--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 12:24:46 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/ML2664/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1048.54         -1052.35
2      -1048.36         -1052.96
--------------------------------------
TOTAL    -1048.44         -1052.70
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.882020    0.086527    0.322637    1.447854    0.850960   1501.00   1501.00    1.002
r(A<->C){all}   0.164480    0.018826    0.000015    0.432994    0.129208    239.24    280.18    1.000
r(A<->G){all}   0.200859    0.024351    0.000190    0.499666    0.162464    109.08    120.31    1.018
r(A<->T){all}   0.168791    0.019816    0.000035    0.450054    0.131825    254.71    278.25    1.000
r(C<->G){all}   0.142895    0.016164    0.000151    0.403968    0.106227    140.78    201.31    1.004
r(C<->T){all}   0.167274    0.021554    0.000157    0.461951    0.127983    239.62    294.87    1.001
r(G<->T){all}   0.155700    0.019968    0.000041    0.437048    0.113003    173.88    251.06    1.004
pi(A){all}      0.207961    0.000210    0.181667    0.239358    0.207673   1276.66   1354.05    1.000
pi(C){all}      0.293996    0.000259    0.263044    0.325815    0.293898   1259.37   1278.65    1.000
pi(G){all}      0.286237    0.000255    0.253865    0.315040    0.285845   1170.86   1227.26    1.000
pi(T){all}      0.211805    0.000213    0.184571    0.240662    0.211681   1407.11   1409.80    1.000
alpha{1,2}      0.385696    0.202676    0.000112    1.293237    0.236710    857.77   1002.27    1.000
alpha{3}        0.419209    0.224495    0.000288    1.411156    0.244980   1078.75   1239.18    1.000
pinvar{all}     0.995784    0.000014    0.988635    0.999928    0.996819   1108.32   1245.01    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1014.333469
Model 2: PositiveSelection	-1008.806523
Model 0: one-ratio	-1013.866804
Model 7: beta	-1014.537508
Model 8: beta&w>1	-1008.806522


Model 0 vs 1	0.933330000000069

Model 2 vs 1	11.053892000000133

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)

            Pr(w>1)     post mean +- SE for w

   189 G      1.000**       999.000

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)

            Pr(w>1)     post mean +- SE for w

   189 G      0.921         6.688 +- 2.925


Model 8 vs 7	11.46197200000006

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)

            Pr(w>1)     post mean +- SE for w

   189 G      1.000**       999.000

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909018_1_2849_MLBR_RS13570)

            Pr(w>1)     post mean +- SE for w

   189 G      0.967*        6.592 +- 2.756

>C1
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C2
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C3
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C4
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C5
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C6
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=251 

C1              MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C2              MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C3              MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C4              MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C5              MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C6              MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
                **************************************************

C1              GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C2              GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C3              GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C4              GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C5              GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C6              GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
                **************************************************

C1              YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C2              YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C3              YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C4              YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C5              YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C6              YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
                **************************************************

C1              SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
C2              SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
C3              SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
C4              SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
C5              SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
C6              SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
                ************************************** ***********

C1              TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C2              TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C3              TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C4              TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C5              TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C6              TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
                **************************************************

C1              A
C2              A
C3              A
C4              A
C5              A
C6              A
                *




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  251 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  251 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7530]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [7530]--->[7530]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.494 Mb, Max= 30.804 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C2              MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C3              MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C4              MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C5              MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
C6              MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
                **************************************************

C1              GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C2              GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C3              GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C4              GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C5              GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
C6              GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
                **************************************************

C1              YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C2              YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C3              YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C4              YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C5              YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
C6              YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
                **************************************************

C1              SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
C2              SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
C3              SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
C4              SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
C5              SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
C6              SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
                ************************************** ***********

C1              TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C2              TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C3              TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C4              TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C5              TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
C6              TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
                **************************************************

C1              A
C2              A
C3              A
C4              A
C5              A
C6              A
                *




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 99.60 C1	 C3	 99.60
TOP	    2    0	 99.60 C3	 C1	 99.60
BOT	    0    3	 99.60 C1	 C4	 99.60
TOP	    3    0	 99.60 C4	 C1	 99.60
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 99.60 C2	 C3	 99.60
TOP	    2    1	 99.60 C3	 C2	 99.60
BOT	    1    3	 99.60 C2	 C4	 99.60
TOP	    3    1	 99.60 C4	 C2	 99.60
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 99.60 C3	 C5	 99.60
TOP	    4    2	 99.60 C5	 C3	 99.60
BOT	    2    5	 99.60 C3	 C6	 99.60
TOP	    5    2	 99.60 C6	 C3	 99.60
BOT	    3    4	 99.60 C4	 C5	 99.60
TOP	    4    3	 99.60 C5	 C4	 99.60
BOT	    3    5	 99.60 C4	 C6	 99.60
TOP	    5    3	 99.60 C6	 C4	 99.60
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 99.84
AVG	 1	 C2	  *	 99.84
AVG	 2	 C3	  *	 99.68
AVG	 3	 C4	  *	 99.68
AVG	 4	 C5	  *	 99.84
AVG	 5	 C6	  *	 99.84
TOT	 TOT	  *	 99.79
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
C2              ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
C3              ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
C4              ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
C5              ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
C6              ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
                **************************************************

C1              GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
C2              GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
C3              GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
C4              GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
C5              GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
C6              GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
                **************************************************

C1              AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
C2              AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
C3              AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
C4              AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
C5              AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
C6              AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
                **************************************************

C1              GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
C2              GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
C3              GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
C4              GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
C5              GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
C6              GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
                **************************************************

C1              CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
C2              CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
C3              CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
C4              CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
C5              CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
C6              CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
                **************************************************

C1              GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
C2              GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
C3              GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
C4              GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
C5              GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
C6              GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
                **************************************************

C1              TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
C2              TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
C3              TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
C4              TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
C5              TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
C6              TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
                **************************************************

C1              GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
C2              GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
C3              GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
C4              GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
C5              GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
C6              GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
                **************************************************

C1              ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
C2              ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
C3              ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
C4              ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
C5              ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
C6              ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
                **************************************************

C1              TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
C2              TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
C3              TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
C4              TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
C5              TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
C6              TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
                **************************************************

C1              GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
C2              GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
C3              GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
C4              GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
C5              GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
C6              GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
                **************************************************

C1              TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
C2              TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
C3              TAAATTCTCCCGAAGAGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
C4              TAAATTCTCCCGAAGAGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
C5              TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
C6              TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
                ***************.**********************************

C1              ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
C2              ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
C3              ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
C4              ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
C5              ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
C6              ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
                **************************************************

C1              GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
C2              GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
C3              GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
C4              GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
C5              GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
C6              GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
                **************************************************

C1              CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
C2              CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
C3              CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
C4              CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
C5              CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
C6              CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
                **************************************************

C1              GCC
C2              GCC
C3              GCC
C4              GCC
C5              GCC
C6              GCC
                ***



>C1
ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
GCC
>C2
ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
GCC
>C3
ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
TAAATTCTCCCGAAGAGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
GCC
>C4
ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
TAAATTCTCCCGAAGAGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
GCC
>C5
ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
GCC
>C6
ATGTATCAAGCGGTTCGTTATCTACTTGTCATGGCCGCGATCATCCTGAT
GGCGGTGGCAGAATCAGGCAGCCCTAGCGTGGCCGCTATCCCTGCACTAA
AGCCGACCCCTGAAGTTGCTTCGGTGCTGCCTACTAACGGCGCGGTGGTG
GGTGTGGCTCATCTGGTGGTGGTGACGTTCACCGCACCGGTGACGGACCG
CTCCGCCGCTGAGCGGTCGATTCGTATAACATCGCCGAACAACATGACCG
GCCACTTCGAGTGGCTTGATGGAGATGTCGTGCAGTGGATTCCAACCAAG
TATTGGCCCGCCTACACTCATGTATCGGTCGAGGTTCAGGCGCTGACGAC
GGGCTTCGAAACCGGTGACGCGTTGCTCGGCGTTGCCAGCCTGTCCACGC
ACACCTTCACCGTCAGCAGAAACGGAGAGGTACTCCGTACCATGCCGGCG
TCCATGGGTAAGCCCACCCGGCCGACACCGATCGGTAAGTTCACCGCATT
GTCTAAGGAGCGCACCGTCGTGATGGACTCACGAACCATCGGTATTCCGC
TAAATTCTCCCGAAGGGTATTTGATCACCGCGCAGTACGCGGTTCGGGTT
ACCTGGAGCGGCGTCTACGTACACTCAGCCCCATGGTCGGTGAACTCACA
GGGTTACACCAACGTCAGTCATGGATGTATAAACCTAAGCCCAGACGACG
CCACATGGTATTTCAACACCGTTAACGTCGGTGACCCGATCGAAGTGGTG
GCC
>C1
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C2
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C3
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C4
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEEYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C5
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A
>C6
MYQAVRYLLVMAAIILMAVAESGSPSVAAIPALKPTPEVASVLPTNGAVV
GVAHLVVVTFTAPVTDRSAAERSIRITSPNNMTGHFEWLDGDVVQWIPTK
YWPAYTHVSVEVQALTTGFETGDALLGVASLSTHTFTVSRNGEVLRTMPA
SMGKPTRPTPIGKFTALSKERTVVMDSRTIGIPLNSPEGYLITAQYAVRV
TWSGVYVHSAPWSVNSQGYTNVSHGCINLSPDDATWYFNTVNVGDPIEVV
A


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 753 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579782192
      Setting output file names to "/data/10res/ML2664/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 339120909
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9217139409
      Seed = 906931531
      Swapseed = 1579782192
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1691.921940 -- -24.965149
         Chain 2 -- -1688.615690 -- -24.965149
         Chain 3 -- -1691.283654 -- -24.965149
         Chain 4 -- -1691.283750 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1691.263791 -- -24.965149
         Chain 2 -- -1691.921940 -- -24.965149
         Chain 3 -- -1691.283750 -- -24.965149
         Chain 4 -- -1691.283654 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1691.922] (-1688.616) (-1691.284) (-1691.284) * [-1691.264] (-1691.922) (-1691.284) (-1691.284) 
        500 -- (-1064.477) (-1069.427) [-1049.795] (-1054.909) * (-1069.867) (-1052.905) (-1052.822) [-1051.490] -- 0:00:00
       1000 -- (-1058.758) (-1064.289) (-1051.222) [-1048.653] * (-1057.217) (-1053.310) [-1052.280] (-1046.934) -- 0:00:00
       1500 -- (-1053.930) [-1052.938] (-1053.185) (-1054.451) * (-1047.608) [-1054.705] (-1054.681) (-1051.272) -- 0:00:00
       2000 -- (-1057.882) (-1052.305) (-1061.788) [-1054.062] * [-1049.171] (-1055.700) (-1063.598) (-1061.362) -- 0:00:00
       2500 -- (-1053.782) [-1055.195] (-1047.750) (-1063.952) * (-1063.071) (-1060.959) (-1060.923) [-1049.456] -- 0:00:00
       3000 -- (-1049.967) [-1057.513] (-1054.393) (-1051.435) * (-1053.217) (-1055.909) (-1055.256) [-1054.442] -- 0:00:00
       3500 -- (-1053.369) (-1050.819) [-1052.790] (-1053.662) * (-1056.638) (-1052.054) (-1055.646) [-1048.519] -- 0:04:44
       4000 -- [-1050.684] (-1053.349) (-1050.199) (-1061.555) * (-1056.652) (-1054.578) [-1053.935] (-1062.521) -- 0:04:09
       4500 -- (-1057.125) (-1051.283) (-1053.421) [-1050.145] * [-1047.807] (-1056.730) (-1056.879) (-1055.835) -- 0:03:41
       5000 -- (-1059.234) (-1049.495) [-1056.983] (-1047.336) * [-1047.103] (-1062.257) (-1050.703) (-1052.956) -- 0:03:19

      Average standard deviation of split frequencies: 0.114280

       5500 -- [-1054.902] (-1055.673) (-1051.014) (-1057.106) * (-1056.987) (-1057.045) (-1054.103) [-1054.520] -- 0:03:00
       6000 -- (-1055.327) [-1052.281] (-1051.069) (-1068.205) * (-1052.333) [-1059.019] (-1053.261) (-1053.361) -- 0:02:45
       6500 -- (-1057.390) (-1056.157) (-1051.179) [-1052.327] * (-1060.305) (-1048.205) [-1048.621] (-1053.612) -- 0:02:32
       7000 -- (-1048.681) (-1056.510) (-1051.723) [-1047.224] * (-1054.609) (-1056.224) [-1056.169] (-1055.506) -- 0:02:21
       7500 -- (-1060.211) (-1059.171) [-1049.462] (-1051.310) * [-1051.013] (-1050.815) (-1047.783) (-1052.841) -- 0:02:12
       8000 -- (-1053.511) [-1052.075] (-1050.440) (-1055.717) * (-1058.480) (-1054.001) [-1051.754] (-1051.967) -- 0:02:04
       8500 -- (-1055.960) [-1060.156] (-1067.614) (-1054.452) * (-1052.982) (-1051.497) (-1052.394) [-1050.638] -- 0:01:56
       9000 -- [-1052.632] (-1060.134) (-1065.860) (-1056.571) * [-1056.163] (-1058.025) (-1055.895) (-1059.685) -- 0:01:50
       9500 -- (-1052.261) [-1058.664] (-1058.070) (-1048.371) * [-1054.085] (-1058.072) (-1056.674) (-1049.334) -- 0:01:44
      10000 -- [-1053.374] (-1052.945) (-1056.486) (-1051.920) * (-1062.294) (-1047.999) (-1051.315) [-1050.664] -- 0:01:39

      Average standard deviation of split frequencies: 0.080353

      10500 -- (-1054.095) (-1054.015) (-1059.857) [-1052.113] * (-1054.195) (-1057.169) (-1057.336) [-1055.645] -- 0:01:34
      11000 -- (-1061.003) [-1053.980] (-1057.456) (-1054.416) * (-1059.391) [-1049.832] (-1051.593) (-1054.362) -- 0:01:29
      11500 -- (-1050.855) (-1057.918) (-1054.805) [-1049.357] * (-1063.304) (-1048.294) (-1055.378) [-1050.931] -- 0:01:25
      12000 -- (-1060.341) [-1054.600] (-1056.889) (-1053.638) * (-1056.183) (-1064.760) [-1052.663] (-1048.187) -- 0:01:22
      12500 -- (-1053.756) (-1052.168) (-1064.856) [-1050.905] * (-1060.791) (-1058.141) [-1053.970] (-1051.766) -- 0:01:19
      13000 -- [-1057.061] (-1052.603) (-1057.921) (-1049.845) * (-1055.524) [-1059.279] (-1056.284) (-1055.035) -- 0:01:15
      13500 -- (-1061.214) (-1053.808) (-1068.146) [-1049.451] * (-1048.610) (-1059.368) [-1055.041] (-1050.511) -- 0:01:13
      14000 -- (-1053.406) [-1053.904] (-1056.399) (-1050.970) * (-1052.753) (-1062.247) [-1053.310] (-1053.760) -- 0:01:10
      14500 -- (-1062.222) (-1059.661) (-1059.119) [-1055.159] * (-1051.825) (-1061.516) [-1052.365] (-1070.365) -- 0:01:07
      15000 -- (-1048.994) [-1049.028] (-1063.839) (-1053.453) * [-1049.848] (-1052.960) (-1053.444) (-1050.373) -- 0:01:05

      Average standard deviation of split frequencies: 0.077675

      15500 -- (-1055.340) (-1053.426) [-1055.164] (-1052.509) * [-1048.120] (-1057.420) (-1054.832) (-1059.020) -- 0:01:03
      16000 -- [-1052.523] (-1053.999) (-1053.732) (-1045.736) * (-1051.259) (-1048.975) (-1070.879) [-1050.247] -- 0:01:01
      16500 -- (-1050.855) (-1054.737) (-1054.251) [-1059.594] * [-1047.274] (-1049.724) (-1055.357) (-1051.524) -- 0:00:59
      17000 -- (-1049.377) (-1051.322) (-1047.043) [-1052.938] * (-1050.432) (-1051.363) (-1051.036) [-1050.350] -- 0:00:57
      17500 -- [-1054.410] (-1059.569) (-1056.845) (-1054.476) * [-1053.413] (-1053.682) (-1052.609) (-1050.139) -- 0:00:56
      18000 -- (-1060.119) (-1059.775) (-1054.370) [-1069.386] * (-1050.810) [-1051.524] (-1050.476) (-1049.770) -- 0:01:49
      18500 -- (-1050.227) [-1055.150] (-1065.739) (-1054.825) * (-1049.430) [-1049.445] (-1057.936) (-1050.980) -- 0:01:46
      19000 -- [-1048.327] (-1055.687) (-1052.388) (-1053.386) * (-1047.055) (-1048.615) [-1053.739] (-1049.281) -- 0:01:43
      19500 -- [-1048.782] (-1058.994) (-1060.606) (-1055.267) * (-1053.382) (-1049.747) (-1060.362) [-1048.470] -- 0:01:40
      20000 -- [-1052.251] (-1062.612) (-1057.124) (-1048.098) * (-1051.431) [-1051.180] (-1056.451) (-1046.412) -- 0:01:38

      Average standard deviation of split frequencies: 0.058062

      20500 -- (-1048.042) [-1055.068] (-1057.815) (-1050.274) * [-1047.147] (-1049.824) (-1055.056) (-1046.372) -- 0:01:35
      21000 -- (-1056.999) [-1055.541] (-1058.234) (-1053.582) * (-1051.767) (-1050.071) [-1055.711] (-1047.578) -- 0:01:33
      21500 -- [-1050.002] (-1056.070) (-1062.885) (-1056.636) * (-1050.745) (-1050.515) [-1057.070] (-1050.637) -- 0:01:31
      22000 -- (-1054.023) (-1058.106) (-1057.483) [-1062.285] * [-1048.631] (-1048.915) (-1059.653) (-1048.413) -- 0:01:28
      22500 -- [-1050.635] (-1053.862) (-1049.687) (-1051.913) * [-1048.877] (-1050.333) (-1055.187) (-1051.684) -- 0:01:26
      23000 -- [-1051.289] (-1059.713) (-1056.908) (-1056.642) * (-1048.440) (-1049.868) [-1048.838] (-1050.194) -- 0:01:24
      23500 -- (-1052.921) [-1054.191] (-1053.867) (-1051.504) * (-1047.379) (-1048.701) [-1056.416] (-1048.884) -- 0:01:23
      24000 -- (-1052.385) (-1055.188) (-1052.762) [-1050.883] * (-1051.667) (-1049.556) (-1055.362) [-1048.043] -- 0:01:21
      24500 -- (-1060.175) (-1053.995) (-1056.346) [-1048.217] * (-1052.712) (-1046.251) (-1050.703) [-1047.948] -- 0:01:19
      25000 -- (-1052.563) (-1059.718) [-1060.352] (-1059.713) * (-1049.818) (-1049.458) (-1057.098) [-1046.451] -- 0:01:18

      Average standard deviation of split frequencies: 0.037657

      25500 -- (-1056.287) (-1051.787) [-1057.401] (-1060.823) * (-1049.412) (-1052.072) (-1053.510) [-1049.589] -- 0:01:16
      26000 -- (-1048.282) (-1053.143) (-1064.327) [-1050.703] * (-1049.071) [-1048.372] (-1057.337) (-1052.858) -- 0:01:14
      26500 -- (-1052.327) (-1056.641) [-1065.002] (-1060.998) * (-1051.672) [-1048.972] (-1047.337) (-1047.710) -- 0:01:13
      27000 -- (-1051.381) (-1053.106) (-1065.255) [-1050.515] * (-1054.108) [-1052.457] (-1066.166) (-1052.020) -- 0:01:12
      27500 -- [-1049.078] (-1049.182) (-1049.135) (-1049.832) * (-1052.721) (-1050.620) (-1055.621) [-1049.393] -- 0:01:10
      28000 -- (-1052.027) (-1053.104) (-1048.687) [-1051.179] * (-1050.331) (-1051.382) [-1049.632] (-1048.124) -- 0:01:09
      28500 -- (-1054.557) (-1048.298) (-1049.346) [-1054.097] * (-1050.841) (-1050.005) [-1051.597] (-1049.292) -- 0:01:08
      29000 -- [-1048.884] (-1051.855) (-1046.596) (-1053.658) * (-1049.850) (-1046.732) [-1064.158] (-1049.733) -- 0:01:06
      29500 -- [-1052.791] (-1060.000) (-1051.666) (-1054.453) * (-1051.682) [-1051.069] (-1057.849) (-1048.073) -- 0:01:05
      30000 -- (-1052.266) (-1055.962) (-1058.255) [-1054.546] * [-1051.964] (-1047.524) (-1054.866) (-1049.570) -- 0:01:04

      Average standard deviation of split frequencies: 0.052028

      30500 -- (-1064.517) [-1062.226] (-1049.544) (-1058.033) * (-1051.650) (-1049.305) (-1050.662) [-1049.020] -- 0:01:03
      31000 -- (-1053.810) (-1053.097) (-1049.345) [-1047.503] * (-1049.764) [-1048.234] (-1049.474) (-1050.334) -- 0:01:02
      31500 -- (-1051.706) (-1064.607) [-1044.922] (-1060.951) * (-1051.611) (-1050.295) [-1050.793] (-1049.034) -- 0:01:01
      32000 -- (-1054.231) (-1051.504) (-1049.447) [-1050.896] * (-1048.846) (-1051.467) [-1050.447] (-1055.364) -- 0:01:00
      32500 -- [-1050.252] (-1059.308) (-1047.714) (-1053.120) * [-1051.075] (-1050.714) (-1050.942) (-1054.061) -- 0:00:59
      33000 -- (-1051.729) (-1060.251) (-1051.504) [-1051.154] * (-1048.342) (-1049.781) (-1049.078) [-1047.417] -- 0:01:27
      33500 -- (-1054.781) (-1056.833) (-1051.807) [-1052.997] * (-1050.430) [-1050.706] (-1054.339) (-1051.332) -- 0:01:26
      34000 -- [-1056.605] (-1054.764) (-1049.567) (-1054.564) * (-1048.422) [-1050.768] (-1049.930) (-1054.747) -- 0:01:25
      34500 -- (-1052.869) (-1062.691) [-1048.332] (-1054.755) * (-1048.713) (-1049.014) (-1050.551) [-1052.638] -- 0:01:23
      35000 -- (-1053.386) (-1065.730) (-1047.430) [-1050.704] * (-1051.233) [-1050.440] (-1048.389) (-1049.181) -- 0:01:22

      Average standard deviation of split frequencies: 0.061108

      35500 -- (-1056.383) [-1050.318] (-1053.791) (-1055.605) * (-1049.536) [-1048.952] (-1049.238) (-1050.274) -- 0:01:21
      36000 -- (-1052.820) (-1050.709) [-1049.982] (-1056.429) * (-1049.823) (-1052.395) [-1049.161] (-1053.588) -- 0:01:20
      36500 -- (-1055.884) [-1049.063] (-1051.731) (-1053.792) * (-1050.077) (-1049.622) [-1051.389] (-1049.879) -- 0:01:19
      37000 -- (-1057.336) [-1048.295] (-1051.783) (-1051.309) * (-1049.955) (-1049.751) (-1048.851) [-1050.586] -- 0:01:18
      37500 -- [-1047.960] (-1049.305) (-1053.848) (-1059.941) * (-1048.443) (-1049.944) (-1050.030) [-1053.279] -- 0:01:17
      38000 -- (-1054.733) [-1048.983] (-1048.330) (-1057.489) * [-1049.066] (-1049.540) (-1049.989) (-1052.380) -- 0:01:15
      38500 -- [-1050.607] (-1052.614) (-1050.202) (-1053.407) * (-1047.813) [-1049.031] (-1048.362) (-1052.137) -- 0:01:14
      39000 -- (-1057.928) (-1051.269) (-1052.041) [-1051.299] * [-1049.476] (-1049.403) (-1049.523) (-1048.543) -- 0:01:13
      39500 -- (-1050.715) (-1053.810) [-1051.621] (-1049.512) * (-1050.970) [-1050.547] (-1049.616) (-1049.482) -- 0:01:12
      40000 -- [-1049.321] (-1050.717) (-1049.097) (-1047.954) * (-1050.959) (-1048.665) [-1049.221] (-1048.888) -- 0:01:12

      Average standard deviation of split frequencies: 0.072227

      40500 -- (-1054.368) [-1052.829] (-1049.423) (-1048.821) * (-1048.852) [-1049.647] (-1049.270) (-1050.901) -- 0:01:11
      41000 -- (-1054.030) (-1050.148) (-1050.376) [-1048.356] * [-1046.339] (-1055.751) (-1048.611) (-1050.163) -- 0:01:10
      41500 -- (-1057.083) (-1050.720) (-1050.704) [-1048.355] * [-1049.409] (-1051.221) (-1050.844) (-1047.222) -- 0:01:09
      42000 -- (-1059.303) [-1050.944] (-1055.603) (-1051.694) * [-1050.750] (-1049.031) (-1048.250) (-1048.443) -- 0:01:08
      42500 -- (-1050.655) (-1050.542) [-1049.705] (-1054.254) * (-1048.442) (-1051.522) [-1049.652] (-1053.200) -- 0:01:07
      43000 -- [-1049.608] (-1049.254) (-1051.499) (-1053.465) * (-1049.580) [-1049.494] (-1050.073) (-1049.203) -- 0:01:06
      43500 -- (-1047.987) [-1050.383] (-1048.622) (-1057.397) * [-1049.787] (-1049.990) (-1048.967) (-1050.653) -- 0:01:05
      44000 -- (-1054.869) (-1054.035) (-1048.720) [-1050.813] * (-1048.416) (-1051.562) [-1050.680] (-1050.608) -- 0:01:05
      44500 -- (-1053.242) [-1048.883] (-1049.064) (-1054.431) * (-1048.242) (-1049.645) [-1048.807] (-1050.615) -- 0:01:04
      45000 -- (-1051.312) (-1053.462) [-1054.229] (-1054.197) * [-1051.035] (-1051.373) (-1052.115) (-1049.692) -- 0:01:03

      Average standard deviation of split frequencies: 0.062854

      45500 -- (-1066.264) (-1050.337) (-1049.673) [-1049.091] * (-1049.977) (-1050.138) [-1050.442] (-1050.320) -- 0:01:02
      46000 -- [-1051.494] (-1050.283) (-1050.445) (-1050.353) * [-1049.306] (-1049.921) (-1049.490) (-1050.364) -- 0:01:02
      46500 -- (-1048.446) [-1049.761] (-1049.535) (-1050.303) * (-1048.928) [-1048.468] (-1048.399) (-1052.502) -- 0:01:01
      47000 -- [-1046.388] (-1051.417) (-1050.677) (-1051.738) * (-1048.582) (-1049.566) (-1054.890) [-1052.039] -- 0:01:00
      47500 -- (-1050.962) [-1052.324] (-1048.795) (-1051.004) * (-1050.034) (-1051.608) (-1047.934) [-1050.518] -- 0:01:00
      48000 -- [-1045.504] (-1049.877) (-1051.213) (-1052.409) * (-1055.152) (-1053.583) (-1048.768) [-1050.734] -- 0:01:19
      48500 -- (-1056.453) (-1055.787) (-1049.546) [-1049.987] * (-1051.937) [-1050.867] (-1049.818) (-1049.808) -- 0:01:18
      49000 -- [-1052.120] (-1049.137) (-1050.542) (-1050.057) * (-1051.013) [-1049.084] (-1048.431) (-1050.713) -- 0:01:17
      49500 -- [-1052.636] (-1049.428) (-1046.440) (-1049.958) * [-1056.027] (-1048.984) (-1048.481) (-1050.434) -- 0:01:16
      50000 -- (-1050.661) (-1049.948) (-1049.385) [-1049.359] * (-1052.771) (-1052.897) [-1048.819] (-1053.533) -- 0:01:16

      Average standard deviation of split frequencies: 0.065128

      50500 -- (-1050.725) (-1049.558) [-1053.144] (-1050.269) * (-1054.053) (-1053.212) (-1050.194) [-1051.665] -- 0:01:15
      51000 -- (-1050.500) [-1050.274] (-1051.420) (-1049.659) * (-1053.472) [-1050.693] (-1050.124) (-1048.447) -- 0:01:14
      51500 -- [-1049.472] (-1052.538) (-1050.216) (-1050.784) * (-1050.477) (-1051.148) [-1051.410] (-1050.137) -- 0:01:13
      52000 -- (-1050.802) [-1046.196] (-1053.271) (-1051.018) * (-1051.096) (-1050.154) [-1050.706] (-1054.569) -- 0:01:12
      52500 -- [-1059.371] (-1053.219) (-1049.791) (-1051.152) * (-1048.861) (-1049.991) [-1051.170] (-1049.447) -- 0:01:12
      53000 -- [-1053.937] (-1049.081) (-1049.769) (-1055.533) * (-1051.128) [-1051.068] (-1050.986) (-1055.281) -- 0:01:11
      53500 -- (-1053.944) (-1049.949) [-1051.607] (-1056.470) * (-1051.335) [-1051.378] (-1052.722) (-1056.872) -- 0:01:10
      54000 -- (-1061.321) (-1049.624) [-1050.107] (-1050.750) * (-1049.304) [-1049.972] (-1055.217) (-1051.091) -- 0:01:10
      54500 -- (-1059.785) (-1053.922) [-1053.224] (-1051.509) * (-1048.250) (-1049.182) [-1052.576] (-1048.083) -- 0:01:09
      55000 -- [-1054.632] (-1048.149) (-1050.083) (-1051.721) * (-1048.464) (-1050.437) [-1055.139] (-1052.154) -- 0:01:08

      Average standard deviation of split frequencies: 0.065099

      55500 -- [-1053.440] (-1049.687) (-1049.418) (-1047.997) * (-1049.758) [-1049.606] (-1050.568) (-1050.853) -- 0:01:08
      56000 -- (-1058.078) (-1048.393) [-1049.113] (-1051.104) * (-1048.747) [-1050.517] (-1051.156) (-1050.214) -- 0:01:07
      56500 -- [-1050.228] (-1050.361) (-1054.469) (-1050.210) * (-1048.699) (-1049.395) (-1051.121) [-1048.722] -- 0:01:06
      57000 -- (-1049.960) (-1048.221) (-1049.496) [-1048.779] * (-1049.594) (-1050.303) (-1048.739) [-1049.492] -- 0:01:06
      57500 -- (-1053.896) [-1048.593] (-1048.951) (-1050.863) * (-1055.577) (-1050.454) (-1051.246) [-1048.695] -- 0:01:05
      58000 -- (-1047.716) [-1050.063] (-1053.848) (-1052.468) * (-1051.472) [-1049.132] (-1050.572) (-1049.324) -- 0:01:04
      58500 -- (-1047.629) (-1050.900) [-1046.041] (-1049.200) * (-1052.114) (-1051.406) (-1050.259) [-1049.013] -- 0:01:04
      59000 -- (-1056.069) (-1051.695) (-1053.163) [-1050.138] * (-1050.561) (-1048.822) (-1050.689) [-1050.529] -- 0:01:03
      59500 -- (-1060.055) (-1050.689) [-1047.609] (-1050.077) * (-1052.029) (-1053.620) (-1048.663) [-1047.621] -- 0:01:03
      60000 -- (-1063.300) [-1049.251] (-1049.712) (-1046.752) * [-1050.847] (-1056.633) (-1048.500) (-1050.854) -- 0:01:02

      Average standard deviation of split frequencies: 0.062163

      60500 -- (-1063.529) (-1049.700) [-1050.056] (-1048.181) * (-1046.107) (-1051.785) [-1050.394] (-1051.268) -- 0:01:02
      61000 -- [-1050.139] (-1049.200) (-1049.127) (-1048.005) * (-1048.784) (-1051.493) (-1050.202) [-1048.818] -- 0:01:01
      61500 -- (-1057.440) (-1049.431) (-1049.302) [-1047.177] * (-1050.401) (-1050.704) [-1049.332] (-1048.036) -- 0:01:01
      62000 -- (-1051.512) (-1049.672) (-1051.211) [-1049.090] * (-1052.705) (-1048.493) [-1053.098] (-1047.396) -- 0:01:00
      62500 -- (-1050.931) (-1049.917) [-1051.129] (-1049.013) * (-1051.484) (-1049.468) (-1046.050) [-1048.589] -- 0:01:00
      63000 -- (-1056.638) (-1051.805) [-1049.042] (-1051.603) * (-1049.073) [-1048.795] (-1052.458) (-1049.530) -- 0:01:14
      63500 -- (-1051.810) (-1050.334) [-1049.113] (-1050.175) * (-1050.023) (-1052.858) (-1048.996) [-1049.606] -- 0:01:13
      64000 -- [-1055.167] (-1049.804) (-1050.564) (-1049.707) * (-1048.521) (-1049.504) [-1050.619] (-1051.723) -- 0:01:13
      64500 -- [-1050.415] (-1048.716) (-1055.118) (-1049.028) * (-1049.358) [-1051.772] (-1049.478) (-1049.218) -- 0:01:12
      65000 -- (-1052.555) (-1049.582) [-1051.797] (-1047.603) * [-1046.253] (-1047.710) (-1050.358) (-1048.329) -- 0:01:11

      Average standard deviation of split frequencies: 0.060314

      65500 -- (-1057.174) (-1051.443) (-1050.586) [-1050.814] * (-1052.538) (-1049.376) [-1049.240] (-1049.322) -- 0:01:11
      66000 -- (-1058.225) (-1050.714) [-1052.642] (-1050.255) * (-1050.820) [-1050.790] (-1048.662) (-1052.075) -- 0:01:10
      66500 -- (-1049.807) (-1053.388) (-1049.753) [-1049.348] * (-1049.537) [-1050.868] (-1049.229) (-1051.184) -- 0:01:10
      67000 -- (-1058.091) (-1050.496) (-1049.913) [-1050.433] * (-1050.533) [-1048.614] (-1050.968) (-1047.996) -- 0:01:09
      67500 -- [-1059.078] (-1051.678) (-1051.619) (-1048.123) * [-1054.078] (-1049.605) (-1049.667) (-1049.439) -- 0:01:09
      68000 -- (-1052.976) [-1050.381] (-1051.208) (-1049.528) * (-1050.971) (-1051.453) (-1049.936) [-1049.086] -- 0:01:08
      68500 -- (-1048.726) [-1050.161] (-1050.855) (-1051.492) * (-1051.396) (-1053.120) (-1051.666) [-1051.249] -- 0:01:07
      69000 -- (-1057.160) (-1048.497) [-1049.642] (-1051.378) * (-1047.942) (-1051.022) (-1051.705) [-1049.765] -- 0:01:07
      69500 -- (-1061.095) (-1051.054) [-1050.273] (-1049.989) * [-1049.677] (-1049.767) (-1051.235) (-1051.524) -- 0:01:06
      70000 -- [-1050.247] (-1048.781) (-1048.116) (-1050.080) * (-1051.331) (-1051.792) (-1051.854) [-1049.698] -- 0:01:06

      Average standard deviation of split frequencies: 0.057229

      70500 -- [-1052.699] (-1049.188) (-1049.372) (-1049.768) * (-1050.218) (-1051.035) (-1048.433) [-1049.992] -- 0:01:05
      71000 -- [-1057.222] (-1050.437) (-1049.777) (-1051.602) * (-1050.577) (-1048.875) [-1049.308] (-1048.336) -- 0:01:05
      71500 -- [-1052.816] (-1052.807) (-1053.773) (-1051.702) * (-1051.700) (-1050.974) [-1049.770] (-1049.891) -- 0:01:04
      72000 -- (-1056.370) (-1052.058) [-1052.846] (-1051.438) * (-1051.331) (-1050.625) [-1051.602] (-1048.746) -- 0:01:04
      72500 -- [-1050.278] (-1050.894) (-1050.997) (-1055.727) * (-1051.380) [-1049.021] (-1049.873) (-1050.690) -- 0:01:03
      73000 -- (-1052.536) (-1051.175) (-1051.046) [-1048.534] * [-1050.014] (-1052.027) (-1052.171) (-1051.890) -- 0:01:03
      73500 -- [-1052.618] (-1050.721) (-1049.425) (-1050.536) * (-1049.397) [-1052.891] (-1051.116) (-1046.922) -- 0:01:03
      74000 -- (-1053.365) (-1049.764) (-1049.498) [-1050.040] * (-1048.997) (-1048.588) (-1050.498) [-1048.733] -- 0:01:02
      74500 -- (-1052.990) (-1048.900) (-1050.409) [-1053.475] * (-1046.537) [-1048.398] (-1050.272) (-1050.151) -- 0:01:02
      75000 -- [-1052.120] (-1050.464) (-1051.880) (-1049.464) * (-1050.211) (-1051.771) [-1051.707] (-1049.139) -- 0:01:01

      Average standard deviation of split frequencies: 0.052378

      75500 -- [-1048.560] (-1049.155) (-1051.868) (-1048.787) * (-1046.802) (-1048.099) (-1047.278) [-1049.190] -- 0:01:01
      76000 -- (-1058.690) [-1051.154] (-1050.675) (-1048.838) * [-1048.393] (-1049.614) (-1049.661) (-1050.569) -- 0:01:00
      76500 -- (-1056.693) (-1051.113) [-1050.728] (-1049.646) * [-1049.509] (-1050.309) (-1052.709) (-1051.554) -- 0:01:00
      77000 -- [-1054.182] (-1049.143) (-1052.222) (-1048.945) * [-1051.260] (-1051.112) (-1051.087) (-1052.224) -- 0:00:59
      77500 -- [-1051.995] (-1048.493) (-1050.404) (-1048.084) * (-1047.409) (-1052.989) (-1051.961) [-1052.089] -- 0:00:59
      78000 -- (-1051.114) (-1053.374) (-1053.086) [-1048.087] * (-1046.744) [-1050.720] (-1047.713) (-1050.765) -- 0:01:10
      78500 -- [-1049.856] (-1051.888) (-1050.427) (-1049.974) * [-1049.059] (-1050.296) (-1052.379) (-1051.604) -- 0:01:10
      79000 -- (-1059.933) (-1049.765) [-1055.112] (-1047.422) * [-1047.591] (-1048.975) (-1049.188) (-1050.423) -- 0:01:09
      79500 -- (-1061.523) (-1049.799) (-1053.726) [-1052.594] * (-1050.189) [-1049.086] (-1049.523) (-1050.425) -- 0:01:09
      80000 -- [-1060.354] (-1050.108) (-1050.615) (-1047.767) * [-1048.724] (-1047.737) (-1048.952) (-1050.752) -- 0:01:09

      Average standard deviation of split frequencies: 0.053626

      80500 -- [-1054.988] (-1049.580) (-1049.412) (-1049.452) * (-1050.740) (-1049.408) [-1050.491] (-1052.980) -- 0:01:08
      81000 -- [-1051.071] (-1053.032) (-1048.320) (-1050.572) * (-1048.088) (-1051.450) (-1049.940) [-1050.707] -- 0:01:08
      81500 -- [-1051.684] (-1053.599) (-1054.464) (-1051.965) * (-1049.493) (-1049.519) (-1050.507) [-1047.866] -- 0:01:07
      82000 -- [-1047.650] (-1057.527) (-1047.682) (-1056.373) * (-1055.767) (-1050.162) (-1051.803) [-1049.899] -- 0:01:07
      82500 -- (-1052.440) (-1052.575) [-1047.616] (-1049.815) * (-1050.330) (-1047.873) [-1050.484] (-1050.433) -- 0:01:06
      83000 -- [-1052.640] (-1050.068) (-1048.973) (-1049.858) * (-1047.385) (-1049.310) [-1048.361] (-1050.356) -- 0:01:06
      83500 -- (-1055.533) (-1051.309) [-1049.511] (-1054.006) * (-1048.682) [-1049.931] (-1048.368) (-1049.093) -- 0:01:05
      84000 -- [-1053.441] (-1050.288) (-1048.554) (-1056.384) * (-1047.566) (-1055.507) [-1050.294] (-1050.272) -- 0:01:05
      84500 -- (-1054.898) (-1051.180) (-1049.815) [-1049.200] * (-1050.773) (-1051.012) (-1051.918) [-1050.026] -- 0:01:05
      85000 -- (-1060.230) [-1049.306] (-1048.811) (-1050.533) * [-1050.403] (-1051.411) (-1051.551) (-1055.713) -- 0:01:04

      Average standard deviation of split frequencies: 0.057411

      85500 -- [-1055.941] (-1053.393) (-1050.560) (-1054.867) * (-1051.954) (-1052.141) (-1050.999) [-1050.579] -- 0:01:04
      86000 -- (-1054.637) (-1052.785) [-1048.243] (-1049.743) * (-1051.255) [-1052.599] (-1051.926) (-1050.146) -- 0:01:03
      86500 -- (-1052.466) [-1050.891] (-1049.069) (-1048.788) * (-1051.203) (-1052.502) (-1048.392) [-1048.058] -- 0:01:03
      87000 -- [-1051.251] (-1051.604) (-1050.698) (-1048.503) * (-1049.728) (-1049.544) (-1049.176) [-1048.209] -- 0:01:02
      87500 -- [-1055.637] (-1050.059) (-1048.714) (-1050.787) * (-1049.354) [-1047.910] (-1050.170) (-1048.182) -- 0:01:02
      88000 -- [-1051.057] (-1051.929) (-1050.613) (-1049.328) * (-1053.769) [-1050.576] (-1047.507) (-1050.692) -- 0:01:02
      88500 -- [-1051.634] (-1050.836) (-1049.221) (-1052.621) * (-1049.704) (-1052.491) [-1046.995] (-1053.319) -- 0:01:01
      89000 -- [-1056.892] (-1055.444) (-1048.948) (-1048.725) * (-1053.418) (-1049.662) [-1048.643] (-1048.723) -- 0:01:01
      89500 -- [-1052.553] (-1051.352) (-1048.955) (-1046.241) * [-1049.203] (-1049.422) (-1048.758) (-1049.435) -- 0:01:01
      90000 -- (-1052.672) (-1056.843) [-1049.157] (-1048.240) * (-1048.607) [-1049.228] (-1053.746) (-1049.430) -- 0:01:00

      Average standard deviation of split frequencies: 0.057740

      90500 -- (-1059.846) [-1052.097] (-1051.055) (-1049.295) * [-1047.967] (-1049.002) (-1052.305) (-1051.162) -- 0:01:00
      91000 -- [-1053.264] (-1048.597) (-1050.761) (-1048.910) * (-1050.119) (-1050.524) (-1050.384) [-1050.287] -- 0:00:59
      91500 -- (-1053.183) (-1049.079) (-1048.385) [-1049.361] * [-1049.435] (-1049.933) (-1048.304) (-1053.509) -- 0:00:59
      92000 -- (-1058.389) (-1048.882) [-1049.481] (-1052.148) * [-1047.632] (-1050.151) (-1054.099) (-1054.569) -- 0:00:59
      92500 -- (-1049.912) (-1051.035) (-1049.951) [-1048.857] * (-1050.423) (-1048.936) (-1051.223) [-1050.580] -- 0:00:58
      93000 -- [-1053.029] (-1052.184) (-1051.014) (-1048.560) * [-1049.601] (-1048.804) (-1048.220) (-1050.403) -- 0:00:58
      93500 -- (-1055.105) (-1051.658) (-1050.912) [-1048.715] * (-1051.642) (-1050.262) [-1051.280] (-1051.146) -- 0:01:07
      94000 -- (-1051.229) [-1048.012] (-1048.922) (-1050.443) * [-1049.767] (-1049.194) (-1049.196) (-1051.180) -- 0:01:07
      94500 -- (-1061.702) (-1052.740) (-1050.761) [-1056.741] * (-1056.392) [-1047.032] (-1050.908) (-1051.757) -- 0:01:07
      95000 -- [-1054.435] (-1049.863) (-1051.509) (-1047.051) * [-1048.786] (-1052.153) (-1048.106) (-1052.155) -- 0:01:06

      Average standard deviation of split frequencies: 0.055049

      95500 -- [-1048.961] (-1049.056) (-1047.377) (-1051.275) * [-1048.728] (-1048.839) (-1054.898) (-1050.160) -- 0:01:06
      96000 -- (-1052.608) (-1049.968) [-1049.609] (-1048.068) * (-1048.595) [-1049.267] (-1055.224) (-1049.140) -- 0:01:05
      96500 -- (-1063.490) [-1048.779] (-1053.313) (-1048.242) * (-1047.584) (-1049.665) (-1050.426) [-1050.959] -- 0:01:05
      97000 -- (-1059.763) (-1048.757) [-1046.798] (-1050.431) * (-1054.321) [-1048.982] (-1048.200) (-1050.716) -- 0:01:05
      97500 -- (-1063.133) (-1051.044) (-1048.318) [-1047.702] * [-1050.494] (-1050.747) (-1050.002) (-1051.279) -- 0:01:04
      98000 -- (-1065.376) (-1049.493) (-1048.774) [-1053.445] * [-1051.356] (-1048.055) (-1053.388) (-1050.574) -- 0:01:04
      98500 -- (-1050.719) (-1050.080) [-1051.856] (-1049.890) * (-1049.802) [-1048.766] (-1054.743) (-1048.169) -- 0:01:04
      99000 -- (-1055.380) [-1050.749] (-1047.415) (-1049.351) * (-1050.268) [-1045.803] (-1050.010) (-1049.801) -- 0:01:03
      99500 -- (-1057.123) (-1047.779) (-1049.641) [-1049.580] * (-1050.144) [-1052.025] (-1049.687) (-1051.297) -- 0:01:03
      100000 -- (-1050.256) [-1049.008] (-1047.512) (-1051.508) * [-1048.114] (-1050.202) (-1049.804) (-1050.019) -- 0:01:02

      Average standard deviation of split frequencies: 0.050525

      100500 -- (-1053.644) (-1052.876) [-1049.384] (-1049.185) * [-1048.456] (-1046.937) (-1050.694) (-1051.206) -- 0:01:02
      101000 -- [-1050.829] (-1047.420) (-1047.185) (-1051.468) * (-1051.021) (-1048.522) [-1047.651] (-1049.058) -- 0:01:02
      101500 -- (-1052.880) [-1051.437] (-1048.536) (-1048.797) * (-1049.529) [-1046.252] (-1049.768) (-1050.249) -- 0:01:01
      102000 -- (-1053.271) (-1050.854) (-1049.242) [-1051.281] * (-1050.530) [-1048.147] (-1049.424) (-1051.785) -- 0:01:01
      102500 -- (-1051.109) [-1049.570] (-1050.779) (-1048.638) * (-1052.419) [-1048.977] (-1048.911) (-1048.508) -- 0:01:01
      103000 -- (-1051.035) (-1049.496) (-1051.020) [-1052.292] * (-1048.737) [-1049.850] (-1049.100) (-1048.684) -- 0:01:00
      103500 -- [-1052.673] (-1048.332) (-1051.451) (-1050.659) * [-1049.111] (-1048.481) (-1049.104) (-1048.575) -- 0:01:00
      104000 -- [-1052.527] (-1049.411) (-1050.326) (-1050.003) * [-1050.100] (-1049.028) (-1049.707) (-1050.311) -- 0:01:00
      104500 -- (-1049.918) (-1051.823) (-1049.624) [-1050.858] * [-1050.607] (-1049.952) (-1050.844) (-1050.410) -- 0:00:59
      105000 -- (-1056.823) [-1047.959] (-1050.332) (-1049.973) * (-1048.368) (-1049.135) [-1049.782] (-1048.932) -- 0:00:59

      Average standard deviation of split frequencies: 0.048919

      105500 -- (-1050.620) [-1049.955] (-1049.720) (-1049.400) * (-1049.947) (-1049.311) (-1048.803) [-1049.079] -- 0:00:59
      106000 -- (-1058.721) (-1048.576) (-1051.672) [-1048.504] * [-1049.132] (-1052.251) (-1050.352) (-1048.601) -- 0:00:59
      106500 -- (-1060.134) (-1050.405) (-1050.945) [-1049.080] * (-1053.009) [-1049.175] (-1050.795) (-1049.230) -- 0:00:58
      107000 -- (-1049.498) (-1051.797) [-1051.215] (-1048.249) * (-1051.088) [-1048.085] (-1050.333) (-1049.364) -- 0:00:58
      107500 -- (-1063.963) (-1051.510) [-1048.863] (-1048.994) * (-1048.935) (-1052.571) [-1047.819] (-1049.103) -- 0:00:58
      108000 -- (-1049.914) (-1058.540) (-1048.816) [-1048.212] * (-1055.192) [-1050.073] (-1049.594) (-1050.446) -- 0:00:57
      108500 -- (-1048.974) (-1050.393) [-1046.994] (-1049.663) * (-1048.872) (-1050.639) [-1048.582] (-1053.230) -- 0:01:05
      109000 -- (-1050.532) [-1048.824] (-1048.730) (-1051.423) * (-1049.833) [-1049.906] (-1051.470) (-1052.386) -- 0:01:05
      109500 -- [-1050.419] (-1049.490) (-1050.779) (-1055.806) * (-1052.111) [-1055.149] (-1047.808) (-1050.313) -- 0:01:05
      110000 -- (-1050.821) (-1051.846) [-1051.131] (-1052.895) * (-1049.577) [-1050.168] (-1050.637) (-1052.566) -- 0:01:04

      Average standard deviation of split frequencies: 0.048040

      110500 -- (-1050.388) (-1046.196) (-1050.963) [-1049.862] * [-1049.278] (-1051.012) (-1049.275) (-1048.010) -- 0:01:04
      111000 -- (-1047.882) (-1051.108) [-1049.918] (-1049.732) * (-1047.490) (-1050.323) [-1054.302] (-1049.494) -- 0:01:04
      111500 -- (-1046.876) [-1050.799] (-1049.748) (-1050.806) * (-1051.217) [-1050.074] (-1053.492) (-1047.976) -- 0:01:03
      112000 -- (-1052.794) [-1049.408] (-1048.606) (-1051.486) * (-1051.461) (-1051.634) [-1049.516] (-1053.591) -- 0:01:03
      112500 -- (-1051.070) [-1048.071] (-1046.559) (-1050.269) * [-1049.845] (-1049.482) (-1050.238) (-1052.793) -- 0:01:03
      113000 -- (-1050.521) (-1049.146) (-1047.554) [-1049.187] * [-1050.094] (-1049.906) (-1048.220) (-1051.798) -- 0:01:02
      113500 -- (-1050.157) (-1051.713) [-1049.466] (-1050.324) * (-1050.311) (-1050.309) (-1050.267) [-1047.434] -- 0:01:02
      114000 -- (-1051.526) [-1049.358] (-1049.836) (-1051.205) * [-1048.749] (-1051.898) (-1048.352) (-1050.853) -- 0:01:02
      114500 -- (-1048.333) [-1046.996] (-1050.213) (-1053.490) * (-1049.736) (-1053.375) [-1049.267] (-1048.440) -- 0:01:01
      115000 -- [-1047.044] (-1048.477) (-1048.212) (-1056.760) * [-1050.633] (-1049.294) (-1049.411) (-1048.659) -- 0:01:01

      Average standard deviation of split frequencies: 0.046413

      115500 -- (-1048.692) [-1048.396] (-1049.752) (-1054.225) * (-1049.333) (-1049.466) [-1051.102] (-1048.316) -- 0:01:01
      116000 -- (-1050.026) (-1047.981) (-1049.713) [-1048.727] * (-1058.550) (-1053.582) [-1048.985] (-1049.102) -- 0:01:00
      116500 -- (-1048.565) (-1051.195) (-1049.105) [-1049.406] * (-1051.473) (-1046.037) [-1047.477] (-1046.458) -- 0:01:00
      117000 -- (-1050.222) [-1052.372] (-1050.081) (-1051.434) * (-1050.129) (-1050.515) [-1051.881] (-1048.641) -- 0:01:00
      117500 -- [-1046.745] (-1050.523) (-1048.039) (-1049.509) * (-1050.351) (-1050.249) [-1048.504] (-1048.486) -- 0:01:00
      118000 -- [-1047.903] (-1051.221) (-1049.567) (-1048.522) * (-1052.347) [-1048.441] (-1050.732) (-1050.047) -- 0:00:59
      118500 -- [-1049.966] (-1049.944) (-1049.383) (-1051.103) * (-1052.186) (-1045.336) (-1049.240) [-1050.632] -- 0:00:59
      119000 -- [-1046.670] (-1050.479) (-1048.986) (-1050.640) * (-1051.796) [-1048.711] (-1047.717) (-1048.543) -- 0:00:59
      119500 -- (-1048.570) (-1051.802) [-1049.266] (-1049.872) * (-1050.737) (-1045.528) (-1046.965) [-1048.692] -- 0:00:58
      120000 -- (-1050.194) (-1050.468) (-1048.602) [-1050.508] * (-1055.719) (-1049.241) (-1048.646) [-1048.844] -- 0:00:58

      Average standard deviation of split frequencies: 0.044207

      120500 -- [-1049.038] (-1049.234) (-1050.125) (-1050.858) * (-1053.828) [-1048.800] (-1051.143) (-1047.699) -- 0:00:58
      121000 -- (-1053.595) (-1049.066) (-1052.290) [-1050.204] * (-1053.130) [-1052.033] (-1047.167) (-1051.760) -- 0:00:58
      121500 -- (-1048.477) [-1049.174] (-1048.837) (-1053.697) * (-1052.747) (-1051.010) [-1049.703] (-1049.089) -- 0:00:57
      122000 -- [-1049.229] (-1052.287) (-1052.569) (-1049.909) * (-1048.624) (-1052.795) (-1050.406) [-1049.846] -- 0:00:57
      122500 -- (-1048.591) [-1051.250] (-1052.624) (-1049.976) * (-1055.380) (-1051.350) (-1050.424) [-1053.982] -- 0:00:57
      123000 -- [-1046.903] (-1051.128) (-1051.476) (-1050.033) * (-1049.513) (-1052.660) [-1049.922] (-1046.870) -- 0:00:57
      123500 -- [-1049.041] (-1053.628) (-1049.316) (-1049.620) * (-1051.240) (-1049.032) (-1052.069) [-1050.587] -- 0:00:56
      124000 -- (-1048.340) (-1051.229) [-1052.584] (-1048.014) * (-1049.007) (-1048.524) [-1050.467] (-1049.643) -- 0:01:03
      124500 -- (-1049.793) (-1053.994) (-1048.869) [-1050.768] * (-1051.894) (-1050.243) [-1049.824] (-1048.836) -- 0:01:03
      125000 -- [-1050.147] (-1053.230) (-1051.389) (-1049.261) * (-1050.139) (-1050.906) (-1051.573) [-1049.350] -- 0:01:03

      Average standard deviation of split frequencies: 0.042336

      125500 -- (-1049.242) [-1050.055] (-1052.442) (-1055.038) * (-1050.862) (-1050.174) (-1049.652) [-1048.014] -- 0:01:02
      126000 -- [-1047.590] (-1049.875) (-1053.244) (-1055.293) * (-1048.277) (-1049.821) (-1048.885) [-1049.398] -- 0:01:02
      126500 -- (-1052.846) (-1053.433) [-1048.117] (-1052.428) * (-1048.232) [-1050.432] (-1048.877) (-1052.459) -- 0:01:02
      127000 -- (-1050.843) (-1048.878) (-1051.313) [-1049.699] * (-1050.890) [-1050.873] (-1049.004) (-1045.466) -- 0:01:01
      127500 -- (-1050.461) [-1051.650] (-1049.048) (-1049.195) * (-1051.461) (-1048.930) [-1050.460] (-1046.812) -- 0:01:01
      128000 -- (-1051.091) (-1051.609) (-1049.953) [-1049.265] * (-1049.374) (-1048.321) (-1049.443) [-1050.573] -- 0:01:01
      128500 -- [-1051.875] (-1047.898) (-1048.710) (-1050.077) * (-1051.249) [-1049.518] (-1050.895) (-1048.539) -- 0:01:01
      129000 -- (-1048.702) (-1049.870) [-1048.235] (-1049.334) * (-1048.838) (-1048.439) (-1053.652) [-1048.955] -- 0:01:00
      129500 -- (-1050.472) (-1050.602) [-1047.555] (-1049.419) * (-1047.572) (-1051.975) [-1048.596] (-1052.261) -- 0:01:00
      130000 -- (-1050.620) [-1050.601] (-1050.939) (-1048.679) * (-1048.862) (-1053.040) (-1050.037) [-1045.937] -- 0:01:00

      Average standard deviation of split frequencies: 0.041014

      130500 -- (-1050.573) (-1049.301) [-1047.541] (-1050.188) * (-1050.292) (-1057.748) [-1049.734] (-1047.522) -- 0:00:59
      131000 -- (-1048.929) (-1050.906) [-1046.770] (-1050.364) * (-1050.234) (-1048.962) [-1052.428] (-1050.932) -- 0:00:59
      131500 -- (-1048.260) [-1051.358] (-1048.571) (-1050.398) * (-1051.839) (-1047.461) (-1053.019) [-1050.683] -- 0:00:59
      132000 -- (-1049.930) (-1050.695) [-1049.658] (-1050.656) * (-1049.417) [-1049.062] (-1048.986) (-1050.817) -- 0:00:59
      132500 -- [-1049.427] (-1050.017) (-1049.478) (-1048.672) * (-1050.017) (-1050.636) [-1052.374] (-1048.341) -- 0:00:58
      133000 -- [-1050.661] (-1049.160) (-1050.223) (-1055.098) * [-1048.962] (-1052.616) (-1052.220) (-1047.334) -- 0:00:58
      133500 -- (-1048.065) [-1049.708] (-1048.389) (-1052.747) * (-1050.502) (-1049.477) (-1051.563) [-1047.819] -- 0:00:58
      134000 -- (-1049.718) (-1049.712) [-1051.556] (-1055.749) * [-1049.394] (-1052.541) (-1048.282) (-1048.925) -- 0:00:58
      134500 -- (-1049.113) (-1051.324) (-1050.097) [-1049.696] * (-1051.173) [-1049.433] (-1052.336) (-1051.517) -- 0:00:57
      135000 -- (-1050.321) (-1049.598) (-1049.821) [-1050.367] * (-1049.252) [-1049.197] (-1049.852) (-1047.087) -- 0:00:57

      Average standard deviation of split frequencies: 0.037924

      135500 -- [-1049.116] (-1050.377) (-1049.064) (-1049.055) * (-1050.154) [-1051.827] (-1048.330) (-1047.904) -- 0:00:57
      136000 -- (-1048.435) [-1050.706] (-1049.589) (-1051.912) * (-1049.400) (-1050.461) [-1050.322] (-1049.565) -- 0:00:57
      136500 -- (-1049.982) (-1051.138) (-1050.652) [-1048.527] * (-1051.736) (-1050.312) (-1049.937) [-1052.075] -- 0:00:56
      137000 -- [-1049.656] (-1049.777) (-1051.426) (-1049.674) * [-1051.183] (-1051.804) (-1052.783) (-1052.014) -- 0:00:56
      137500 -- [-1048.455] (-1051.236) (-1050.518) (-1051.633) * (-1050.336) (-1049.239) (-1052.859) [-1046.700] -- 0:00:56
      138000 -- [-1048.428] (-1050.304) (-1051.212) (-1050.614) * (-1050.974) (-1048.484) (-1049.315) [-1049.883] -- 0:00:56
      138500 -- (-1051.372) (-1052.325) (-1051.656) [-1049.254] * (-1053.072) (-1050.282) [-1049.087] (-1050.135) -- 0:00:55
      139000 -- (-1050.139) (-1048.411) [-1050.507] (-1052.819) * (-1054.341) (-1049.047) (-1049.145) [-1048.335] -- 0:01:01
      139500 -- (-1049.521) (-1049.476) [-1050.686] (-1050.886) * [-1048.144] (-1049.616) (-1052.312) (-1049.041) -- 0:01:01
      140000 -- (-1050.606) (-1049.308) (-1053.106) [-1049.536] * (-1050.888) (-1048.319) (-1050.684) [-1049.644] -- 0:01:01

      Average standard deviation of split frequencies: 0.034695

      140500 -- [-1049.480] (-1049.241) (-1055.387) (-1050.263) * [-1049.201] (-1048.437) (-1050.610) (-1049.155) -- 0:01:01
      141000 -- (-1050.358) (-1047.028) [-1048.705] (-1049.681) * (-1052.350) [-1048.743] (-1048.484) (-1049.845) -- 0:01:00
      141500 -- (-1048.662) (-1048.862) [-1049.091] (-1051.741) * (-1051.899) (-1049.442) [-1047.998] (-1049.661) -- 0:01:00
      142000 -- [-1048.264] (-1049.408) (-1050.515) (-1053.864) * (-1050.966) (-1050.743) [-1049.483] (-1047.486) -- 0:01:00
      142500 -- (-1049.418) [-1048.640] (-1048.369) (-1050.006) * (-1048.476) [-1048.644] (-1048.011) (-1050.975) -- 0:01:00
      143000 -- (-1048.525) (-1051.919) [-1048.489] (-1049.544) * (-1048.929) (-1049.101) [-1053.960] (-1050.424) -- 0:00:59
      143500 -- [-1049.995] (-1052.287) (-1049.803) (-1048.943) * (-1049.166) (-1049.612) [-1051.640] (-1049.243) -- 0:00:59
      144000 -- [-1050.629] (-1050.632) (-1049.564) (-1051.755) * (-1047.463) (-1050.330) (-1050.067) [-1046.108] -- 0:00:59
      144500 -- (-1049.780) [-1048.621] (-1050.620) (-1053.609) * (-1049.199) (-1049.643) (-1051.826) [-1048.290] -- 0:00:59
      145000 -- (-1055.424) (-1051.401) (-1049.798) [-1053.052] * [-1048.937] (-1046.133) (-1049.938) (-1059.202) -- 0:00:58

      Average standard deviation of split frequencies: 0.031528

      145500 -- (-1056.486) (-1050.202) [-1052.781] (-1050.151) * (-1049.459) [-1051.371] (-1048.503) (-1053.202) -- 0:00:58
      146000 -- (-1049.725) [-1047.912] (-1052.105) (-1050.295) * (-1048.680) (-1048.495) (-1048.061) [-1052.367] -- 0:00:58
      146500 -- (-1048.379) (-1049.390) (-1050.573) [-1048.611] * [-1052.535] (-1049.966) (-1049.790) (-1048.794) -- 0:00:58
      147000 -- (-1048.888) (-1051.047) (-1049.341) [-1048.437] * (-1048.800) [-1048.739] (-1048.790) (-1051.676) -- 0:00:58
      147500 -- [-1050.846] (-1048.988) (-1050.772) (-1049.420) * (-1049.254) (-1048.293) (-1049.248) [-1051.330] -- 0:00:57
      148000 -- (-1051.483) (-1049.290) [-1049.129] (-1057.489) * [-1048.636] (-1054.274) (-1051.228) (-1049.545) -- 0:00:57
      148500 -- (-1052.171) (-1049.733) [-1047.338] (-1048.796) * (-1047.307) (-1051.854) [-1050.967] (-1052.921) -- 0:00:57
      149000 -- (-1048.789) (-1051.905) [-1047.097] (-1048.857) * (-1049.558) (-1049.087) (-1048.333) [-1048.769] -- 0:00:57
      149500 -- (-1048.456) [-1048.570] (-1047.939) (-1049.053) * (-1046.992) [-1050.208] (-1049.102) (-1050.350) -- 0:00:56
      150000 -- (-1053.153) (-1049.855) (-1048.423) [-1047.960] * [-1052.643] (-1049.628) (-1051.798) (-1047.791) -- 0:00:56

      Average standard deviation of split frequencies: 0.031114

      150500 -- (-1048.750) (-1050.234) (-1047.071) [-1051.084] * (-1046.568) (-1048.988) [-1048.778] (-1047.027) -- 0:00:56
      151000 -- [-1048.256] (-1047.117) (-1047.121) (-1050.886) * [-1049.273] (-1049.533) (-1049.949) (-1048.742) -- 0:00:56
      151500 -- (-1052.687) [-1048.020] (-1048.475) (-1049.516) * [-1049.152] (-1050.993) (-1047.056) (-1049.222) -- 0:00:56
      152000 -- [-1049.434] (-1049.529) (-1050.573) (-1049.333) * (-1048.659) (-1049.241) [-1050.012] (-1049.047) -- 0:00:55
      152500 -- (-1048.466) (-1047.615) [-1048.894] (-1050.881) * (-1048.757) [-1048.545] (-1052.570) (-1049.568) -- 0:00:55
      153000 -- (-1055.494) (-1050.531) (-1050.736) [-1051.988] * (-1050.985) [-1048.722] (-1051.675) (-1049.842) -- 0:00:55
      153500 -- (-1052.298) [-1049.800] (-1051.171) (-1051.656) * [-1048.297] (-1051.123) (-1050.591) (-1048.845) -- 0:00:55
      154000 -- (-1051.057) (-1050.951) (-1047.783) [-1049.444] * (-1049.941) [-1049.283] (-1045.714) (-1047.717) -- 0:00:54
      154500 -- [-1048.814] (-1052.742) (-1050.312) (-1051.843) * (-1053.231) (-1051.002) (-1048.321) [-1048.324] -- 0:01:00
      155000 -- (-1048.917) (-1050.867) [-1049.577] (-1051.762) * (-1049.824) (-1047.450) [-1054.003] (-1049.550) -- 0:00:59

      Average standard deviation of split frequencies: 0.031226

      155500 -- (-1047.599) (-1054.358) (-1054.146) [-1057.913] * (-1049.058) (-1048.860) [-1051.733] (-1050.590) -- 0:00:59
      156000 -- (-1048.960) [-1046.782] (-1048.869) (-1056.722) * (-1048.288) [-1051.902] (-1047.314) (-1050.942) -- 0:00:59
      156500 -- [-1049.257] (-1048.617) (-1053.126) (-1055.322) * (-1048.206) (-1048.853) [-1050.886] (-1053.369) -- 0:00:59
      157000 -- (-1050.015) (-1053.830) (-1049.733) [-1054.439] * (-1051.984) (-1046.410) [-1049.849] (-1058.598) -- 0:00:59
      157500 -- (-1050.856) (-1053.872) [-1050.624] (-1053.565) * (-1052.435) [-1050.568] (-1052.518) (-1050.887) -- 0:00:58
      158000 -- (-1048.468) (-1050.119) [-1050.749] (-1050.084) * (-1052.534) (-1051.118) (-1046.827) [-1050.756] -- 0:00:58
      158500 -- (-1049.985) [-1049.104] (-1049.396) (-1048.186) * (-1046.893) (-1049.826) [-1047.544] (-1049.406) -- 0:00:58
      159000 -- [-1049.516] (-1049.465) (-1050.317) (-1052.611) * (-1047.761) [-1047.141] (-1048.427) (-1049.326) -- 0:00:58
      159500 -- [-1047.716] (-1050.316) (-1051.223) (-1053.439) * (-1046.900) (-1054.039) (-1048.211) [-1047.652] -- 0:00:57
      160000 -- [-1049.788] (-1050.381) (-1050.695) (-1051.859) * (-1049.893) (-1058.347) (-1048.167) [-1048.910] -- 0:00:57

      Average standard deviation of split frequencies: 0.032112

      160500 -- [-1050.096] (-1049.781) (-1049.957) (-1050.220) * [-1050.450] (-1057.674) (-1051.525) (-1050.137) -- 0:00:57
      161000 -- (-1049.804) (-1050.096) [-1050.761] (-1050.091) * [-1050.122] (-1056.882) (-1049.782) (-1049.669) -- 0:00:57
      161500 -- (-1050.278) (-1047.274) (-1053.744) [-1049.762] * (-1048.761) [-1047.923] (-1049.121) (-1051.461) -- 0:00:57
      162000 -- (-1048.843) (-1050.084) [-1050.361] (-1053.281) * [-1049.066] (-1048.915) (-1051.259) (-1050.955) -- 0:00:56
      162500 -- (-1051.536) (-1049.959) [-1048.515] (-1052.798) * [-1046.552] (-1048.985) (-1050.405) (-1052.063) -- 0:00:56
      163000 -- (-1048.993) (-1051.088) (-1050.672) [-1052.851] * [-1047.903] (-1047.519) (-1049.519) (-1050.203) -- 0:00:56
      163500 -- (-1054.598) [-1049.130] (-1050.212) (-1052.103) * [-1046.835] (-1052.185) (-1051.627) (-1048.555) -- 0:00:56
      164000 -- (-1050.268) (-1050.309) [-1048.737] (-1050.081) * [-1048.122] (-1051.731) (-1059.862) (-1049.290) -- 0:00:56
      164500 -- (-1049.379) (-1050.619) (-1049.372) [-1048.148] * (-1047.854) (-1049.027) (-1053.560) [-1049.330] -- 0:00:55
      165000 -- (-1055.425) (-1050.256) (-1048.410) [-1053.864] * [-1047.934] (-1050.462) (-1053.092) (-1050.764) -- 0:00:55

      Average standard deviation of split frequencies: 0.032184

      165500 -- (-1051.121) (-1052.795) [-1049.262] (-1050.455) * (-1049.793) (-1055.166) (-1055.120) [-1053.070] -- 0:00:55
      166000 -- (-1049.622) (-1053.480) [-1053.184] (-1053.983) * [-1049.410] (-1050.127) (-1049.223) (-1051.373) -- 0:00:55
      166500 -- [-1049.628] (-1050.800) (-1053.301) (-1046.854) * (-1052.868) (-1051.215) [-1049.298] (-1052.201) -- 0:00:55
      167000 -- (-1050.441) (-1050.743) (-1055.942) [-1048.124] * [-1049.085] (-1053.063) (-1052.010) (-1050.165) -- 0:00:54
      167500 -- (-1047.921) (-1053.281) [-1055.250] (-1051.356) * (-1051.143) (-1050.651) [-1048.400] (-1050.151) -- 0:00:54
      168000 -- (-1051.323) [-1048.585] (-1052.701) (-1051.284) * (-1053.477) (-1052.815) [-1049.786] (-1049.662) -- 0:00:54
      168500 -- [-1048.727] (-1050.119) (-1051.950) (-1050.709) * [-1047.693] (-1053.574) (-1049.153) (-1048.947) -- 0:00:54
      169000 -- (-1049.285) [-1048.600] (-1050.612) (-1048.417) * [-1050.543] (-1051.893) (-1049.696) (-1051.916) -- 0:00:54
      169500 -- (-1048.690) [-1048.034] (-1052.565) (-1051.256) * (-1051.289) (-1052.539) (-1048.834) [-1048.882] -- 0:00:58
      170000 -- [-1049.985] (-1048.001) (-1049.501) (-1051.483) * (-1050.323) (-1049.363) (-1048.206) [-1049.977] -- 0:00:58

      Average standard deviation of split frequencies: 0.030690

      170500 -- [-1049.232] (-1052.723) (-1052.158) (-1049.504) * (-1052.284) [-1051.305] (-1051.060) (-1050.897) -- 0:00:58
      171000 -- (-1047.752) [-1052.435] (-1050.518) (-1051.246) * (-1050.979) (-1049.240) [-1048.529] (-1049.425) -- 0:00:58
      171500 -- (-1049.509) (-1049.940) [-1049.213] (-1052.426) * [-1047.656] (-1048.994) (-1048.246) (-1050.264) -- 0:00:57
      172000 -- [-1049.278] (-1050.381) (-1053.364) (-1048.772) * (-1048.566) (-1049.259) [-1051.282] (-1051.520) -- 0:00:57
      172500 -- [-1051.688] (-1050.427) (-1049.385) (-1050.309) * (-1049.443) (-1048.254) [-1049.946] (-1050.150) -- 0:00:57
      173000 -- (-1051.176) (-1050.535) [-1048.774] (-1051.616) * (-1055.209) (-1049.808) [-1048.729] (-1050.578) -- 0:00:57
      173500 -- (-1053.230) (-1049.509) [-1048.483] (-1053.158) * (-1052.706) [-1053.105] (-1047.814) (-1055.527) -- 0:00:57
      174000 -- (-1052.510) [-1048.684] (-1048.680) (-1051.556) * (-1049.048) (-1049.551) [-1050.577] (-1051.387) -- 0:00:56
      174500 -- (-1049.825) [-1049.083] (-1049.981) (-1056.068) * (-1052.915) (-1049.152) [-1048.773] (-1053.374) -- 0:00:56
      175000 -- (-1049.420) (-1051.518) (-1051.512) [-1047.625] * (-1050.885) [-1049.259] (-1048.849) (-1049.955) -- 0:00:56

      Average standard deviation of split frequencies: 0.027082

      175500 -- (-1048.926) (-1047.365) [-1050.616] (-1050.985) * (-1050.606) [-1049.456] (-1052.832) (-1050.712) -- 0:00:56
      176000 -- (-1050.446) (-1049.255) (-1050.687) [-1054.869] * (-1048.316) [-1050.040] (-1051.614) (-1049.925) -- 0:00:56
      176500 -- [-1049.175] (-1051.063) (-1050.029) (-1049.003) * (-1049.817) (-1050.276) (-1048.504) [-1051.024] -- 0:00:55
      177000 -- [-1048.465] (-1053.335) (-1050.269) (-1047.957) * (-1051.142) [-1050.397] (-1047.913) (-1051.020) -- 0:00:55
      177500 -- (-1049.223) [-1052.498] (-1048.313) (-1049.122) * [-1052.422] (-1051.613) (-1049.767) (-1049.278) -- 0:00:55
      178000 -- (-1047.640) (-1049.342) (-1049.211) [-1048.784] * (-1050.383) [-1048.583] (-1053.222) (-1051.204) -- 0:00:55
      178500 -- (-1050.335) (-1047.888) [-1050.466] (-1048.512) * (-1053.165) (-1051.143) (-1049.303) [-1048.395] -- 0:00:55
      179000 -- (-1049.985) (-1047.872) [-1050.363] (-1044.840) * [-1052.446] (-1050.180) (-1052.406) (-1048.943) -- 0:00:55
      179500 -- (-1049.918) (-1053.326) (-1048.664) [-1051.549] * (-1052.700) (-1049.280) [-1049.094] (-1049.557) -- 0:00:54
      180000 -- (-1050.259) (-1050.074) [-1049.968] (-1047.934) * (-1051.318) (-1052.132) (-1049.939) [-1051.488] -- 0:00:54

      Average standard deviation of split frequencies: 0.028992

      180500 -- [-1050.397] (-1047.335) (-1049.695) (-1049.170) * (-1050.596) (-1047.309) [-1048.907] (-1049.133) -- 0:00:54
      181000 -- (-1048.823) (-1049.553) (-1051.379) [-1049.334] * [-1052.724] (-1056.887) (-1049.692) (-1048.455) -- 0:00:54
      181500 -- (-1049.804) (-1048.931) [-1050.592] (-1049.503) * (-1052.012) [-1050.101] (-1048.907) (-1049.309) -- 0:00:54
      182000 -- (-1056.170) [-1049.387] (-1049.601) (-1050.942) * (-1050.020) (-1053.838) (-1052.209) [-1053.665] -- 0:00:53
      182500 -- (-1056.318) [-1050.637] (-1052.579) (-1048.872) * (-1048.552) (-1051.370) (-1052.222) [-1052.738] -- 0:00:53
      183000 -- (-1053.609) (-1049.554) [-1050.572] (-1048.048) * (-1051.121) [-1051.159] (-1053.049) (-1052.711) -- 0:00:53
      183500 -- (-1051.494) (-1049.520) (-1048.813) [-1054.547] * (-1046.627) (-1048.190) [-1049.075] (-1052.708) -- 0:00:53
      184000 -- (-1051.228) (-1048.825) (-1052.267) [-1053.134] * (-1048.882) (-1050.052) (-1051.363) [-1051.464] -- 0:00:53
      184500 -- (-1053.865) (-1052.144) (-1056.079) [-1049.042] * (-1049.504) [-1049.746] (-1051.258) (-1049.979) -- 0:00:57
      185000 -- (-1052.285) (-1054.167) [-1051.003] (-1048.382) * (-1050.557) [-1051.770] (-1050.473) (-1049.728) -- 0:00:57

      Average standard deviation of split frequencies: 0.028160

      185500 -- (-1053.550) (-1051.860) [-1051.425] (-1049.553) * (-1050.591) (-1050.424) (-1048.889) [-1049.876] -- 0:00:57
      186000 -- (-1048.559) [-1049.205] (-1051.969) (-1051.332) * (-1052.457) (-1050.614) (-1052.003) [-1050.402] -- 0:00:56
      186500 -- [-1049.382] (-1049.418) (-1050.001) (-1051.569) * (-1050.665) (-1049.147) [-1050.412] (-1051.919) -- 0:00:56
      187000 -- (-1051.285) (-1048.979) (-1050.913) [-1049.090] * (-1048.580) (-1048.964) (-1050.766) [-1050.959] -- 0:00:56
      187500 -- (-1048.344) [-1050.054] (-1051.073) (-1047.899) * (-1049.129) (-1048.822) [-1049.398] (-1053.975) -- 0:00:56
      188000 -- [-1052.339] (-1052.137) (-1054.063) (-1049.096) * (-1052.929) (-1049.976) (-1048.396) [-1056.101] -- 0:00:56
      188500 -- (-1051.096) (-1049.528) (-1049.658) [-1051.084] * (-1051.301) (-1049.755) [-1049.230] (-1049.740) -- 0:00:55
      189000 -- (-1050.399) (-1048.883) (-1049.454) [-1052.001] * (-1051.178) [-1048.950] (-1050.510) (-1049.768) -- 0:00:55
      189500 -- (-1047.642) (-1048.779) (-1055.434) [-1050.999] * (-1049.470) [-1051.193] (-1050.162) (-1050.947) -- 0:00:55
      190000 -- (-1047.914) (-1049.390) (-1051.205) [-1051.354] * (-1048.802) (-1049.668) [-1049.907] (-1051.607) -- 0:00:55

      Average standard deviation of split frequencies: 0.024999

      190500 -- (-1051.664) (-1055.695) (-1048.230) [-1052.930] * [-1050.227] (-1048.644) (-1049.644) (-1047.605) -- 0:00:55
      191000 -- (-1049.843) (-1053.829) [-1046.914] (-1048.658) * [-1051.916] (-1052.174) (-1049.227) (-1048.771) -- 0:00:55
      191500 -- [-1050.001] (-1051.603) (-1048.169) (-1049.048) * (-1052.569) (-1048.488) (-1048.500) [-1049.441] -- 0:00:54
      192000 -- (-1051.195) (-1049.805) (-1050.931) [-1049.713] * (-1050.500) [-1050.302] (-1050.578) (-1048.837) -- 0:00:54
      192500 -- (-1052.402) (-1049.657) [-1052.466] (-1051.063) * (-1053.026) [-1053.631] (-1050.091) (-1050.895) -- 0:00:54
      193000 -- [-1049.771] (-1049.078) (-1049.347) (-1048.675) * (-1048.875) (-1051.110) (-1054.032) [-1047.577] -- 0:00:54
      193500 -- (-1052.835) [-1051.302] (-1049.902) (-1049.120) * (-1050.861) (-1050.454) (-1050.185) [-1048.462] -- 0:00:54
      194000 -- [-1048.416] (-1049.136) (-1050.425) (-1047.644) * [-1049.785] (-1049.823) (-1051.607) (-1052.398) -- 0:00:54
      194500 -- [-1047.867] (-1050.063) (-1049.373) (-1050.799) * (-1050.012) (-1049.844) (-1051.832) [-1050.603] -- 0:00:53
      195000 -- (-1049.194) [-1050.006] (-1049.007) (-1049.175) * [-1049.076] (-1050.414) (-1048.546) (-1050.392) -- 0:00:53

      Average standard deviation of split frequencies: 0.025042

      195500 -- [-1047.669] (-1054.839) (-1050.312) (-1049.126) * [-1052.688] (-1049.231) (-1051.850) (-1049.650) -- 0:00:53
      196000 -- (-1049.249) (-1052.567) (-1048.403) [-1050.529] * (-1051.451) (-1050.174) [-1050.453] (-1053.374) -- 0:00:53
      196500 -- [-1047.306] (-1051.852) (-1051.887) (-1048.358) * (-1050.784) (-1050.723) (-1049.362) [-1048.630] -- 0:00:53
      197000 -- (-1049.096) [-1049.691] (-1046.781) (-1050.750) * [-1051.886] (-1048.708) (-1048.681) (-1050.248) -- 0:00:52
      197500 -- (-1048.740) (-1052.887) [-1047.314] (-1051.934) * (-1051.738) (-1050.382) [-1048.153] (-1049.839) -- 0:00:52
      198000 -- (-1054.358) [-1051.252] (-1048.651) (-1051.354) * [-1050.227] (-1049.406) (-1048.389) (-1048.808) -- 0:00:52
      198500 -- [-1046.721] (-1050.365) (-1048.060) (-1048.743) * (-1050.057) (-1049.585) (-1049.023) [-1048.267] -- 0:00:52
      199000 -- (-1053.312) (-1051.152) (-1050.788) [-1049.351] * (-1047.427) (-1050.035) [-1050.516] (-1049.185) -- 0:00:52
      199500 -- [-1049.030] (-1049.985) (-1048.309) (-1050.467) * [-1048.504] (-1050.019) (-1050.527) (-1048.897) -- 0:00:56
      200000 -- (-1050.218) [-1049.374] (-1048.810) (-1047.563) * (-1049.373) (-1050.630) (-1050.036) [-1048.331] -- 0:00:55

      Average standard deviation of split frequencies: 0.022056

      200500 -- (-1049.158) [-1048.325] (-1053.900) (-1049.599) * (-1048.839) [-1052.923] (-1045.047) (-1050.915) -- 0:00:55
      201000 -- (-1054.717) (-1048.036) [-1048.222] (-1051.545) * (-1048.600) [-1049.524] (-1048.398) (-1050.323) -- 0:00:55
      201500 -- [-1049.103] (-1051.127) (-1055.665) (-1052.661) * (-1050.974) [-1048.620] (-1049.334) (-1050.291) -- 0:00:55
      202000 -- [-1049.751] (-1051.171) (-1056.965) (-1048.617) * [-1049.514] (-1053.955) (-1046.166) (-1050.715) -- 0:00:55
      202500 -- (-1049.058) [-1051.629] (-1047.976) (-1048.428) * (-1052.380) [-1049.117] (-1049.885) (-1052.098) -- 0:00:55
      203000 -- (-1049.356) [-1049.032] (-1049.900) (-1051.511) * (-1049.609) [-1049.523] (-1048.486) (-1052.839) -- 0:00:54
      203500 -- (-1050.008) (-1051.847) [-1051.325] (-1053.307) * (-1050.325) (-1048.802) [-1048.050] (-1051.769) -- 0:00:54
      204000 -- (-1048.260) (-1055.364) (-1050.525) [-1053.353] * [-1051.889] (-1047.307) (-1049.516) (-1049.253) -- 0:00:54
      204500 -- (-1051.800) [-1051.198] (-1049.872) (-1049.772) * (-1049.695) (-1048.892) [-1049.293] (-1050.253) -- 0:00:54
      205000 -- [-1047.125] (-1049.778) (-1050.982) (-1050.543) * (-1049.425) (-1050.177) (-1052.955) [-1049.638] -- 0:00:54

      Average standard deviation of split frequencies: 0.020114

      205500 -- (-1055.208) [-1050.176] (-1048.882) (-1050.159) * (-1050.479) (-1054.259) [-1051.463] (-1049.144) -- 0:00:54
      206000 -- (-1052.174) [-1050.484] (-1049.092) (-1050.351) * (-1048.921) [-1049.039] (-1050.613) (-1049.278) -- 0:00:53
      206500 -- (-1047.605) [-1050.013] (-1049.033) (-1050.547) * (-1053.113) (-1051.256) (-1047.855) [-1049.230] -- 0:00:53
      207000 -- (-1049.356) [-1049.171] (-1051.733) (-1048.663) * (-1047.466) (-1049.031) (-1048.787) [-1048.884] -- 0:00:53
      207500 -- [-1049.924] (-1048.110) (-1051.078) (-1049.946) * (-1049.344) (-1050.343) (-1053.075) [-1050.793] -- 0:00:53
      208000 -- [-1048.819] (-1054.413) (-1049.448) (-1051.049) * [-1050.556] (-1046.544) (-1048.986) (-1050.587) -- 0:00:53
      208500 -- (-1050.788) [-1050.527] (-1050.154) (-1049.318) * (-1051.294) [-1049.685] (-1050.415) (-1049.547) -- 0:00:53
      209000 -- (-1052.229) (-1051.432) [-1050.217] (-1049.686) * (-1049.337) [-1049.291] (-1050.160) (-1051.934) -- 0:00:52
      209500 -- (-1049.940) (-1051.535) [-1052.051] (-1053.008) * (-1050.594) [-1052.480] (-1049.170) (-1050.443) -- 0:00:52
      210000 -- (-1051.281) (-1048.676) (-1049.333) [-1051.522] * [-1049.995] (-1049.720) (-1051.976) (-1048.528) -- 0:00:52

      Average standard deviation of split frequencies: 0.020728

      210500 -- (-1048.243) (-1050.825) [-1049.164] (-1049.018) * (-1051.193) [-1049.792] (-1049.072) (-1048.829) -- 0:00:52
      211000 -- (-1047.843) (-1050.553) (-1048.744) [-1051.992] * (-1056.096) [-1050.783] (-1048.020) (-1052.405) -- 0:00:52
      211500 -- (-1048.851) (-1052.816) (-1049.062) [-1049.736] * (-1050.796) (-1051.976) [-1049.276] (-1052.522) -- 0:00:52
      212000 -- [-1048.394] (-1054.353) (-1052.366) (-1052.368) * (-1051.920) [-1048.269] (-1050.051) (-1050.057) -- 0:00:52
      212500 -- (-1050.637) (-1049.670) (-1049.749) [-1053.220] * (-1052.758) (-1049.452) [-1050.114] (-1053.476) -- 0:00:51
      213000 -- [-1048.729] (-1049.853) (-1049.755) (-1049.735) * (-1052.512) (-1048.809) [-1052.615] (-1049.659) -- 0:00:51
      213500 -- [-1048.805] (-1050.905) (-1051.700) (-1052.390) * (-1051.713) (-1049.540) [-1049.223] (-1052.284) -- 0:00:51
      214000 -- (-1049.307) (-1052.878) (-1053.321) [-1049.321] * (-1050.802) [-1051.143] (-1046.792) (-1052.194) -- 0:00:51
      214500 -- [-1049.675] (-1050.766) (-1054.072) (-1047.335) * (-1047.465) (-1048.984) [-1046.122] (-1050.537) -- 0:00:51
      215000 -- [-1049.487] (-1050.311) (-1049.321) (-1046.572) * (-1046.612) [-1049.862] (-1050.029) (-1049.131) -- 0:00:54

      Average standard deviation of split frequencies: 0.021595

      215500 -- (-1049.494) [-1048.269] (-1049.313) (-1049.042) * (-1050.706) (-1049.707) [-1051.046] (-1049.587) -- 0:00:54
      216000 -- (-1048.328) [-1049.509] (-1048.854) (-1045.916) * [-1050.168] (-1050.779) (-1051.315) (-1050.933) -- 0:00:54
      216500 -- (-1048.321) (-1051.882) [-1049.626] (-1050.433) * [-1049.543] (-1048.309) (-1049.844) (-1049.492) -- 0:00:54
      217000 -- [-1048.669] (-1050.225) (-1049.291) (-1048.269) * [-1052.733] (-1048.734) (-1051.124) (-1050.263) -- 0:00:54
      217500 -- (-1048.740) (-1050.573) [-1048.673] (-1054.184) * (-1053.622) [-1050.097] (-1051.019) (-1051.116) -- 0:00:53
      218000 -- (-1050.547) (-1048.949) (-1049.789) [-1046.563] * (-1050.004) (-1048.808) (-1051.037) [-1049.840] -- 0:00:53
      218500 -- (-1048.408) [-1051.134] (-1051.903) (-1052.978) * (-1053.714) [-1048.663] (-1050.654) (-1052.019) -- 0:00:53
      219000 -- (-1049.873) (-1048.120) (-1048.842) [-1049.770] * (-1048.678) [-1049.380] (-1053.601) (-1050.406) -- 0:00:53
      219500 -- (-1050.552) (-1050.560) (-1051.266) [-1048.129] * [-1048.008] (-1052.161) (-1048.761) (-1049.877) -- 0:00:53
      220000 -- [-1048.464] (-1048.634) (-1050.679) (-1047.245) * [-1049.331] (-1050.206) (-1050.227) (-1050.118) -- 0:00:53

      Average standard deviation of split frequencies: 0.021925

      220500 -- [-1051.611] (-1052.452) (-1049.374) (-1048.007) * (-1049.441) (-1053.464) [-1054.236] (-1050.951) -- 0:00:53
      221000 -- (-1051.046) (-1051.202) (-1052.470) [-1048.445] * [-1049.325] (-1048.738) (-1052.805) (-1055.411) -- 0:00:52
      221500 -- [-1051.096] (-1047.665) (-1050.708) (-1047.880) * (-1048.482) (-1049.626) [-1050.166] (-1050.664) -- 0:00:52
      222000 -- (-1050.588) [-1048.614] (-1050.316) (-1052.623) * (-1052.134) [-1050.292] (-1051.072) (-1049.697) -- 0:00:52
      222500 -- (-1048.521) (-1049.009) (-1050.658) [-1049.500] * (-1050.617) (-1050.096) [-1051.525] (-1048.522) -- 0:00:52
      223000 -- [-1048.559] (-1049.337) (-1051.591) (-1053.351) * (-1047.529) [-1046.754] (-1050.880) (-1050.459) -- 0:00:52
      223500 -- (-1052.308) (-1048.687) (-1047.923) [-1048.310] * [-1048.787] (-1049.933) (-1051.310) (-1052.439) -- 0:00:52
      224000 -- (-1053.428) [-1049.986] (-1049.585) (-1048.772) * [-1050.957] (-1050.023) (-1049.021) (-1052.918) -- 0:00:51
      224500 -- [-1049.389] (-1051.702) (-1049.190) (-1048.823) * [-1048.423] (-1047.754) (-1052.825) (-1053.215) -- 0:00:51
      225000 -- (-1049.503) (-1054.777) (-1048.370) [-1049.007] * (-1050.728) (-1049.274) (-1052.308) [-1046.457] -- 0:00:51

      Average standard deviation of split frequencies: 0.020529

      225500 -- (-1047.475) [-1054.056] (-1049.330) (-1049.081) * (-1053.995) [-1046.807] (-1050.742) (-1048.558) -- 0:00:51
      226000 -- (-1050.649) [-1047.508] (-1049.716) (-1047.330) * (-1048.760) (-1049.889) [-1048.927] (-1052.741) -- 0:00:51
      226500 -- (-1049.294) (-1050.356) (-1050.444) [-1049.993] * (-1051.358) [-1048.838] (-1049.805) (-1051.280) -- 0:00:51
      227000 -- (-1048.286) [-1053.684] (-1048.503) (-1048.054) * [-1045.959] (-1051.556) (-1051.856) (-1051.759) -- 0:00:51
      227500 -- (-1049.638) (-1052.085) (-1049.637) [-1048.350] * [-1050.175] (-1049.580) (-1053.753) (-1051.444) -- 0:00:50
      228000 -- (-1051.343) (-1051.298) (-1049.372) [-1053.125] * (-1049.939) (-1049.976) (-1050.361) [-1048.828] -- 0:00:50
      228500 -- [-1053.460] (-1053.743) (-1049.004) (-1047.417) * (-1049.672) (-1049.738) [-1052.051] (-1048.864) -- 0:00:50
      229000 -- (-1052.292) (-1053.846) (-1049.180) [-1046.791] * (-1050.324) (-1050.325) (-1051.757) [-1050.043] -- 0:00:50
      229500 -- (-1048.176) [-1050.266] (-1049.102) (-1048.310) * (-1054.563) [-1048.492] (-1050.744) (-1049.122) -- 0:00:50
      230000 -- (-1051.980) (-1050.887) (-1050.845) [-1049.548] * (-1051.170) (-1051.406) [-1051.055] (-1049.232) -- 0:00:53

      Average standard deviation of split frequencies: 0.019899

      230500 -- (-1049.565) [-1050.150] (-1050.619) (-1050.305) * (-1051.219) [-1047.219] (-1049.670) (-1048.395) -- 0:00:53
      231000 -- (-1049.347) (-1053.746) [-1049.210] (-1049.461) * [-1050.294] (-1048.802) (-1048.025) (-1048.474) -- 0:00:53
      231500 -- (-1049.481) (-1051.483) (-1047.075) [-1048.349] * (-1052.185) (-1057.163) (-1047.648) [-1048.828] -- 0:00:53
      232000 -- (-1045.595) (-1051.398) [-1049.573] (-1051.133) * (-1051.826) [-1050.344] (-1052.507) (-1049.563) -- 0:00:52
      232500 -- (-1048.516) [-1048.964] (-1050.529) (-1049.489) * [-1049.026] (-1054.501) (-1051.825) (-1049.660) -- 0:00:52
      233000 -- (-1049.453) (-1049.707) [-1053.174] (-1050.269) * (-1053.801) (-1051.642) [-1048.867] (-1048.681) -- 0:00:52
      233500 -- [-1047.784] (-1049.158) (-1049.751) (-1049.297) * (-1049.947) (-1047.269) [-1051.053] (-1053.736) -- 0:00:52
      234000 -- (-1049.454) (-1054.671) [-1048.869] (-1046.050) * (-1050.463) [-1049.605] (-1050.141) (-1050.266) -- 0:00:52
      234500 -- (-1051.709) (-1052.589) (-1049.792) [-1048.370] * [-1049.109] (-1047.863) (-1052.290) (-1049.491) -- 0:00:52
      235000 -- (-1050.429) [-1051.072] (-1049.789) (-1050.106) * (-1049.031) [-1048.838] (-1048.872) (-1048.221) -- 0:00:52

      Average standard deviation of split frequencies: 0.018818

      235500 -- (-1052.102) (-1050.051) (-1051.247) [-1049.604] * (-1047.813) (-1049.945) (-1051.623) [-1049.342] -- 0:00:51
      236000 -- (-1048.910) (-1051.863) (-1052.951) [-1045.178] * [-1050.683] (-1050.434) (-1047.916) (-1050.831) -- 0:00:51
      236500 -- (-1056.972) (-1051.261) [-1049.610] (-1047.703) * (-1049.595) [-1049.689] (-1050.987) (-1051.287) -- 0:00:51
      237000 -- (-1048.453) (-1048.779) (-1049.330) [-1050.502] * (-1046.343) (-1050.465) [-1048.852] (-1052.388) -- 0:00:51
      237500 -- (-1049.022) (-1050.761) [-1051.739] (-1052.755) * (-1048.460) (-1050.823) (-1054.070) [-1052.318] -- 0:00:51
      238000 -- [-1050.321] (-1051.802) (-1050.185) (-1049.989) * (-1049.909) [-1047.785] (-1049.204) (-1049.553) -- 0:00:51
      238500 -- (-1051.200) (-1049.631) (-1050.634) [-1050.530] * (-1049.696) (-1050.383) (-1051.125) [-1050.395] -- 0:00:51
      239000 -- (-1051.985) (-1048.823) (-1050.194) [-1053.191] * [-1047.353] (-1050.438) (-1051.596) (-1054.284) -- 0:00:50
      239500 -- (-1049.492) (-1051.109) [-1049.841] (-1049.952) * (-1050.498) (-1049.897) (-1049.837) [-1050.321] -- 0:00:50
      240000 -- (-1049.155) (-1051.030) (-1051.753) [-1050.026] * (-1048.615) (-1051.014) [-1049.822] (-1054.505) -- 0:00:50

      Average standard deviation of split frequencies: 0.017629

      240500 -- (-1049.031) (-1049.887) (-1050.441) [-1047.078] * (-1051.666) (-1051.591) [-1050.844] (-1048.876) -- 0:00:50
      241000 -- (-1050.551) (-1050.448) [-1052.838] (-1047.748) * (-1049.933) [-1050.763] (-1050.085) (-1053.314) -- 0:00:50
      241500 -- (-1050.615) (-1047.501) [-1049.420] (-1049.184) * (-1048.795) (-1050.713) (-1049.894) [-1049.797] -- 0:00:50
      242000 -- (-1050.289) [-1050.084] (-1051.174) (-1050.322) * (-1049.626) (-1052.089) (-1049.424) [-1048.625] -- 0:00:50
      242500 -- [-1049.651] (-1052.306) (-1049.576) (-1047.383) * (-1050.323) (-1050.736) (-1051.185) [-1046.646] -- 0:00:49
      243000 -- (-1049.573) [-1049.053] (-1049.681) (-1051.190) * (-1048.280) (-1046.262) [-1049.792] (-1049.622) -- 0:00:49
      243500 -- (-1047.928) [-1048.949] (-1048.231) (-1048.527) * [-1048.874] (-1048.965) (-1053.516) (-1052.485) -- 0:00:49
      244000 -- (-1051.026) [-1048.362] (-1051.654) (-1056.550) * (-1048.533) (-1049.447) [-1048.987] (-1055.093) -- 0:00:49
      244500 -- (-1047.641) [-1051.771] (-1052.846) (-1052.413) * (-1051.814) (-1049.116) [-1057.170] (-1050.763) -- 0:00:49
      245000 -- [-1050.279] (-1050.184) (-1051.354) (-1048.571) * (-1052.077) (-1051.906) [-1048.700] (-1051.330) -- 0:00:52

      Average standard deviation of split frequencies: 0.016944

      245500 -- [-1052.095] (-1049.090) (-1050.321) (-1047.067) * [-1049.921] (-1052.945) (-1055.170) (-1049.841) -- 0:00:52
      246000 -- [-1051.290] (-1049.025) (-1051.362) (-1049.903) * (-1048.263) [-1048.163] (-1049.949) (-1049.112) -- 0:00:52
      246500 -- (-1046.587) (-1052.673) (-1050.261) [-1046.872] * (-1049.268) (-1051.149) [-1049.546] (-1048.579) -- 0:00:51
      247000 -- (-1049.660) [-1050.246] (-1050.405) (-1048.885) * [-1048.438] (-1048.898) (-1050.107) (-1049.002) -- 0:00:51
      247500 -- (-1050.484) (-1053.532) (-1049.797) [-1048.123] * (-1049.127) [-1048.783] (-1052.940) (-1048.829) -- 0:00:51
      248000 -- [-1049.300] (-1053.532) (-1050.719) (-1049.765) * [-1048.069] (-1049.164) (-1054.889) (-1050.840) -- 0:00:51
      248500 -- (-1052.709) (-1050.687) (-1055.451) [-1049.930] * (-1050.372) (-1050.377) [-1050.814] (-1049.842) -- 0:00:51
      249000 -- (-1053.272) (-1049.488) (-1053.526) [-1050.215] * (-1050.573) (-1049.007) (-1052.165) [-1051.759] -- 0:00:51
      249500 -- (-1056.105) (-1050.479) (-1046.524) [-1053.223] * (-1050.082) (-1049.345) [-1050.895] (-1049.391) -- 0:00:51
      250000 -- (-1052.970) (-1051.791) [-1050.162] (-1052.760) * [-1051.698] (-1050.468) (-1047.578) (-1049.937) -- 0:00:51

      Average standard deviation of split frequencies: 0.015936

      250500 -- (-1050.542) (-1048.220) [-1049.657] (-1054.498) * (-1051.409) (-1051.021) [-1048.380] (-1049.232) -- 0:00:50
      251000 -- [-1048.994] (-1049.624) (-1051.518) (-1053.353) * [-1050.582] (-1051.045) (-1051.529) (-1049.554) -- 0:00:50
      251500 -- [-1047.424] (-1049.343) (-1049.714) (-1054.297) * (-1050.141) (-1049.940) [-1051.778] (-1050.462) -- 0:00:50
      252000 -- (-1053.095) (-1050.045) [-1052.820] (-1050.832) * (-1052.147) (-1054.069) (-1051.058) [-1049.014] -- 0:00:50
      252500 -- (-1049.314) [-1049.338] (-1050.031) (-1048.397) * (-1052.795) [-1049.946] (-1050.639) (-1050.612) -- 0:00:50
      253000 -- [-1047.840] (-1050.335) (-1050.039) (-1045.285) * (-1052.495) (-1050.821) [-1048.482] (-1053.370) -- 0:00:50
      253500 -- (-1046.986) (-1050.364) [-1048.508] (-1050.243) * (-1048.382) (-1051.013) (-1050.703) [-1049.753] -- 0:00:50
      254000 -- (-1049.755) (-1050.297) (-1050.093) [-1046.792] * (-1049.918) [-1048.967] (-1053.039) (-1049.980) -- 0:00:49
      254500 -- [-1049.193] (-1051.543) (-1051.682) (-1050.896) * (-1050.528) [-1049.125] (-1052.050) (-1053.421) -- 0:00:49
      255000 -- (-1048.696) (-1049.493) (-1050.443) [-1052.024] * [-1051.273] (-1047.998) (-1051.194) (-1049.040) -- 0:00:49

      Average standard deviation of split frequencies: 0.015857

      255500 -- (-1047.097) [-1049.258] (-1050.781) (-1049.431) * (-1051.007) (-1051.933) (-1048.788) [-1049.564] -- 0:00:49
      256000 -- (-1045.607) (-1045.575) [-1053.961] (-1049.189) * [-1049.646] (-1048.950) (-1051.076) (-1050.229) -- 0:00:49
      256500 -- (-1048.304) (-1050.299) [-1053.035] (-1049.118) * [-1050.927] (-1051.915) (-1048.987) (-1049.590) -- 0:00:49
      257000 -- [-1049.197] (-1050.957) (-1057.965) (-1049.055) * [-1047.821] (-1052.874) (-1050.102) (-1050.543) -- 0:00:49
      257500 -- (-1047.713) (-1050.755) (-1050.553) [-1051.713] * (-1051.667) [-1050.355] (-1051.872) (-1049.333) -- 0:00:49
      258000 -- (-1047.755) (-1047.528) [-1057.293] (-1050.234) * (-1051.754) (-1049.063) [-1050.655] (-1048.370) -- 0:00:48
      258500 -- (-1050.869) [-1050.340] (-1052.322) (-1050.753) * (-1055.676) (-1050.311) [-1049.052] (-1049.330) -- 0:00:48
      259000 -- (-1048.658) [-1049.104] (-1052.947) (-1048.448) * [-1049.098] (-1052.020) (-1053.263) (-1051.266) -- 0:00:48
      259500 -- (-1049.148) [-1049.243] (-1049.043) (-1052.754) * (-1050.128) (-1050.598) (-1051.656) [-1048.828] -- 0:00:48
      260000 -- (-1050.481) (-1053.713) [-1050.368] (-1048.443) * (-1049.599) [-1047.628] (-1049.747) (-1049.343) -- 0:00:51

      Average standard deviation of split frequencies: 0.015171

      260500 -- [-1049.516] (-1050.845) (-1049.272) (-1047.404) * (-1048.526) (-1053.648) [-1049.896] (-1049.508) -- 0:00:51
      261000 -- (-1047.345) [-1050.979] (-1051.445) (-1051.684) * (-1049.141) [-1050.737] (-1050.600) (-1050.119) -- 0:00:50
      261500 -- (-1051.362) (-1048.928) [-1049.647] (-1049.011) * (-1049.411) (-1049.111) [-1050.763] (-1049.845) -- 0:00:50
      262000 -- (-1048.783) (-1049.453) (-1054.468) [-1047.823] * (-1049.433) (-1048.920) (-1050.416) [-1052.394] -- 0:00:50
      262500 -- (-1051.127) (-1053.500) [-1049.193] (-1051.942) * (-1049.716) (-1048.681) (-1049.188) [-1049.854] -- 0:00:50
      263000 -- (-1052.616) (-1048.977) (-1048.969) [-1049.287] * (-1049.000) [-1047.850] (-1048.787) (-1049.403) -- 0:00:50
      263500 -- (-1050.300) [-1049.286] (-1047.762) (-1050.968) * [-1049.163] (-1050.404) (-1048.799) (-1048.715) -- 0:00:50
      264000 -- (-1050.162) (-1049.064) [-1051.380] (-1050.134) * (-1050.156) [-1051.778] (-1049.378) (-1051.019) -- 0:00:50
      264500 -- (-1049.729) (-1050.136) (-1053.227) [-1049.221] * (-1048.991) (-1050.503) [-1050.232] (-1048.880) -- 0:00:50
      265000 -- (-1048.660) (-1049.103) [-1049.770] (-1050.383) * (-1048.083) (-1050.771) (-1052.006) [-1049.765] -- 0:00:49

      Average standard deviation of split frequencies: 0.014737

      265500 -- (-1049.650) (-1048.901) (-1049.671) [-1050.267] * [-1050.507] (-1051.801) (-1051.846) (-1047.264) -- 0:00:49
      266000 -- (-1050.302) (-1053.068) (-1049.541) [-1050.870] * (-1051.536) (-1050.087) [-1048.928] (-1050.643) -- 0:00:49
      266500 -- [-1051.038] (-1047.132) (-1050.046) (-1052.617) * (-1049.483) (-1053.660) (-1050.880) [-1049.320] -- 0:00:49
      267000 -- [-1052.985] (-1048.629) (-1050.472) (-1048.595) * (-1049.592) (-1051.271) [-1053.480] (-1051.786) -- 0:00:49
      267500 -- (-1049.202) [-1049.639] (-1051.274) (-1049.493) * (-1050.448) [-1049.876] (-1048.594) (-1054.237) -- 0:00:49
      268000 -- (-1048.097) (-1050.219) [-1052.146] (-1051.445) * (-1049.226) (-1051.016) [-1051.926] (-1051.299) -- 0:00:49
      268500 -- [-1047.437] (-1050.784) (-1049.366) (-1049.336) * (-1051.947) [-1051.195] (-1050.100) (-1049.477) -- 0:00:49
      269000 -- (-1050.164) (-1050.109) [-1050.018] (-1049.120) * (-1048.290) (-1049.612) [-1052.723] (-1055.147) -- 0:00:48
      269500 -- [-1053.912] (-1050.904) (-1051.627) (-1049.467) * (-1046.991) (-1049.698) (-1058.553) [-1048.494] -- 0:00:48
      270000 -- [-1048.975] (-1051.694) (-1053.056) (-1048.823) * (-1049.577) (-1050.570) (-1062.971) [-1048.183] -- 0:00:48

      Average standard deviation of split frequencies: 0.014758

      270500 -- (-1048.507) (-1049.576) (-1051.973) [-1048.188] * (-1048.784) (-1048.838) [-1051.803] (-1048.325) -- 0:00:48
      271000 -- (-1049.638) (-1048.499) [-1050.845] (-1050.798) * [-1049.307] (-1049.546) (-1051.426) (-1048.283) -- 0:00:48
      271500 -- [-1051.915] (-1049.768) (-1048.472) (-1049.021) * (-1048.777) (-1052.094) (-1055.124) [-1049.099] -- 0:00:48
      272000 -- (-1049.487) (-1049.093) [-1051.065] (-1049.220) * [-1047.950] (-1050.316) (-1049.778) (-1050.221) -- 0:00:48
      272500 -- (-1049.204) (-1046.247) (-1051.633) [-1049.743] * (-1050.759) (-1051.274) [-1052.739] (-1048.864) -- 0:00:48
      273000 -- (-1050.010) (-1052.083) (-1053.212) [-1048.984] * (-1054.573) [-1053.590] (-1049.127) (-1048.581) -- 0:00:47
      273500 -- (-1049.098) (-1051.775) [-1048.788] (-1052.334) * (-1048.169) (-1051.163) [-1050.663] (-1049.239) -- 0:00:47
      274000 -- [-1047.958] (-1049.529) (-1050.768) (-1052.963) * [-1049.159] (-1049.441) (-1050.514) (-1048.583) -- 0:00:47
      274500 -- (-1050.301) (-1050.044) (-1052.488) [-1048.361] * (-1052.494) (-1048.756) [-1048.795] (-1048.146) -- 0:00:47
      275000 -- (-1049.996) [-1050.115] (-1053.071) (-1049.534) * [-1052.409] (-1049.658) (-1048.706) (-1047.028) -- 0:00:50

      Average standard deviation of split frequencies: 0.014563

      275500 -- (-1050.489) (-1051.133) (-1048.997) [-1051.112] * (-1048.681) (-1050.005) (-1048.998) [-1053.292] -- 0:00:49
      276000 -- [-1051.165] (-1049.721) (-1050.166) (-1050.023) * (-1051.287) (-1054.075) [-1049.849] (-1049.815) -- 0:00:49
      276500 -- (-1052.944) [-1049.419] (-1054.499) (-1050.516) * [-1050.256] (-1048.839) (-1052.104) (-1048.908) -- 0:00:49
      277000 -- (-1051.718) [-1049.648] (-1048.757) (-1054.459) * (-1047.749) (-1051.786) [-1050.171] (-1048.432) -- 0:00:49
      277500 -- (-1051.102) (-1052.446) (-1050.502) [-1049.212] * [-1049.589] (-1048.451) (-1048.790) (-1048.640) -- 0:00:49
      278000 -- (-1050.446) [-1050.303] (-1049.379) (-1049.235) * (-1051.899) (-1051.252) (-1050.519) [-1049.439] -- 0:00:49
      278500 -- (-1049.708) (-1048.637) (-1055.518) [-1049.952] * [-1050.706] (-1049.269) (-1049.099) (-1053.101) -- 0:00:49
      279000 -- (-1053.584) [-1048.216] (-1050.030) (-1048.281) * [-1050.823] (-1049.069) (-1048.876) (-1049.282) -- 0:00:49
      279500 -- (-1051.841) [-1048.913] (-1049.164) (-1048.925) * (-1048.795) [-1050.889] (-1048.911) (-1055.228) -- 0:00:48
      280000 -- [-1050.750] (-1050.418) (-1052.557) (-1049.865) * [-1048.010] (-1050.154) (-1051.664) (-1049.579) -- 0:00:48

      Average standard deviation of split frequencies: 0.014498

      280500 -- (-1049.620) (-1050.530) [-1050.716] (-1048.748) * (-1049.896) (-1051.522) [-1051.400] (-1047.576) -- 0:00:48
      281000 -- (-1051.472) [-1049.107] (-1050.105) (-1052.192) * (-1054.386) (-1050.935) [-1050.816] (-1050.888) -- 0:00:48
      281500 -- (-1052.951) [-1048.572] (-1051.570) (-1050.611) * (-1049.954) [-1048.310] (-1060.622) (-1057.314) -- 0:00:48
      282000 -- [-1051.287] (-1048.873) (-1049.505) (-1050.992) * [-1046.803] (-1050.237) (-1050.898) (-1050.721) -- 0:00:48
      282500 -- (-1049.307) [-1050.307] (-1050.030) (-1049.896) * [-1049.508] (-1048.943) (-1050.196) (-1054.319) -- 0:00:48
      283000 -- (-1049.592) (-1049.344) [-1051.775] (-1049.119) * (-1051.239) (-1048.893) [-1051.153] (-1051.586) -- 0:00:48
      283500 -- [-1049.414] (-1048.322) (-1056.653) (-1052.254) * [-1053.090] (-1048.965) (-1050.825) (-1049.580) -- 0:00:48
      284000 -- [-1048.612] (-1049.229) (-1055.965) (-1051.009) * (-1048.761) (-1055.031) (-1049.458) [-1049.490] -- 0:00:47
      284500 -- [-1051.163] (-1049.828) (-1050.380) (-1051.511) * (-1047.625) [-1051.235] (-1050.033) (-1049.974) -- 0:00:47
      285000 -- (-1052.485) [-1049.245] (-1049.845) (-1049.860) * (-1047.843) (-1051.184) (-1052.488) [-1051.727] -- 0:00:47

      Average standard deviation of split frequencies: 0.013880

      285500 -- [-1051.813] (-1050.672) (-1050.508) (-1049.591) * (-1053.528) [-1051.782] (-1049.083) (-1048.848) -- 0:00:47
      286000 -- (-1051.279) (-1053.296) [-1048.940] (-1051.900) * (-1051.791) (-1048.998) (-1052.039) [-1048.905] -- 0:00:47
      286500 -- (-1053.131) (-1048.840) (-1057.971) [-1050.095] * (-1053.037) [-1049.226] (-1053.805) (-1050.450) -- 0:00:47
      287000 -- (-1056.451) [-1050.590] (-1054.473) (-1051.135) * [-1050.712] (-1049.724) (-1052.658) (-1049.164) -- 0:00:47
      287500 -- (-1049.142) (-1048.889) (-1050.899) [-1051.621] * (-1048.637) (-1047.388) (-1049.758) [-1049.147] -- 0:00:47
      288000 -- (-1051.349) (-1054.549) [-1055.106] (-1051.807) * (-1048.799) [-1050.514] (-1049.695) (-1048.480) -- 0:00:46
      288500 -- (-1052.724) [-1047.687] (-1053.852) (-1051.781) * (-1046.984) [-1047.152] (-1050.084) (-1048.535) -- 0:00:46
      289000 -- (-1050.102) (-1049.997) (-1049.479) [-1048.420] * (-1049.468) (-1051.271) [-1049.767] (-1047.105) -- 0:00:46
      289500 -- (-1050.253) [-1048.751] (-1049.843) (-1048.782) * (-1051.831) (-1050.398) [-1054.020] (-1052.720) -- 0:00:46
      290000 -- (-1050.960) (-1049.371) [-1048.929] (-1048.645) * (-1052.907) [-1052.696] (-1048.416) (-1050.392) -- 0:00:46

      Average standard deviation of split frequencies: 0.012804

      290500 -- (-1050.713) [-1048.328] (-1050.935) (-1050.319) * (-1052.473) (-1052.024) [-1051.574] (-1050.728) -- 0:00:48
      291000 -- [-1050.833] (-1048.926) (-1052.567) (-1052.163) * (-1047.199) (-1050.314) (-1052.088) [-1049.551] -- 0:00:48
      291500 -- (-1052.784) [-1048.036] (-1049.485) (-1050.400) * (-1046.174) (-1049.216) [-1048.374] (-1049.168) -- 0:00:48
      292000 -- [-1049.127] (-1052.754) (-1049.505) (-1052.123) * [-1047.414] (-1047.053) (-1050.248) (-1048.963) -- 0:00:48
      292500 -- (-1049.114) (-1049.328) [-1049.324] (-1051.257) * [-1048.022] (-1050.919) (-1049.107) (-1049.801) -- 0:00:48
      293000 -- [-1046.209] (-1049.160) (-1050.250) (-1051.003) * [-1047.009] (-1049.441) (-1051.644) (-1049.469) -- 0:00:48
      293500 -- (-1048.592) (-1049.445) [-1052.053] (-1053.565) * [-1045.186] (-1049.420) (-1053.622) (-1052.194) -- 0:00:48
      294000 -- (-1048.638) (-1052.347) [-1050.451] (-1049.349) * [-1048.715] (-1049.177) (-1051.190) (-1051.355) -- 0:00:48
      294500 -- (-1048.531) (-1049.501) [-1051.450] (-1048.747) * (-1047.667) (-1049.806) (-1051.920) [-1049.452] -- 0:00:47
      295000 -- (-1056.269) [-1049.009] (-1050.564) (-1048.801) * [-1048.287] (-1051.532) (-1049.260) (-1051.580) -- 0:00:47

      Average standard deviation of split frequencies: 0.012741

      295500 -- (-1050.386) [-1048.506] (-1050.232) (-1049.684) * (-1052.255) (-1052.639) (-1047.311) [-1049.411] -- 0:00:47
      296000 -- [-1049.626] (-1048.575) (-1050.602) (-1053.762) * (-1047.762) (-1049.268) [-1048.626] (-1049.994) -- 0:00:47
      296500 -- (-1049.341) (-1052.371) (-1050.689) [-1048.526] * [-1053.415] (-1051.235) (-1051.048) (-1050.575) -- 0:00:47
      297000 -- (-1049.239) [-1050.529] (-1053.546) (-1050.652) * (-1055.806) (-1052.010) [-1045.680] (-1054.494) -- 0:00:47
      297500 -- [-1048.939] (-1055.235) (-1051.430) (-1049.153) * (-1053.291) (-1049.406) (-1049.489) [-1054.486] -- 0:00:47
      298000 -- (-1050.495) (-1052.548) [-1049.770] (-1051.648) * (-1052.968) (-1050.519) (-1046.931) [-1049.753] -- 0:00:47
      298500 -- (-1049.671) (-1051.738) (-1051.141) [-1048.343] * (-1050.142) (-1050.389) [-1049.813] (-1049.395) -- 0:00:47
      299000 -- (-1049.596) (-1049.276) (-1051.904) [-1048.610] * (-1048.965) (-1050.008) (-1048.954) [-1050.363] -- 0:00:46
      299500 -- (-1053.902) (-1048.680) (-1052.118) [-1050.458] * (-1049.090) (-1048.020) [-1053.462] (-1052.065) -- 0:00:46
      300000 -- [-1046.826] (-1048.593) (-1051.147) (-1048.639) * (-1048.623) (-1049.706) (-1053.503) [-1049.716] -- 0:00:46

      Average standard deviation of split frequencies: 0.012130

      300500 -- (-1049.622) (-1049.821) (-1050.587) [-1048.495] * (-1051.949) [-1048.724] (-1052.447) (-1048.754) -- 0:00:46
      301000 -- (-1049.064) [-1049.618] (-1051.222) (-1049.699) * (-1053.848) [-1048.787] (-1050.451) (-1049.254) -- 0:00:46
      301500 -- (-1050.700) (-1049.150) (-1051.379) [-1049.535] * (-1050.621) (-1049.132) (-1048.728) [-1047.658] -- 0:00:46
      302000 -- [-1050.422] (-1049.580) (-1050.042) (-1049.270) * (-1052.184) (-1054.273) [-1049.115] (-1050.505) -- 0:00:46
      302500 -- [-1049.661] (-1049.639) (-1051.969) (-1047.822) * (-1049.918) [-1049.225] (-1052.757) (-1049.282) -- 0:00:46
      303000 -- (-1053.249) (-1048.918) (-1050.364) [-1049.569] * [-1046.728] (-1050.440) (-1048.584) (-1051.948) -- 0:00:46
      303500 -- (-1048.988) (-1051.817) [-1050.169] (-1049.647) * (-1049.110) [-1049.636] (-1052.053) (-1048.537) -- 0:00:45
      304000 -- [-1048.443] (-1053.267) (-1050.013) (-1051.321) * [-1052.966] (-1048.785) (-1050.675) (-1046.521) -- 0:00:45
      304500 -- [-1048.462] (-1052.502) (-1047.942) (-1053.355) * (-1048.721) (-1047.946) (-1051.694) [-1048.844] -- 0:00:45
      305000 -- (-1049.904) (-1048.771) [-1052.577] (-1050.378) * (-1048.973) (-1052.362) [-1049.414] (-1049.975) -- 0:00:45

      Average standard deviation of split frequencies: 0.011919

      305500 -- (-1049.271) (-1049.610) (-1049.094) [-1049.658] * (-1051.840) [-1053.671] (-1052.003) (-1048.430) -- 0:00:47
      306000 -- (-1050.801) [-1051.255] (-1046.581) (-1052.321) * (-1051.376) (-1052.436) [-1049.056] (-1051.142) -- 0:00:47
      306500 -- (-1055.235) (-1053.244) (-1049.256) [-1050.341] * (-1052.130) [-1050.507] (-1051.099) (-1047.537) -- 0:00:47
      307000 -- (-1048.439) (-1051.277) [-1050.063] (-1049.765) * [-1051.291] (-1051.741) (-1049.724) (-1047.782) -- 0:00:47
      307500 -- (-1049.268) [-1051.597] (-1049.950) (-1049.406) * (-1049.850) (-1051.847) [-1048.569] (-1051.524) -- 0:00:47
      308000 -- [-1051.643] (-1052.711) (-1049.827) (-1052.944) * (-1049.088) [-1048.256] (-1048.809) (-1047.224) -- 0:00:47
      308500 -- (-1053.562) (-1051.453) (-1050.385) [-1051.159] * (-1049.647) (-1050.359) (-1051.264) [-1049.028] -- 0:00:47
      309000 -- (-1051.562) (-1050.189) [-1048.024] (-1048.569) * [-1048.810] (-1049.421) (-1046.995) (-1052.072) -- 0:00:46
      309500 -- (-1051.445) [-1051.694] (-1050.690) (-1048.382) * (-1049.101) (-1049.094) (-1049.877) [-1050.081] -- 0:00:46
      310000 -- (-1050.410) (-1049.517) [-1049.875] (-1048.202) * (-1049.248) [-1049.826] (-1051.294) (-1050.723) -- 0:00:46

      Average standard deviation of split frequencies: 0.012059

      310500 -- (-1050.663) (-1048.117) (-1050.947) [-1049.708] * (-1049.774) (-1050.353) (-1054.523) [-1046.720] -- 0:00:46
      311000 -- (-1053.602) [-1051.503] (-1051.459) (-1050.728) * [-1049.988] (-1050.912) (-1049.069) (-1047.811) -- 0:00:46
      311500 -- [-1049.261] (-1051.693) (-1051.194) (-1050.244) * (-1048.637) (-1048.974) [-1049.593] (-1048.941) -- 0:00:46
      312000 -- (-1048.642) [-1050.324] (-1054.192) (-1049.846) * (-1057.754) (-1048.654) [-1050.672] (-1047.690) -- 0:00:46
      312500 -- (-1049.598) (-1051.328) (-1050.100) [-1048.376] * (-1049.522) [-1049.749] (-1051.268) (-1050.613) -- 0:00:46
      313000 -- (-1053.851) [-1054.517] (-1051.594) (-1049.237) * [-1050.561] (-1049.659) (-1055.003) (-1057.147) -- 0:00:46
      313500 -- (-1050.771) (-1050.673) (-1051.651) [-1045.873] * (-1050.141) [-1049.368] (-1054.980) (-1054.454) -- 0:00:45
      314000 -- (-1050.649) (-1049.636) [-1052.183] (-1046.951) * [-1048.106] (-1050.727) (-1053.312) (-1050.233) -- 0:00:45
      314500 -- (-1048.932) (-1053.407) [-1051.640] (-1048.081) * (-1047.086) (-1050.161) (-1050.637) [-1048.737] -- 0:00:45
      315000 -- (-1049.656) [-1052.296] (-1050.526) (-1047.649) * (-1048.142) [-1049.543] (-1050.400) (-1048.042) -- 0:00:45

      Average standard deviation of split frequencies: 0.011542

      315500 -- (-1048.531) (-1053.808) [-1045.891] (-1050.742) * (-1048.585) (-1050.398) (-1048.191) [-1047.459] -- 0:00:45
      316000 -- (-1050.984) [-1052.072] (-1047.389) (-1046.072) * (-1049.811) [-1051.711] (-1049.488) (-1049.015) -- 0:00:45
      316500 -- (-1047.783) (-1050.282) (-1050.969) [-1047.984] * (-1049.334) [-1047.850] (-1050.544) (-1048.789) -- 0:00:45
      317000 -- (-1052.409) [-1049.480] (-1050.722) (-1049.724) * (-1049.082) [-1046.625] (-1051.838) (-1049.363) -- 0:00:45
      317500 -- [-1051.247] (-1048.734) (-1049.126) (-1050.838) * (-1049.226) [-1048.182] (-1049.110) (-1049.124) -- 0:00:45
      318000 -- [-1049.471] (-1048.897) (-1056.935) (-1050.861) * [-1049.063] (-1047.840) (-1048.876) (-1052.845) -- 0:00:45
      318500 -- [-1048.977] (-1049.283) (-1049.057) (-1049.979) * [-1049.543] (-1048.174) (-1050.132) (-1048.436) -- 0:00:44
      319000 -- (-1052.751) (-1051.238) [-1048.976] (-1050.123) * (-1051.777) (-1050.102) (-1048.702) [-1048.483] -- 0:00:44
      319500 -- (-1050.187) (-1050.283) [-1052.165] (-1048.974) * (-1050.049) [-1049.402] (-1048.897) (-1049.597) -- 0:00:44
      320000 -- (-1049.695) (-1049.056) [-1047.753] (-1049.532) * (-1046.568) [-1048.947] (-1050.513) (-1050.417) -- 0:00:44

      Average standard deviation of split frequencies: 0.010832

      320500 -- (-1048.867) (-1048.861) (-1047.673) [-1047.879] * (-1050.002) [-1047.809] (-1050.680) (-1048.392) -- 0:00:46
      321000 -- (-1050.602) [-1050.332] (-1052.107) (-1048.519) * [-1049.070] (-1050.492) (-1047.445) (-1051.415) -- 0:00:46
      321500 -- (-1051.631) (-1055.915) (-1051.127) [-1048.028] * (-1048.726) (-1047.641) (-1048.969) [-1048.284] -- 0:00:46
      322000 -- (-1049.592) (-1050.947) (-1050.552) [-1048.925] * (-1051.133) (-1053.645) (-1049.200) [-1047.780] -- 0:00:46
      322500 -- (-1048.845) (-1050.322) [-1049.495] (-1050.892) * (-1046.516) (-1049.369) [-1048.784] (-1053.457) -- 0:00:46
      323000 -- (-1050.727) [-1049.769] (-1050.427) (-1049.508) * [-1048.250] (-1048.941) (-1050.841) (-1054.038) -- 0:00:46
      323500 -- (-1049.468) (-1048.964) (-1048.109) [-1052.618] * (-1047.807) (-1049.640) (-1050.390) [-1054.870] -- 0:00:46
      324000 -- (-1050.475) [-1050.677] (-1046.785) (-1053.765) * (-1049.756) (-1049.384) (-1051.603) [-1050.977] -- 0:00:45
      324500 -- (-1048.891) (-1049.795) (-1049.032) [-1049.889] * (-1050.168) (-1048.706) [-1049.140] (-1048.175) -- 0:00:45
      325000 -- (-1049.742) (-1049.493) (-1049.184) [-1049.932] * (-1050.740) (-1050.479) [-1045.786] (-1048.627) -- 0:00:45

      Average standard deviation of split frequencies: 0.010503

      325500 -- (-1049.006) (-1050.192) (-1050.374) [-1049.328] * (-1050.538) (-1048.933) [-1050.049] (-1051.748) -- 0:00:45
      326000 -- (-1048.909) (-1048.851) [-1053.545] (-1049.061) * [-1049.119] (-1049.942) (-1050.275) (-1047.362) -- 0:00:45
      326500 -- (-1048.674) (-1048.680) (-1060.928) [-1048.987] * (-1049.144) [-1052.368] (-1046.276) (-1048.319) -- 0:00:45
      327000 -- (-1048.390) [-1051.059] (-1048.573) (-1048.863) * [-1048.229] (-1052.030) (-1046.869) (-1046.910) -- 0:00:45
      327500 -- [-1049.114] (-1054.250) (-1048.397) (-1051.430) * [-1050.098] (-1054.069) (-1054.841) (-1051.386) -- 0:00:45
      328000 -- (-1050.251) [-1053.048] (-1050.335) (-1053.162) * (-1049.160) (-1049.629) (-1053.171) [-1047.785] -- 0:00:45
      328500 -- [-1051.299] (-1054.169) (-1048.911) (-1052.007) * (-1051.467) (-1050.071) (-1048.401) [-1049.731] -- 0:00:44
      329000 -- (-1049.937) (-1050.310) [-1049.841] (-1049.949) * [-1050.824] (-1051.758) (-1049.195) (-1049.798) -- 0:00:44
      329500 -- [-1046.454] (-1049.085) (-1048.653) (-1046.885) * [-1049.471] (-1053.400) (-1051.095) (-1046.181) -- 0:00:44
      330000 -- (-1049.143) (-1049.413) (-1046.263) [-1050.589] * [-1049.197] (-1053.455) (-1051.061) (-1048.608) -- 0:00:44

      Average standard deviation of split frequencies: 0.010580

      330500 -- (-1051.341) (-1059.707) [-1047.239] (-1050.227) * (-1051.067) [-1052.907] (-1048.241) (-1051.381) -- 0:00:44
      331000 -- (-1049.289) [-1049.625] (-1046.727) (-1049.671) * (-1053.108) (-1050.574) [-1048.231] (-1049.615) -- 0:00:44
      331500 -- [-1050.853] (-1049.480) (-1048.602) (-1049.076) * (-1052.843) (-1050.817) [-1049.136] (-1048.106) -- 0:00:44
      332000 -- (-1055.269) [-1049.310] (-1047.175) (-1051.165) * (-1052.927) [-1050.632] (-1047.752) (-1050.809) -- 0:00:44
      332500 -- (-1051.715) [-1049.498] (-1050.900) (-1053.470) * (-1050.238) (-1049.079) [-1047.356] (-1054.877) -- 0:00:44
      333000 -- (-1054.095) [-1049.898] (-1045.564) (-1048.654) * (-1050.750) (-1048.993) (-1049.771) [-1050.881] -- 0:00:44
      333500 -- (-1052.081) (-1048.979) (-1050.637) [-1049.717] * (-1048.958) [-1048.496] (-1049.516) (-1051.148) -- 0:00:43
      334000 -- (-1050.132) (-1049.421) [-1048.399] (-1048.799) * (-1048.646) (-1049.785) [-1051.802] (-1054.678) -- 0:00:43
      334500 -- [-1047.919] (-1050.374) (-1048.864) (-1048.889) * (-1048.395) (-1050.192) (-1052.205) [-1052.228] -- 0:00:43
      335000 -- (-1048.694) [-1049.248] (-104