 5.3056 0.0030 0.0006 1.6 0.1
7..4 0.007 535.4 217.6 5.3056 0.0030 0.0006 1.6 0.1
7..5 0.000 535.4 217.6 5.3056 0.0000 0.0000 0.0 0.0
7..6 0.000 535.4 217.6 5.3056 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)
Pr(w>1) post mean +- SE for w
189 G 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)
Pr(w>1) post mean +- SE for w
189 G 0.921 6.688 +- 2.925
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.108 0.105 0.104 0.102 0.100 0.099 0.097 0.096 0.095 0.094
w2: 0.032 0.052 0.071 0.088 0.103 0.115 0.124 0.132 0.139 0.144
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.006
0.011 0.008 0.006
0.012 0.012 0.011 0.008 0.006
0.011 0.012 0.012 0.012 0.011 0.008 0.006
0.010 0.011 0.012 0.012 0.013 0.012 0.012 0.009 0.006
0.009 0.010 0.010 0.011 0.012 0.013 0.013 0.012 0.012 0.009 0.006
0.008 0.008 0.009 0.010 0.011 0.012 0.012 0.013 0.013 0.013 0.012 0.009 0.006
0.006 0.007 0.008 0.009 0.009 0.010 0.011 0.012 0.013 0.013 0.013 0.013 0.012 0.009 0.006
0.006 0.006 0.007 0.007 0.008 0.009 0.010 0.011 0.011 0.012 0.013 0.014 0.014 0.013 0.012 0.009 0.006
0.005 0.005 0.006 0.006 0.007 0.008 0.008 0.009 0.010 0.011 0.012 0.013 0.013 0.014 0.014 0.013 0.013 0.009 0.006
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 9): -1014.537508 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.004026 0.004026 0.000004 0.000004 951.428628 3.027879 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.008068
(1: 0.000004, 2: 0.000004, 3: 0.004026, 4: 0.004026, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909018_1_2849_MLBR_RS13570: 0.000004, NC_002677_1_NP_302699_1_1571_ML2664: 0.000004, NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305: 0.004026, NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535: 0.004026, NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670: 0.000004, NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42863
Parameters in M7 (beta):
p = 3.02788 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 535.4 217.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 535.4 217.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.004 535.4 217.6 1.0000 0.0013 0.0013 0.7 0.3
7..4 0.004 535.4 217.6 1.0000 0.0013 0.0013 0.7 0.3
7..5 0.000 535.4 217.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 535.4 217.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 11): -1008.806522 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.006899 0.006899 0.000004 0.000004 999.000000 0.994689 0.005000 17.762042 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.013814
(1: 0.000004, 2: 0.000004, 3: 0.006899, 4: 0.006899, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909018_1_2849_MLBR_RS13570: 0.000004, NC_002677_1_NP_302699_1_1571_ML2664: 0.000004, NZ_LVXE01000015_1_WP_064430345_1_560_A3216_RS06305: 0.006899, NZ_LYPH01000020_1_WP_064430345_1_747_A8144_RS03535: 0.006899, NZ_CP029543_1_WP_010909018_1_2883_DIJ64_RS14670: 0.000004, NZ_AP014567_1_WP_010909018_1_2950_JK2ML_RS15005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
Parameters in M8 (beta&w>1):
p0 = 0.99469 p = 0.00500 q = 17.76204
(p1 = 0.00531) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09947 0.09947 0.09947 0.09947 0.09947 0.09947 0.09947 0.09947 0.09947 0.09947 0.00531
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 535.4 217.6 5.3055 0.0000 0.0000 0.0 0.0
7..2 0.000 535.4 217.6 5.3055 0.0000 0.0000 0.0 0.0
7..3 0.007 535.4 217.6 5.3055 0.0030 0.0006 1.6 0.1
7..4 0.007 535.4 217.6 5.3055 0.0030 0.0006 1.6 0.1
7..5 0.000 535.4 217.6 5.3055 0.0000 0.0000 0.0 0.0
7..6 0.000 535.4 217.6 5.3055 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)
Pr(w>1) post mean +- SE for w
189 G 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)
Pr(w>1) post mean +- SE for w
189 G 0.967* 6.592 +- 2.756
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.050 0.059 0.071 0.085 0.102 0.121 0.139 0.151 0.141 0.081
p : 0.109 0.105 0.103 0.101 0.099 0.098 0.097 0.097 0.096 0.095
q : 0.093 0.096 0.098 0.099 0.100 0.101 0.102 0.103 0.104 0.104
ws: 0.036 0.063 0.085 0.100 0.110 0.117 0.120 0.122 0.123 0.123
Time used: 0:27
Model 1: NearlyNeutral -1014.333469
Model 2: PositiveSelection -1008.806523
Model 0: one-ratio -1013.866804
Model 7: beta -1014.537508
Model 8: beta&w>1 -1008.806522
Model 0 vs 1 0.933330000000069
Model 2 vs 1 11.053892000000133
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)
Pr(w>1) post mean +- SE for w
189 G 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)
Pr(w>1) post mean +- SE for w
189 G 0.921 6.688 +- 2.925
Model 8 vs 7 11.46197200000006
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)
Pr(w>1) post mean +- SE for w
189 G 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)
Pr(w>1) post mean +- SE for w
189 G 0.967* 6.592 +- 2.756
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
