--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 12:30:45 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/ML2692/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1821.45 -1837.26
2 -1821.18 -1834.78
--------------------------------------
TOTAL -1821.31 -1836.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.075611 0.041517 0.728973 1.495927 1.050043 1363.84 1377.83 1.000
r(A<->C){all} 0.220573 0.004737 0.086255 0.352166 0.215889 526.49 593.26 1.000
r(A<->G){all} 0.220120 0.004843 0.086182 0.354644 0.214568 601.67 637.31 1.001
r(A<->T){all} 0.089126 0.004753 0.000048 0.223559 0.073924 290.35 391.34 1.000
r(C<->G){all} 0.073526 0.002235 0.000046 0.163571 0.066036 550.33 654.35 1.000
r(C<->T){all} 0.166220 0.005205 0.035200 0.314279 0.162064 410.67 499.30 1.001
r(G<->T){all} 0.230435 0.006408 0.092269 0.402312 0.225563 374.74 400.40 1.000
pi(A){all} 0.244420 0.000145 0.219929 0.266937 0.244614 985.66 1157.76 1.000
pi(C){all} 0.300127 0.000177 0.274417 0.326478 0.300092 1101.08 1242.17 1.000
pi(G){all} 0.286067 0.000164 0.261366 0.311366 0.285865 1186.07 1313.16 1.000
pi(T){all} 0.169386 0.000114 0.148109 0.189948 0.169017 1300.49 1400.74 1.001
alpha{1,2} 1.133128 0.283218 0.368908 2.176399 1.011069 1363.10 1432.05 1.000
alpha{3} 1.683434 0.486166 0.619892 3.132187 1.569391 1501.00 1501.00 1.000
pinvar{all} 0.062227 0.002937 0.000022 0.169056 0.047610 1386.11 1425.45 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -524.950819
Model 2: PositiveSelection -519.58982
Model 0: one-ratio -531.723646
Model 7: beta -526.167226
Model 8: beta&w>1 -519.592554
Model 0 vs 1 13.545654000000013
Model 2 vs 1 10.721997999999985
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)
Pr(w>1) post mean +- SE for w
15 E 0.519 46.045
16 V 0.986* 87.111
18 I 0.872 77.083
19 V 0.820 72.511
21 V 0.739 65.340
24 C 0.996** 87.959
25 A 0.845 74.677
27 S 0.992** 87.582
28 L 0.942 83.262
30 Q 0.999** 88.236
32 I 0.948 83.716
33 E 0.997** 88.096
34 Y 0.960* 84.843
35 Y 0.507 44.957
36 Q 0.503 44.589
39 D 0.546 48.339
41 T 0.818 72.301
42 S 0.999** 88.271
43 T 0.968* 85.494
45 P 0.766 67.721
46 G 0.637 56.385
47 L 0.988* 87.237
48 M 0.521 46.145
49 H 0.998** 88.149
50 V 0.994** 87.774
52 F 0.569 50.423
53 G 0.984* 86.898
54 P 0.877 77.476
55 Y 0.539 47.786
56 V 0.841 74.368
59 F 0.993** 87.670
60 D 0.843 74.545
61 V 0.799 70.623
62 D 0.994** 87.788
64 K 0.997** 88.094
65 K 0.918 81.142
66 V 0.997** 88.026
67 G 0.966* 85.337
68 V 0.991** 87.536
70 L 0.976* 86.248
71 S 0.818 72.343
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)
Pr(w>1) post mean +- SE for w
16 V 0.924 9.027 +- 2.542
18 I 0.726 7.243 +- 4.087
19 V 0.719 7.198 +- 4.074
21 V 0.622 6.301 +- 4.440
24 C 0.973* 9.451 +- 1.772
25 A 0.744 7.420 +- 3.961
27 S 0.952* 9.267 +- 2.150
28 L 0.817 8.065 +- 3.583
30 Q 0.988* 9.585 +- 1.420
32 I 0.848 8.348 +- 3.333
33 E 0.977* 9.487 +- 1.686
34 Y 0.869 8.537 +- 3.137
35 Y 0.519 5.369 +- 4.533
41 T 0.664 6.683 +- 4.326
42 S 0.992** 9.623 +- 1.303
43 T 0.907 8.873 +- 2.758
45 P 0.576 5.888 +- 4.489
46 G 0.739 7.356 +- 4.015
47 L 0.920 8.989 +- 2.594
49 H 0.981* 9.529 +- 1.579
50 V 0.959* 9.330 +- 2.031
52 F 0.579 5.910 +- 4.495
53 G 0.922 9.006 +- 2.566
54 P 0.759 7.539 +- 3.944
55 Y 0.538 5.535 +- 4.535
56 V 0.750 7.468 +- 3.935
59 F 0.950 9.253 +- 2.175
60 D 0.728 7.266 +- 4.069
61 V 0.662 6.666 +- 4.331
62 D 0.956* 9.308 +- 2.068
64 K 0.977* 9.491 +- 1.673
65 K 0.869 8.528 +- 3.145
66 V 0.976* 9.480 +- 1.704
67 G 0.869 8.534 +- 3.138
68 V 0.948 9.234 +- 2.208
70 L 0.904 8.849 +- 2.779
71 S 0.688 6.896 +- 4.235
Model 8 vs 7 13.149344000000156
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)
Pr(w>1) post mean +- SE for w
15 E 0.520 46.146
16 V 0.986* 87.225
18 I 0.872 77.193
19 V 0.818 72.464
21 V 0.739 65.464
24 C 0.996** 88.083
25 A 0.843 74.638
27 S 0.991** 87.700
28 L 0.942 83.390
30 Q 0.999** 88.363
32 I 0.947 83.830
33 E 0.997** 88.222
34 Y 0.960* 84.936
35 Y 0.507 45.031
36 Q 0.503 44.654
39 D 0.546 48.463
41 T 0.818 72.419
42 S 0.999** 88.399
43 T 0.968* 85.613
45 P 0.765 67.787
46 G 0.637 56.427
47 L 0.987* 87.351
48 M 0.521 46.261
49 H 0.998** 88.276
50 V 0.994** 87.895
52 F 0.569 50.513
53 G 0.983* 87.002
54 P 0.877 77.614
55 Y 0.540 47.878
56 V 0.840 74.322
59 F 0.992** 87.790
60 D 0.843 74.639
61 V 0.799 70.743
62 D 0.994** 87.903
64 K 0.997** 88.218
65 K 0.918 81.226
66 V 0.997** 88.151
67 G 0.966* 85.423
68 V 0.991** 87.654
70 L 0.976* 86.351
71 S 0.818 72.446
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)
Pr(w>1) post mean +- SE for w
15 E 0.548 5.559 +- 4.591
16 V 0.956* 9.287 +- 2.114
18 I 0.797 7.848 +- 3.761
19 V 0.807 7.938 +- 3.669
21 V 0.697 6.932 +- 4.275
24 C 0.985* 9.551 +- 1.505
25 A 0.828 8.131 +- 3.518
27 S 0.973* 9.441 +- 1.787
28 L 0.871 8.520 +- 3.192
30 Q 0.994** 9.630 +- 1.256
32 I 0.899 8.775 +- 2.896
33 E 0.988* 9.572 +- 1.444
34 Y 0.919 8.956 +- 2.649
35 Y 0.611 6.132 +- 4.496
36 Q 0.588 5.929 +- 4.530
39 D 0.570 5.757 +- 4.582
41 T 0.739 7.314 +- 4.095
42 S 0.996** 9.648 +- 1.192
43 T 0.941 9.156 +- 2.350
45 P 0.666 6.645 +- 4.358
46 G 0.812 7.978 +- 3.654
47 L 0.953* 9.266 +- 2.150
48 M 0.505 5.174 +- 4.619
49 H 0.990** 9.597 +- 1.368
50 V 0.977* 9.478 +- 1.699
52 F 0.664 6.620 +- 4.373
53 G 0.956* 9.287 +- 2.108
54 P 0.820 8.057 +- 3.616
55 Y 0.625 6.260 +- 4.475
56 V 0.833 8.172 +- 3.484
59 F 0.972* 9.434 +- 1.803
60 D 0.802 7.889 +- 3.727
61 V 0.737 7.293 +- 4.105
62 D 0.977* 9.480 +- 1.691
63 A 0.548 5.549 +- 4.593
64 K 0.989* 9.582 +- 1.413
65 K 0.917 8.930 +- 2.685
66 V 0.987* 9.568 +- 1.456
67 G 0.919 8.955 +- 2.649
68 V 0.971* 9.422 +- 1.832
70 L 0.944 9.180 +- 2.302
71 S 0.765 7.549 +- 3.952
>C1
MSEHNPAGAPGASTEVRVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLM
HVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTN
VVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGS
EEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKS
QVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKI
SKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPL
NLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQ
QLPDEIARAQLEEFIIDTK
>C2
MSEHNPAGAPGASTEVRVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLM
HVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTN
VVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGS
EEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKS
QVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKI
SKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPL
NLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQ
QLPDEIARAQLEEFIIDTK
>C3
MSEHNPAGAPGASTEVRVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLM
HVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTN
VVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGS
EEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKS
QVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKI
SKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPL
NLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQ
QLPDEIARAQLEEFIIDTK
>C4
MSEHNPAGAPGASTEVRVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLM
HVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTN
VVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGS
EEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKS
QVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKI
SKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPL
NLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQ
QLPDEIARAQLEEFIIDTK
>C5
MSEHNPAGAPGASTDSAFTGNPERPRSASDVMSEIVTGLSEFSLLSKNAE
QDASNVSAAITQRVNADTAAGGIRTRRWNQNIAooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooo
>C6
MSEHNPAGAPGASTEVRVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLM
HVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTN
VVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGS
EEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKS
QVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKI
SKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPL
NLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQ
QLPDEIARAQLEEFIIDTK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=381
C1 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
C2 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
C3 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
C4 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
C5 MSEHNPAGAPGASTD--SAFTGNPERPRSASDVMSEIVTGLSEFSLLSKN
C6 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
**************: *:.* ..: *.:* *:. : :*
C1 AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
C2 AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
C3 AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
C4 AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
C5 AEQDASNVSAAITQRVNAD-------TAAGGIRTRRWNQNIAoooooooo
C6 AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
*: *:*.*.. : *... .** .: ::: . :::
C1 NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
C2 NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
C3 NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
C4 NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
C5 oooooooooooooooooooooooooooooooooooooooooooooooooo
C6 NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
C1 TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
C2 TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
C3 TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
C4 TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
C5 oooooooooooooooooooooooooooooooooooooooooooooooooo
C6 TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
C1 ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
C2 ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
C3 ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
C4 ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
C5 oooooooooooooooooooooooooooooooooooooooooooooooooo
C6 ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
C1 MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
C2 MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
C3 MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
C4 MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
C5 oooooooooooooooooooooooooooooooooooooooooooooooooo
C6 MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
C1 RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
C2 RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
C3 RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
C4 RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
C5 oooooooooooooooooooooooooooooooooooooooooooooooooo
C6 RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
C1 PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
C2 PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
C3 PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
C4 PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
C5 oooooooooooooooooooooooooooo---
C6 PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 369 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 369 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [22140]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [22140]--->[22138]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.528 Mb, Max= 31.156 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MSEHNPAGAPGASTEVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLMHV
C2 MSEHNPAGAPGASTEVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLMHV
C3 MSEHNPAGAPGASTEVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLMHV
C4 MSEHNPAGAPGASTEVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLMHV
C5 MSEHNPAGAPGASTDSAFTGASDVMSEIVTGLSEFKNAEDASNVSAAITQ
C6 MSEHNPAGAPGASTEVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLMHV
**************: *:.*..: *.:* *:. ::**:*:*.*.. :
C1 RFGPYVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTNVVVQRGPTL
C2 RFGPYVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTNVVVQRGPTL
C3 RFGPYVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTNVVVQRGPTL
C4 RFGPYVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTNVVVQRGPTL
C5 RVNADTAAGGIRTRRWNQNIAooooooooooooooooooooooooooooo
C6 RFGPYVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTNVVVQRGPTL
*... .** .: ::: . :::
C1 DGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGSEEADKFYAQ
C2 DGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGSEEADKFYAQ
C3 DGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGSEEADKFYAQ
C4 DGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGSEEADKFYAQ
C5 oooooooooooooooooooooooooooooooooooooooooooooooooo
C6 DGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGSEEADKFYAQ
C1 CAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKSQVGATITHR
C2 CAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKSQVGATITHR
C3 CAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKSQVGATITHR
C4 CAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKSQVGATITHR
C5 oooooooooooooooooooooooooooooooooooooooooooooooooo
C6 CAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKSQVGATITHR
C1 VMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKISKTQAVTSN
C2 VMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKISKTQAVTSN
C3 VMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKISKTQAVTSN
C4 VMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKISKTQAVTSN
C5 oooooooooooooooooooooooooooooooooooooooooooooooooo
C6 VMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKISKTQAVTSN
C1 VHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPLNLEYKLEVW
C2 VHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPLNLEYKLEVW
C3 VHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPLNLEYKLEVW
C4 VHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPLNLEYKLEVW
C5 oooooooooooooooooooooooooooooooooooooooooooooooooo
C6 VHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPLNLEYKLEVW
C1 DSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQQLPDEIARA
C2 DSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQQLPDEIARA
C3 DSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQQLPDEIARA
C4 DSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQQLPDEIARA
C5 oooooooooooooooooooooooooooooooooooooooooooooooooo
C6 DSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQQLPDEIARA
C1 QLEEFII
C2 QLEEFII
C3 QLEEFII
C4 QLEEFII
C5 ooooooo
C6 QLEEFII
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:75 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 7.56 C1 C5 7.56
TOP 4 0 7.56 C5 C1 7.56
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 7.56 C2 C5 7.56
TOP 4 1 7.56 C5 C2 7.56
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 7.56 C3 C5 7.56
TOP 4 2 7.56 C5 C3 7.56
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 7.56 C4 C5 7.56
TOP 4 3 7.56 C5 C4 7.56
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 7.56 C5 C6 7.56
TOP 5 4 7.56 C6 C5 7.56
AVG 0 C1 * 81.51
AVG 1 C2 * 81.51
AVG 2 C3 * 81.51
AVG 3 C4 * 81.51
AVG 4 C5 * 7.56
AVG 5 C6 * 81.51
TOT TOT * 69.19
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
C2 ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
C3 ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
C4 ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
C5 ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAT-----
C6 ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
********************************************
C1 AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
C2 AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
C3 AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
C4 AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
C5 -TCCGCATTCACCGGCAACCCTGAGCGCCCGAGGAGCGCCAGCGACGTGA
C6 AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
.**.:* . **** * .**.** .
C1 CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
C2 CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
C3 CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
C4 CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
C5 TGTCAGAAATCGTGACCGGCCTGTCTGAGTTCTCACTGTTATCCAAGAAT
C6 CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
***. ...*.** ...** .* . * *:* .****
C1 GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
C2 GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
C3 GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
C4 GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
C5 GCTGAGCAAGACGCCAGTAATGTATCTGCTGCCATCACACAACGAGTCAA
C6 GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
***** ***.*.: *.:**. * * * ** ... :.**. **..
C1 ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
C2 ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
C3 ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
C4 ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
C5 CGCGGAC---------------------ACGGCCGCCGGTGGAATCAGAA
C6 ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
. * ** . *** *** *...*.....
C1 CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
C2 CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
C3 CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
C4 CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
C5 CCCGCCGGTGGAATCAGAACATTGCA------------------------
C6 CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
**.. ..* .. :..**:* *.
C1 AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
C2 AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
C3 AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
C4 AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
C5 --------------------------------------------------
C6 AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
C1 CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
C2 CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
C3 CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
C4 CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
C5 --------------------------------------------------
C6 CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
C1 TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
C2 TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
C3 TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
C4 TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
C5 --------------------------------------------------
C6 TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
C1 ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
C2 ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
C3 ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
C4 ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
C5 --------------------------------------------------
C6 ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
C1 GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
C2 GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
C3 GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
C4 GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
C5 --------------------------------------------------
C6 GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
C1 TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
C2 TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
C3 TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
C4 TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
C5 --------------------------------------------------
C6 TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
C1 GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
C2 GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
C3 GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
C4 GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
C5 --------------------------------------------------
C6 GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
C1 CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
C2 CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
C3 CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
C4 CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
C5 --------------------------------------------------
C6 CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
C1 TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
C2 TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
C3 TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
C4 TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
C5 --------------------------------------------------
C6 TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
C1 ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
C2 ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
C3 ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
C4 ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
C5 --------------------------------------------------
C6 ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
C1 CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
C2 CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
C3 CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
C4 CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
C5 --------------------------------------------------
C6 CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
C1 GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
C2 GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
C3 GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
C4 GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
C5 --------------------------------------------------
C6 GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
C1 CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
C2 CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
C3 CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
C4 CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
C5 --------------------------------------------------
C6 CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
C1 GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
C2 GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
C3 GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
C4 GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
C5 --------------------------------------------------
C6 GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
C1 TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
C2 TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
C3 TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
C4 TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
C5 --------------------------------------------------
C6 TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
C1 CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
C2 CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
C3 CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
C4 CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
C5 --------------------------------------------------
C6 CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
C1 GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
C2 GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
C3 GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
C4 GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
C5 -------------------------------------------
C6 GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
>C1
ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
>C2
ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
>C3
ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
>C4
ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
>C5
ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAT-----
-TCCGCATTCACCGGCAACCCTGAGCGCCCGAGGAGCGCCAGCGACGTGA
TGTCAGAAATCGTGACCGGCCTGTCTGAGTTCTCACTGTTATCCAAGAAT
GCTGAGCAAGACGCCAGTAATGTATCTGCTGCCATCACACAACGAGTCAA
CGCGGAC---------------------ACGGCCGCCGGTGGAATCAGAA
CCCGCCGGTGGAATCAGAACATTGCA------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
-------------------------------------------
>C6
ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
>C1
MSEHNPAGAPGASTEVRVAIVGoooooooVGNCASSLVQGIEYYooooQN
ADoDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
>C2
MSEHNPAGAPGASTEVRVAIVGoooooooVGNCASSLVQGIEYYooooQN
ADoDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
>C3
MSEHNPAGAPGASTEVRVAIVGoooooooVGNCASSLVQGIEYYooooQN
ADoDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
>C4
MSEHNPAGAPGASTEVRVAIVGoooooooVGNCASSLVQGIEYYooooQN
ADoDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
>C5
MSEHNPAGAPGASTDooSAFTGNPERPRSASDVMSEIVTGLSEFSLLSKN
AEQDASNVSAAITQRVNADoooooooTAAGGIRTRRWNQNIAoooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooo
>C6
MSEHNPAGAPGASTEVRVAIVGoooooooVGNCASSLVQGIEYYooooQN
ADoDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 1143 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579782469
Setting output file names to "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1908736119
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9748799519
Seed = 1630401915
Swapseed = 1579782469
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 23 unique site patterns
Division 2 has 24 unique site patterns
Division 3 has 23 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2789.445281 -- -24.965149
Chain 2 -- -2789.445281 -- -24.965149
Chain 3 -- -2789.445344 -- -24.965149
Chain 4 -- -2789.445344 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2789.445243 -- -24.965149
Chain 2 -- -2789.433124 -- -24.965149
Chain 3 -- -2789.161589 -- -24.965149
Chain 4 -- -2789.161589 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2789.445] (-2789.445) (-2789.445) (-2789.445) * [-2789.445] (-2789.433) (-2789.162) (-2789.162)
500 -- (-1868.917) (-1866.705) (-1861.510) [-1830.914] * [-1836.108] (-1842.719) (-1847.209) (-1837.484) -- 0:00:00
1000 -- (-1841.211) [-1825.951] (-1832.096) (-1832.487) * (-1824.576) [-1830.594] (-1829.551) (-1829.814) -- 0:00:00
1500 -- (-1830.373) (-1828.537) [-1832.029] (-1824.847) * (-1828.639) [-1823.934] (-1833.378) (-1828.061) -- 0:00:00
2000 -- (-1822.152) [-1825.393] (-1827.161) (-1830.961) * (-1822.370) (-1831.503) [-1828.747] (-1838.236) -- 0:00:00
2500 -- (-1823.232) [-1835.286] (-1839.098) (-1827.872) * (-1824.569) (-1824.646) (-1827.527) [-1830.458] -- 0:00:00
3000 -- (-1822.741) (-1827.722) [-1826.994] (-1824.331) * (-1829.938) [-1828.440] (-1825.129) (-1829.269) -- 0:00:00
3500 -- (-1829.929) (-1834.604) (-1832.920) [-1823.958] * [-1828.630] (-1834.582) (-1827.685) (-1829.725) -- 0:00:00
4000 -- [-1824.858] (-1826.322) (-1819.475) (-1819.537) * (-1829.340) (-1831.101) [-1825.002] (-1831.756) -- 0:00:00
4500 -- (-1826.871) (-1829.130) [-1821.238] (-1829.383) * (-1832.099) (-1831.284) [-1829.010] (-1837.144) -- 0:00:00
5000 -- (-1830.343) (-1824.683) [-1822.890] (-1823.776) * (-1827.815) (-1824.648) (-1830.204) [-1829.976] -- 0:00:00
Average standard deviation of split frequencies: 0.114280
5500 -- (-1819.124) [-1821.574] (-1828.662) (-1830.579) * (-1825.093) (-1822.210) [-1830.676] (-1826.956) -- 0:00:00
6000 -- [-1826.918] (-1823.664) (-1823.322) (-1827.975) * (-1824.855) (-1825.622) (-1830.628) [-1824.194] -- 0:00:00
6500 -- (-1824.981) (-1828.558) [-1826.531] (-1830.483) * [-1828.241] (-1827.993) (-1822.667) (-1832.831) -- 0:02:32
7000 -- (-1836.001) [-1817.984] (-1825.876) (-1826.735) * (-1838.721) (-1820.199) (-1821.791) [-1826.571] -- 0:02:21
7500 -- (-1831.432) [-1822.928] (-1830.278) (-1834.656) * (-1837.129) (-1829.217) (-1822.764) [-1825.862] -- 0:02:12
8000 -- (-1838.737) (-1824.907) [-1825.895] (-1829.304) * (-1824.742) (-1837.006) [-1823.628] (-1830.814) -- 0:02:04
8500 -- (-1820.628) (-1831.546) [-1828.545] (-1824.955) * [-1823.785] (-1826.761) (-1822.702) (-1828.615) -- 0:01:56
9000 -- [-1828.428] (-1831.422) (-1830.160) (-1832.692) * (-1826.213) (-1827.946) (-1825.264) [-1825.965] -- 0:01:50
9500 -- (-1827.710) [-1818.494] (-1824.641) (-1831.335) * (-1837.274) (-1833.156) [-1822.113] (-1829.558) -- 0:01:44
10000 -- (-1837.188) [-1822.175] (-1826.214) (-1831.824) * [-1827.645] (-1830.390) (-1826.721) (-1831.881) -- 0:01:39
Average standard deviation of split frequencies: 0.082075
10500 -- (-1825.972) [-1831.545] (-1823.184) (-1834.725) * (-1833.505) [-1823.014] (-1831.966) (-1838.365) -- 0:01:34
11000 -- (-1840.619) (-1827.422) [-1835.190] (-1831.754) * (-1837.487) (-1823.379) (-1825.858) [-1824.929] -- 0:01:29
11500 -- (-1832.751) [-1827.538] (-1823.632) (-1828.796) * (-1825.135) [-1821.677] (-1823.720) (-1819.281) -- 0:01:25
12000 -- (-1824.747) (-1827.627) [-1830.501] (-1828.307) * (-1832.883) (-1821.100) (-1826.457) [-1821.591] -- 0:01:22
12500 -- (-1834.875) (-1829.980) (-1831.000) [-1837.589] * (-1822.998) (-1822.426) [-1823.127] (-1820.942) -- 0:01:19
13000 -- (-1826.538) [-1826.025] (-1829.427) (-1824.443) * (-1824.408) (-1825.281) [-1830.948] (-1825.982) -- 0:01:15
13500 -- [-1828.137] (-1831.066) (-1827.144) (-1827.112) * [-1829.976] (-1826.002) (-1828.670) (-1827.177) -- 0:01:13
14000 -- (-1827.368) [-1824.903] (-1824.960) (-1836.745) * (-1824.200) [-1823.662] (-1832.671) (-1823.751) -- 0:02:20
14500 -- (-1826.243) (-1824.099) [-1823.117] (-1832.804) * (-1827.254) (-1828.014) (-1830.807) [-1826.827] -- 0:02:15
15000 -- (-1831.577) (-1825.737) [-1824.700] (-1828.577) * (-1829.472) (-1821.834) [-1819.886] (-1823.494) -- 0:02:11
Average standard deviation of split frequencies: 0.057452
15500 -- (-1823.667) [-1823.803] (-1831.144) (-1832.324) * (-1834.445) (-1832.255) [-1821.486] (-1821.618) -- 0:02:07
16000 -- (-1829.037) (-1833.575) (-1831.334) [-1830.210] * (-1824.793) (-1832.356) [-1821.847] (-1823.386) -- 0:02:03
16500 -- (-1829.811) [-1819.710] (-1820.140) (-1829.600) * (-1830.332) [-1830.390] (-1831.524) (-1820.871) -- 0:01:59
17000 -- (-1826.902) [-1823.414] (-1824.409) (-1829.047) * (-1826.120) [-1823.069] (-1821.005) (-1821.809) -- 0:01:55
17500 -- (-1826.517) (-1831.103) [-1822.388] (-1829.150) * (-1824.575) [-1837.445] (-1825.658) (-1829.514) -- 0:01:52
18000 -- (-1832.394) [-1828.366] (-1824.010) (-1832.010) * (-1825.484) (-1822.309) (-1823.645) [-1829.545] -- 0:01:49
18500 -- (-1830.109) [-1823.305] (-1829.454) (-1833.618) * (-1825.121) (-1829.810) (-1829.896) [-1820.848] -- 0:01:46
19000 -- [-1821.575] (-1830.034) (-1831.025) (-1831.468) * (-1827.943) (-1834.801) (-1824.527) [-1833.062] -- 0:01:43
19500 -- (-1823.352) (-1827.495) (-1823.436) [-1823.779] * [-1829.952] (-1826.606) (-1828.384) (-1828.743) -- 0:01:40
20000 -- (-1829.845) (-1824.397) [-1831.097] (-1822.842) * (-1826.140) (-1827.275) (-1830.117) [-1829.679] -- 0:01:38
Average standard deviation of split frequencies: 0.053223
20500 -- (-1823.549) (-1823.222) (-1831.800) [-1826.797] * (-1830.175) (-1832.241) [-1828.095] (-1822.150) -- 0:01:35
21000 -- (-1828.127) [-1827.662] (-1827.237) (-1841.849) * (-1830.066) [-1823.949] (-1831.670) (-1827.280) -- 0:01:33
21500 -- (-1821.758) (-1825.670) [-1822.357] (-1825.833) * (-1836.255) (-1828.013) [-1828.517] (-1834.315) -- 0:02:16
22000 -- (-1824.409) (-1828.389) [-1819.360] (-1829.824) * (-1827.445) [-1831.651] (-1826.508) (-1823.532) -- 0:02:13
22500 -- (-1827.596) [-1831.214] (-1824.590) (-1837.349) * (-1829.898) (-1835.432) (-1833.786) [-1821.439] -- 0:02:10
23000 -- (-1826.216) [-1824.191] (-1827.364) (-1829.086) * (-1827.454) (-1826.906) (-1830.667) [-1822.188] -- 0:02:07
23500 -- (-1831.199) (-1826.542) [-1824.989] (-1827.353) * (-1824.776) (-1820.471) (-1823.511) [-1816.139] -- 0:02:04
24000 -- (-1825.735) (-1837.524) [-1822.610] (-1835.211) * (-1824.463) (-1823.626) [-1827.434] (-1824.649) -- 0:02:02
24500 -- [-1831.521] (-1829.113) (-1836.489) (-1827.933) * (-1822.612) (-1825.850) (-1821.551) [-1826.434] -- 0:01:59
25000 -- (-1826.272) (-1834.558) [-1827.706] (-1829.946) * (-1831.020) (-1822.326) [-1828.282] (-1831.266) -- 0:01:57
Average standard deviation of split frequencies: 0.046510
25500 -- [-1824.424] (-1831.136) (-1835.011) (-1829.850) * (-1831.440) (-1826.601) (-1825.748) [-1826.163] -- 0:01:54
26000 -- (-1824.846) [-1825.238] (-1828.633) (-1828.927) * (-1826.481) [-1821.663] (-1824.468) (-1825.654) -- 0:01:52
26500 -- [-1827.507] (-1832.323) (-1825.143) (-1827.399) * (-1829.381) [-1832.642] (-1828.946) (-1821.174) -- 0:01:50
27000 -- (-1827.843) (-1829.577) (-1821.192) [-1823.867] * (-1825.780) (-1830.952) [-1821.892] (-1841.893) -- 0:01:48
27500 -- (-1828.277) (-1826.930) [-1818.157] (-1828.433) * (-1822.598) [-1822.628] (-1830.075) (-1829.532) -- 0:01:46
28000 -- (-1827.925) [-1834.736] (-1825.291) (-1824.050) * (-1823.217) (-1826.461) (-1825.991) [-1832.858] -- 0:01:44
28500 -- [-1830.840] (-1826.547) (-1837.309) (-1823.717) * (-1830.295) [-1820.007] (-1825.499) (-1836.065) -- 0:01:42
29000 -- (-1824.100) (-1832.009) (-1829.074) [-1822.495] * (-1825.557) (-1826.924) [-1826.135] (-1836.174) -- 0:02:13
29500 -- (-1825.239) (-1827.078) (-1830.593) [-1821.504] * (-1819.861) [-1820.389] (-1827.628) (-1821.820) -- 0:02:11
30000 -- (-1828.470) (-1828.305) [-1822.459] (-1825.764) * [-1823.135] (-1826.146) (-1832.127) (-1831.228) -- 0:02:09
Average standard deviation of split frequencies: 0.053802
30500 -- (-1822.680) (-1834.039) (-1827.569) [-1825.819] * (-1824.843) [-1827.188] (-1825.532) (-1832.560) -- 0:02:07
31000 -- (-1832.547) (-1829.341) [-1825.715] (-1822.998) * (-1831.628) (-1831.865) [-1826.020] (-1828.981) -- 0:02:05
31500 -- (-1826.375) (-1824.155) [-1828.022] (-1822.526) * (-1823.486) [-1820.653] (-1828.156) (-1828.953) -- 0:02:02
32000 -- (-1828.782) (-1824.271) [-1829.391] (-1820.237) * (-1825.174) (-1827.911) [-1826.972] (-1830.162) -- 0:02:01
32500 -- (-1823.800) (-1828.944) (-1828.735) [-1830.151] * [-1827.957] (-1826.900) (-1829.263) (-1824.191) -- 0:01:59
33000 -- (-1828.690) (-1835.992) (-1833.673) [-1825.600] * (-1826.224) [-1827.099] (-1823.109) (-1820.343) -- 0:01:57
33500 -- [-1828.395] (-1835.814) (-1824.919) (-1824.866) * [-1827.258] (-1830.611) (-1817.561) (-1829.938) -- 0:01:55
34000 -- [-1830.082] (-1827.729) (-1829.213) (-1836.739) * (-1821.567) (-1827.772) [-1820.848] (-1832.012) -- 0:01:53
34500 -- (-1827.480) (-1841.515) [-1826.826] (-1829.694) * (-1820.634) [-1819.861] (-1820.312) (-1829.921) -- 0:01:51
35000 -- (-1829.592) [-1826.340] (-1829.085) (-1833.631) * [-1821.014] (-1825.325) (-1826.458) (-1834.340) -- 0:01:50
Average standard deviation of split frequencies: 0.045236
35500 -- (-1820.941) [-1827.020] (-1831.597) (-1837.147) * (-1822.147) [-1823.084] (-1823.947) (-1828.748) -- 0:01:48
36000 -- (-1835.724) [-1827.469] (-1828.108) (-1822.311) * (-1836.557) [-1823.136] (-1823.464) (-1827.920) -- 0:01:47
36500 -- (-1828.242) (-1832.578) [-1822.798] (-1831.905) * (-1823.709) (-1830.482) [-1828.720] (-1829.875) -- 0:02:11
37000 -- (-1824.814) (-1829.208) [-1819.299] (-1834.471) * (-1833.760) (-1829.480) [-1825.703] (-1831.886) -- 0:02:10
37500 -- (-1835.280) [-1826.550] (-1827.920) (-1828.659) * (-1831.414) (-1821.171) [-1822.013] (-1830.081) -- 0:02:08
38000 -- (-1829.214) (-1831.927) [-1820.342] (-1828.316) * (-1833.072) (-1825.389) (-1825.367) [-1820.452] -- 0:02:06
38500 -- (-1828.749) (-1842.938) (-1832.292) [-1826.836] * (-1836.714) (-1830.219) (-1835.663) [-1824.375] -- 0:02:04
39000 -- (-1825.856) (-1828.506) (-1833.411) [-1835.855] * (-1831.057) (-1824.944) (-1831.710) [-1820.688] -- 0:02:03
39500 -- [-1823.342] (-1839.117) (-1826.453) (-1823.576) * (-1827.036) (-1820.634) [-1824.135] (-1825.423) -- 0:02:01
40000 -- [-1836.989] (-1834.212) (-1826.650) (-1822.879) * (-1828.651) [-1820.494] (-1822.393) (-1822.708) -- 0:02:00
Average standard deviation of split frequencies: 0.043056
40500 -- (-1819.598) (-1839.675) (-1828.989) [-1820.213] * (-1830.193) (-1828.788) [-1826.441] (-1829.849) -- 0:01:58
41000 -- [-1830.196] (-1839.172) (-1830.207) (-1835.884) * (-1836.072) [-1822.960] (-1824.972) (-1830.594) -- 0:01:56
41500 -- (-1826.547) (-1833.377) [-1823.229] (-1827.340) * (-1837.509) (-1821.582) [-1822.169] (-1825.437) -- 0:01:55
42000 -- (-1821.834) [-1832.971] (-1821.909) (-1827.581) * (-1834.463) (-1820.704) (-1822.604) [-1828.485] -- 0:01:54
42500 -- [-1824.878] (-1822.606) (-1825.826) (-1829.697) * (-1824.876) [-1821.787] (-1831.212) (-1823.234) -- 0:01:52
43000 -- (-1822.441) (-1824.309) [-1826.373] (-1830.309) * (-1822.311) [-1823.058] (-1827.476) (-1824.175) -- 0:01:51
43500 -- (-1823.530) (-1829.412) [-1823.272] (-1822.037) * (-1830.567) (-1822.379) (-1836.039) [-1826.735] -- 0:01:49
44000 -- (-1823.272) (-1831.788) [-1829.973] (-1824.276) * (-1827.695) (-1825.644) (-1829.289) [-1824.974] -- 0:02:10
44500 -- (-1826.962) (-1833.228) (-1822.750) [-1823.719] * (-1825.201) (-1829.982) (-1831.584) [-1821.046] -- 0:02:08
45000 -- (-1824.521) (-1828.972) [-1827.184] (-1826.277) * (-1824.079) (-1832.718) [-1829.395] (-1824.925) -- 0:02:07
Average standard deviation of split frequencies: 0.040992
45500 -- (-1826.200) [-1823.464] (-1824.759) (-1821.653) * [-1825.170] (-1829.850) (-1828.011) (-1843.224) -- 0:02:05
46000 -- (-1824.893) (-1827.491) (-1821.181) [-1825.083] * (-1824.372) (-1824.227) (-1829.308) [-1823.664] -- 0:02:04
46500 -- (-1842.740) (-1820.463) [-1823.001] (-1823.867) * (-1834.223) (-1831.494) (-1829.407) [-1825.059] -- 0:02:03
47000 -- (-1823.482) (-1818.182) [-1825.035] (-1827.390) * (-1827.030) (-1830.272) (-1828.745) [-1824.021] -- 0:02:01
47500 -- (-1833.397) (-1825.652) [-1827.166] (-1826.685) * (-1833.249) (-1831.976) [-1822.331] (-1834.081) -- 0:02:00
48000 -- [-1823.693] (-1824.176) (-1828.085) (-1821.332) * (-1830.725) (-1829.653) (-1829.036) [-1826.979] -- 0:01:59
48500 -- [-1818.290] (-1827.480) (-1825.697) (-1836.795) * (-1823.232) [-1821.997] (-1826.508) (-1823.616) -- 0:01:57
49000 -- (-1833.699) [-1822.908] (-1824.934) (-1823.315) * [-1824.099] (-1831.636) (-1823.022) (-1828.858) -- 0:01:56
49500 -- (-1836.968) (-1828.894) (-1825.283) [-1822.527] * (-1832.686) (-1825.470) [-1828.164] (-1831.328) -- 0:01:55
50000 -- [-1830.795] (-1823.348) (-1826.059) (-1824.780) * [-1831.248] (-1826.274) (-1829.190) (-1823.043) -- 0:01:54
Average standard deviation of split frequencies: 0.036812
50500 -- [-1828.352] (-1829.559) (-1826.170) (-1835.362) * (-1821.006) [-1824.122] (-1834.987) (-1834.496) -- 0:01:52
51000 -- (-1827.440) [-1820.585] (-1831.004) (-1826.704) * (-1831.140) (-1831.473) [-1829.733] (-1838.507) -- 0:01:51
51500 -- [-1822.151] (-1827.173) (-1822.378) (-1824.390) * [-1826.319] (-1828.081) (-1830.438) (-1822.958) -- 0:02:08
52000 -- [-1828.429] (-1821.191) (-1826.819) (-1834.420) * (-1824.702) (-1828.259) (-1826.827) [-1824.972] -- 0:02:07
52500 -- (-1829.126) (-1825.657) (-1825.650) [-1827.360] * [-1830.431] (-1832.302) (-1830.681) (-1825.445) -- 0:02:06
53000 -- (-1831.927) [-1824.485] (-1827.840) (-1821.814) * (-1829.564) (-1827.089) (-1837.282) [-1826.260] -- 0:02:05
53500 -- (-1827.206) (-1823.271) (-1822.478) [-1830.614] * (-1828.213) [-1829.448] (-1831.364) (-1826.928) -- 0:02:03
54000 -- [-1831.966] (-1826.911) (-1829.636) (-1828.007) * (-1828.198) (-1828.590) [-1824.204] (-1826.342) -- 0:02:02
54500 -- (-1830.947) (-1825.440) (-1828.017) [-1826.258] * [-1828.292] (-1825.792) (-1829.789) (-1828.014) -- 0:02:01
55000 -- (-1829.126) [-1825.281] (-1831.610) (-1825.238) * (-1828.744) [-1829.183] (-1828.231) (-1836.221) -- 0:02:00
Average standard deviation of split frequencies: 0.037115
55500 -- (-1845.530) (-1834.511) (-1823.348) [-1817.827] * (-1829.935) (-1823.980) (-1834.463) [-1832.021] -- 0:01:59
56000 -- (-1827.544) (-1830.351) [-1825.535] (-1825.351) * (-1826.757) (-1825.592) [-1830.841] (-1824.537) -- 0:01:58
56500 -- [-1827.093] (-1841.181) (-1830.905) (-1828.330) * (-1823.349) [-1829.930] (-1831.897) (-1835.442) -- 0:01:56
57000 -- [-1822.111] (-1824.525) (-1829.777) (-1820.762) * (-1834.860) (-1819.394) (-1823.524) [-1825.397] -- 0:01:55
57500 -- (-1825.010) (-1824.485) [-1821.391] (-1824.218) * (-1826.591) [-1829.880] (-1840.429) (-1829.897) -- 0:01:54
58000 -- [-1827.164] (-1824.167) (-1831.422) (-1826.452) * (-1835.570) (-1829.978) (-1831.855) [-1828.009] -- 0:01:53
58500 -- [-1822.537] (-1821.822) (-1830.987) (-1831.533) * (-1819.272) [-1822.129] (-1826.582) (-1834.368) -- 0:01:52
59000 -- (-1822.603) (-1828.540) (-1845.461) [-1823.614] * (-1830.239) (-1828.827) (-1835.957) [-1830.701] -- 0:02:07
59500 -- (-1830.929) (-1821.580) (-1830.307) [-1820.122] * (-1837.031) (-1827.014) (-1828.453) [-1823.530] -- 0:02:06
60000 -- (-1824.439) (-1822.531) (-1825.769) [-1823.901] * (-1832.037) [-1819.993] (-1821.866) (-1832.164) -- 0:02:05
Average standard deviation of split frequencies: 0.034967
60500 -- (-1831.642) (-1824.134) (-1828.199) [-1822.497] * (-1824.422) (-1820.699) [-1828.008] (-1828.975) -- 0:02:04
61000 -- (-1830.007) [-1822.764] (-1842.837) (-1830.252) * [-1827.221] (-1825.337) (-1821.666) (-1831.010) -- 0:02:03
61500 -- (-1828.561) [-1823.964] (-1834.925) (-1825.897) * (-1822.130) (-1823.061) [-1826.496] (-1825.251) -- 0:02:02
62000 -- (-1832.518) (-1825.283) [-1823.040] (-1831.420) * (-1820.642) (-1825.373) (-1825.589) [-1833.087] -- 0:02:01
62500 -- (-1831.615) (-1832.250) (-1828.270) [-1830.951] * (-1823.099) (-1831.592) (-1834.511) [-1827.327] -- 0:02:00
63000 -- [-1820.860] (-1831.478) (-1830.495) (-1826.449) * (-1824.423) [-1823.011] (-1826.271) (-1830.728) -- 0:01:58
63500 -- [-1826.666] (-1824.393) (-1828.804) (-1825.345) * (-1830.534) (-1824.761) (-1832.719) [-1833.193] -- 0:01:57
64000 -- [-1821.612] (-1822.606) (-1827.779) (-1822.146) * (-1824.485) [-1824.765] (-1821.197) (-1831.009) -- 0:01:57
64500 -- (-1829.169) (-1826.113) (-1829.735) [-1829.089] * (-1829.295) (-1831.185) [-1824.603] (-1830.119) -- 0:01:56
65000 -- [-1825.496] (-1824.685) (-1827.590) (-1833.790) * (-1823.373) (-1823.932) [-1822.894] (-1827.613) -- 0:01:55
Average standard deviation of split frequencies: 0.030744
65500 -- (-1825.733) (-1827.029) [-1824.558] (-1822.057) * [-1822.890] (-1828.165) (-1821.795) (-1831.073) -- 0:01:54
66000 -- [-1824.393] (-1826.805) (-1830.118) (-1824.157) * (-1828.070) [-1828.419] (-1825.682) (-1833.185) -- 0:01:53
66500 -- [-1825.960] (-1833.878) (-1830.768) (-1828.999) * [-1828.883] (-1826.822) (-1818.683) (-1822.921) -- 0:02:06
67000 -- [-1822.460] (-1833.251) (-1825.017) (-1838.076) * (-1828.669) (-1830.149) [-1821.395] (-1829.759) -- 0:02:05
67500 -- (-1839.747) [-1827.858] (-1838.304) (-1833.365) * (-1829.614) (-1831.349) (-1823.644) [-1827.426] -- 0:02:04
68000 -- (-1819.891) [-1833.268] (-1827.425) (-1825.116) * [-1827.955] (-1836.634) (-1834.418) (-1832.068) -- 0:02:03
68500 -- (-1822.321) (-1823.744) [-1827.619] (-1823.523) * (-1821.327) [-1829.878] (-1827.028) (-1832.524) -- 0:02:02
69000 -- (-1827.033) (-1823.328) (-1830.152) [-1831.603] * (-1829.868) (-1825.638) (-1822.409) [-1824.818] -- 0:02:01
69500 -- (-1821.795) [-1833.675] (-1831.338) (-1830.502) * (-1830.795) [-1823.279] (-1826.555) (-1827.987) -- 0:02:00
70000 -- (-1829.502) [-1823.600] (-1832.665) (-1830.156) * (-1836.581) (-1821.481) [-1826.444] (-1830.704) -- 0:01:59
Average standard deviation of split frequencies: 0.023507
70500 -- (-1824.043) (-1826.177) (-1826.678) [-1829.739] * (-1827.829) (-1827.119) (-1829.802) [-1819.547] -- 0:01:58
71000 -- (-1824.462) (-1834.862) (-1822.375) [-1824.576] * (-1830.464) (-1826.380) (-1824.012) [-1820.338] -- 0:01:57
71500 -- [-1819.273] (-1824.345) (-1826.594) (-1826.029) * (-1824.901) [-1821.447] (-1829.311) (-1822.433) -- 0:01:56
72000 -- (-1823.064) (-1827.724) (-1820.281) [-1824.423] * (-1831.415) (-1827.854) (-1825.162) [-1821.449] -- 0:01:56
72500 -- (-1827.958) (-1826.691) [-1825.186] (-1826.623) * (-1832.720) [-1827.231] (-1828.179) (-1840.535) -- 0:01:55
73000 -- (-1824.953) (-1822.038) [-1830.246] (-1826.567) * [-1827.012] (-1829.772) (-1825.334) (-1833.548) -- 0:01:54
73500 -- [-1831.720] (-1829.422) (-1832.140) (-1828.331) * (-1822.852) [-1818.987] (-1828.970) (-1831.537) -- 0:01:53
74000 -- (-1824.337) (-1826.501) (-1831.681) [-1825.838] * (-1830.520) [-1822.865] (-1829.699) (-1829.896) -- 0:02:05
74500 -- (-1833.851) (-1830.752) (-1825.985) [-1828.562] * (-1831.784) (-1824.433) [-1822.252] (-1831.625) -- 0:02:04
75000 -- [-1821.200] (-1835.071) (-1837.219) (-1834.009) * (-1829.069) [-1820.770] (-1825.402) (-1828.119) -- 0:02:03
Average standard deviation of split frequencies: 0.025939
75500 -- (-1832.385) (-1821.882) [-1832.213] (-1827.536) * (-1823.998) (-1821.823) [-1828.428] (-1820.732) -- 0:02:02
76000 -- [-1827.218] (-1838.101) (-1825.531) (-1828.109) * (-1826.208) (-1829.375) (-1828.618) [-1826.549] -- 0:02:01
76500 -- [-1822.772] (-1832.938) (-1827.148) (-1828.431) * (-1839.156) [-1824.442] (-1826.034) (-1829.026) -- 0:02:00
77000 -- [-1825.892] (-1823.848) (-1832.691) (-1830.943) * (-1837.887) [-1824.072] (-1827.714) (-1828.858) -- 0:01:59
77500 -- (-1828.757) (-1828.812) [-1824.828] (-1827.788) * (-1828.065) (-1824.789) (-1829.880) [-1821.405] -- 0:01:59
78000 -- (-1831.732) [-1826.044] (-1826.313) (-1831.143) * (-1831.439) [-1824.039] (-1825.123) (-1826.698) -- 0:01:58
78500 -- (-1826.970) (-1828.896) (-1831.607) [-1823.569] * (-1828.423) (-1829.924) (-1828.347) [-1827.207] -- 0:01:57
79000 -- (-1829.705) (-1841.658) [-1824.513] (-1833.983) * [-1835.319] (-1818.769) (-1839.300) (-1826.401) -- 0:01:56
79500 -- (-1820.610) (-1829.453) [-1825.397] (-1831.615) * (-1831.559) (-1825.432) [-1825.993] (-1826.230) -- 0:01:55
80000 -- [-1822.757] (-1827.729) (-1824.574) (-1830.971) * (-1827.320) (-1825.939) [-1822.702] (-1835.046) -- 0:01:55
Average standard deviation of split frequencies: 0.022791
80500 -- (-1832.415) (-1823.468) (-1822.243) [-1828.587] * (-1823.964) (-1819.671) [-1825.360] (-1826.043) -- 0:01:54
81000 -- (-1831.046) [-1836.044] (-1825.848) (-1833.237) * (-1828.038) (-1822.876) [-1824.273] (-1827.313) -- 0:01:53
81500 -- (-1830.595) [-1826.292] (-1831.731) (-1825.046) * [-1826.655] (-1826.048) (-1823.889) (-1831.685) -- 0:02:03
82000 -- (-1826.908) (-1826.867) (-1829.698) [-1825.134] * (-1835.420) [-1820.460] (-1822.023) (-1821.315) -- 0:02:03
82500 -- (-1832.134) (-1824.578) (-1825.346) [-1824.610] * (-1821.006) (-1824.931) [-1826.067] (-1831.978) -- 0:02:02
83000 -- (-1829.678) [-1824.009] (-1823.913) (-1825.497) * (-1823.309) [-1823.241] (-1831.202) (-1825.178) -- 0:02:01
83500 -- (-1827.269) (-1824.577) [-1826.403] (-1833.552) * (-1824.068) [-1824.564] (-1820.999) (-1832.965) -- 0:02:00
84000 -- (-1831.749) [-1827.167] (-1821.793) (-1827.766) * (-1825.137) (-1823.661) [-1821.624] (-1834.761) -- 0:01:59
84500 -- (-1824.466) [-1822.054] (-1833.684) (-1831.531) * (-1825.178) (-1835.265) (-1826.105) [-1827.407] -- 0:01:59
85000 -- (-1824.521) (-1827.873) [-1822.284] (-1837.681) * [-1827.006] (-1832.114) (-1819.765) (-1825.839) -- 0:01:58
Average standard deviation of split frequencies: 0.023117
85500 -- (-1821.066) (-1827.975) (-1822.819) [-1819.234] * (-1826.281) (-1830.025) [-1818.268] (-1828.638) -- 0:01:57
86000 -- (-1824.189) (-1839.896) (-1834.817) [-1821.588] * (-1830.990) [-1826.083] (-1830.019) (-1828.765) -- 0:01:56
86500 -- (-1831.890) (-1823.884) (-1831.265) [-1824.764] * (-1823.580) (-1835.299) (-1826.203) [-1827.820] -- 0:01:56
87000 -- (-1830.110) (-1825.848) [-1830.851] (-1825.276) * (-1822.318) (-1825.541) (-1826.937) [-1831.015] -- 0:01:55
87500 -- [-1823.497] (-1823.440) (-1824.222) (-1819.965) * (-1836.522) (-1830.981) [-1820.227] (-1820.827) -- 0:01:54
88000 -- (-1826.650) (-1824.396) [-1824.791] (-1825.950) * (-1821.150) (-1823.317) [-1825.482] (-1826.985) -- 0:01:54
88500 -- [-1820.955] (-1829.756) (-1822.806) (-1824.837) * (-1836.550) (-1833.113) [-1823.217] (-1825.259) -- 0:01:53
89000 -- (-1820.954) (-1823.626) [-1823.730] (-1836.413) * (-1827.634) (-1822.713) (-1829.937) [-1830.569] -- 0:02:02
89500 -- [-1820.173] (-1823.640) (-1835.004) (-1827.666) * (-1820.594) [-1829.993] (-1825.836) (-1823.260) -- 0:02:02
90000 -- [-1831.512] (-1823.351) (-1824.670) (-1824.315) * (-1830.616) [-1828.155] (-1832.840) (-1824.516) -- 0:02:01
Average standard deviation of split frequencies: 0.020550
90500 -- (-1829.992) (-1827.513) [-1828.705] (-1826.452) * (-1821.622) [-1829.167] (-1823.322) (-1823.180) -- 0:02:00
91000 -- [-1827.182] (-1827.099) (-1822.899) (-1830.839) * (-1825.539) (-1822.626) (-1820.690) [-1822.494] -- 0:01:59
91500 -- [-1823.596] (-1826.085) (-1836.233) (-1827.982) * [-1829.056] (-1824.087) (-1831.383) (-1825.107) -- 0:01:59
92000 -- (-1829.293) (-1823.434) [-1827.201] (-1831.998) * (-1832.263) (-1828.866) [-1816.938] (-1836.337) -- 0:01:58
92500 -- (-1824.801) (-1832.223) (-1827.109) [-1822.605] * [-1837.456] (-1831.887) (-1821.891) (-1829.005) -- 0:01:57
93000 -- (-1824.683) (-1821.592) (-1827.518) [-1830.847] * (-1831.056) (-1831.342) [-1823.229] (-1829.012) -- 0:01:57
93500 -- (-1821.406) (-1838.680) [-1828.307] (-1835.323) * (-1824.917) [-1822.595] (-1825.353) (-1824.130) -- 0:01:56
94000 -- (-1824.012) (-1829.650) (-1829.312) [-1830.651] * (-1833.750) [-1827.665] (-1826.827) (-1829.658) -- 0:01:55
94500 -- (-1826.517) [-1829.654] (-1834.158) (-1831.127) * (-1832.286) [-1822.284] (-1825.632) (-1828.806) -- 0:01:54
95000 -- [-1824.572] (-1833.187) (-1822.109) (-1829.622) * (-1824.623) (-1825.214) (-1824.047) [-1824.501] -- 0:01:54
Average standard deviation of split frequencies: 0.019419
95500 -- (-1833.260) (-1831.720) [-1832.278] (-1822.001) * (-1827.613) (-1827.318) (-1831.679) [-1826.368] -- 0:01:53
96000 -- (-1836.401) (-1822.880) (-1833.726) [-1825.084] * (-1829.392) [-1824.116] (-1829.405) (-1823.537) -- 0:01:53
96500 -- (-1829.918) [-1824.018] (-1836.385) (-1821.956) * (-1824.155) (-1830.448) [-1823.530] (-1825.542) -- 0:02:01
97000 -- (-1833.433) (-1829.924) [-1829.472] (-1827.303) * (-1829.334) (-1831.685) (-1842.028) [-1832.154] -- 0:02:01
97500 -- (-1833.229) (-1827.728) [-1828.223] (-1825.356) * (-1820.824) (-1830.205) [-1826.224] (-1823.706) -- 0:02:00
98000 -- (-1824.252) [-1822.712] (-1825.841) (-1823.929) * (-1829.751) [-1822.069] (-1827.783) (-1828.064) -- 0:01:59
98500 -- (-1823.705) (-1828.779) [-1823.113] (-1828.564) * [-1827.504] (-1828.728) (-1832.218) (-1830.092) -- 0:01:58
99000 -- (-1822.928) [-1822.990] (-1834.036) (-1838.593) * (-1834.065) [-1824.731] (-1826.427) (-1826.218) -- 0:01:58
99500 -- (-1853.669) (-1824.280) [-1829.416] (-1829.632) * (-1834.251) (-1827.604) (-1827.022) [-1828.750] -- 0:01:57
100000 -- (-1824.331) (-1827.984) [-1831.017] (-1828.228) * (-1834.058) (-1819.520) [-1823.683] (-1822.251) -- 0:01:56
Average standard deviation of split frequencies: 0.024117
100500 -- (-1829.792) (-1829.149) (-1838.482) [-1818.614] * (-1824.106) [-1823.256] (-1827.051) (-1822.617) -- 0:01:56
101000 -- (-1829.070) (-1826.472) (-1826.418) [-1832.105] * (-1825.847) (-1828.340) (-1827.554) [-1830.229] -- 0:01:55
101500 -- (-1829.088) (-1826.135) [-1828.650] (-1829.014) * (-1833.197) (-1833.934) (-1830.469) [-1818.498] -- 0:01:55
102000 -- (-1827.236) (-1834.563) (-1832.062) [-1827.436] * (-1829.296) [-1823.390] (-1829.212) (-1827.971) -- 0:01:54
102500 -- (-1821.335) [-1827.468] (-1827.018) (-1819.797) * (-1831.676) (-1823.300) [-1831.778] (-1823.770) -- 0:01:53
103000 -- (-1824.568) (-1823.747) [-1823.040] (-1827.850) * (-1831.049) (-1822.942) (-1827.712) [-1828.722] -- 0:01:53
103500 -- (-1836.961) [-1821.958] (-1830.506) (-1830.399) * [-1826.519] (-1822.888) (-1821.093) (-1826.900) -- 0:01:52
104000 -- (-1822.956) (-1822.802) (-1832.109) [-1822.387] * [-1835.383] (-1823.017) (-1821.468) (-1826.708) -- 0:02:00
104500 -- (-1833.566) (-1833.582) [-1820.469] (-1835.321) * (-1824.236) [-1825.402] (-1832.857) (-1822.783) -- 0:01:59
105000 -- [-1831.566] (-1827.928) (-1829.624) (-1830.987) * (-1825.662) [-1822.287] (-1832.720) (-1826.068) -- 0:01:59
Average standard deviation of split frequencies: 0.022640
105500 -- (-1828.839) [-1832.866] (-1841.916) (-1835.663) * (-1834.986) (-1827.812) (-1836.804) [-1825.122] -- 0:01:58
106000 -- (-1826.104) [-1823.268] (-1835.512) (-1833.585) * (-1829.527) (-1832.276) [-1823.419] (-1827.405) -- 0:01:58
106500 -- (-1830.722) (-1829.147) [-1821.897] (-1828.015) * (-1824.433) [-1834.386] (-1835.513) (-1822.423) -- 0:01:57
107000 -- (-1828.597) (-1821.776) [-1830.775] (-1824.253) * (-1824.933) [-1822.678] (-1829.928) (-1824.597) -- 0:01:56
107500 -- (-1823.779) (-1822.362) [-1822.281] (-1830.400) * [-1827.950] (-1825.368) (-1828.493) (-1834.991) -- 0:01:56
108000 -- (-1821.478) (-1823.513) [-1820.555] (-1827.946) * [-1824.960] (-1842.297) (-1827.269) (-1829.710) -- 0:01:55
108500 -- (-1824.222) (-1829.555) (-1828.356) [-1825.541] * (-1823.627) (-1818.897) (-1831.143) [-1826.561] -- 0:01:55
109000 -- (-1831.146) [-1828.951] (-1828.480) (-1823.182) * (-1832.540) [-1824.508] (-1827.827) (-1826.091) -- 0:01:54
109500 -- (-1831.953) [-1820.467] (-1832.433) (-1824.259) * (-1831.534) (-1820.883) (-1828.349) [-1832.167] -- 0:01:53
110000 -- (-1827.046) (-1822.410) [-1834.655] (-1827.501) * (-1825.688) [-1823.502] (-1827.448) (-1825.313) -- 0:01:53
Average standard deviation of split frequencies: 0.020718
110500 -- (-1828.229) (-1831.846) [-1832.910] (-1829.126) * (-1833.178) [-1823.505] (-1820.927) (-1828.719) -- 0:01:52
111000 -- (-1828.096) [-1823.773] (-1823.005) (-1829.742) * (-1831.885) (-1823.352) (-1829.234) [-1832.792] -- 0:02:00
111500 -- (-1831.336) (-1828.576) [-1824.030] (-1824.767) * [-1824.664] (-1824.971) (-1823.771) (-1835.313) -- 0:01:59
112000 -- (-1835.479) (-1830.771) (-1825.507) [-1829.393] * [-1819.497] (-1820.869) (-1842.262) (-1822.875) -- 0:01:58
112500 -- (-1824.859) (-1828.236) (-1828.088) [-1831.615] * [-1817.649] (-1827.460) (-1842.543) (-1840.335) -- 0:01:58
113000 -- (-1828.489) (-1827.182) [-1821.944] (-1828.439) * (-1831.800) [-1820.976] (-1832.166) (-1835.903) -- 0:01:57
113500 -- (-1828.843) (-1828.565) [-1827.916] (-1833.398) * [-1821.429] (-1834.195) (-1837.920) (-1827.024) -- 0:01:57
114000 -- (-1833.864) (-1828.540) [-1838.043] (-1831.805) * (-1819.362) (-1825.976) [-1829.078] (-1829.642) -- 0:01:56
114500 -- (-1835.483) (-1826.012) (-1828.935) [-1826.838] * (-1826.664) (-1825.203) (-1838.082) [-1821.234] -- 0:01:56
115000 -- (-1833.526) (-1831.471) [-1825.542] (-1829.518) * (-1823.917) (-1825.067) (-1829.376) [-1828.753] -- 0:01:55
Average standard deviation of split frequencies: 0.021058
115500 -- (-1837.280) (-1830.673) (-1820.264) [-1828.266] * (-1826.030) (-1822.008) [-1836.062] (-1826.179) -- 0:01:54
116000 -- (-1834.090) (-1826.341) (-1826.445) [-1824.101] * (-1823.816) [-1826.261] (-1841.701) (-1827.442) -- 0:01:54
116500 -- (-1832.631) (-1820.431) [-1822.463] (-1821.491) * (-1822.408) (-1831.185) [-1828.349] (-1833.956) -- 0:01:53
117000 -- (-1824.957) [-1830.443] (-1822.540) (-1834.184) * (-1821.214) [-1828.525] (-1822.760) (-1831.821) -- 0:01:53
117500 -- (-1834.743) (-1825.135) (-1824.530) [-1825.260] * (-1824.309) (-1827.563) [-1825.608] (-1830.315) -- 0:01:52
118000 -- (-1841.613) (-1828.098) [-1822.433] (-1830.328) * (-1829.424) (-1828.000) [-1829.119] (-1819.659) -- 0:01:52
118500 -- (-1824.869) (-1822.329) [-1815.581] (-1842.482) * (-1830.790) (-1829.322) (-1829.495) [-1823.693] -- 0:01:59
119000 -- (-1820.565) [-1826.489] (-1826.622) (-1823.846) * (-1825.231) [-1831.953] (-1831.481) (-1826.782) -- 0:01:58
119500 -- (-1827.064) (-1825.823) [-1829.716] (-1826.160) * (-1822.212) (-1829.953) (-1827.581) [-1822.084] -- 0:01:57
120000 -- (-1823.010) [-1827.967] (-1827.971) (-1822.517) * (-1828.257) (-1829.687) (-1836.174) [-1820.776] -- 0:01:57
Average standard deviation of split frequencies: 0.022138
120500 -- (-1825.422) (-1827.314) (-1827.306) [-1823.482] * [-1823.893] (-1826.161) (-1839.871) (-1820.665) -- 0:01:56
121000 -- (-1824.884) (-1831.016) (-1832.929) [-1827.231] * (-1830.330) (-1833.685) [-1826.897] (-1827.829) -- 0:01:56
121500 -- [-1823.113] (-1827.074) (-1831.978) (-1826.847) * (-1826.928) (-1829.137) [-1824.496] (-1833.844) -- 0:01:55
122000 -- (-1821.899) (-1822.139) [-1828.467] (-1829.766) * (-1825.813) (-1832.773) (-1834.507) [-1823.918] -- 0:01:55
122500 -- [-1826.793] (-1823.767) (-1823.991) (-1819.818) * (-1823.359) (-1820.243) [-1820.992] (-1827.567) -- 0:01:54
123000 -- (-1834.183) (-1830.090) (-1826.614) [-1820.562] * (-1825.432) (-1824.609) [-1828.087] (-1826.190) -- 0:01:54
123500 -- (-1819.826) (-1829.286) (-1827.317) [-1824.734] * (-1828.401) (-1829.891) (-1826.690) [-1827.420] -- 0:01:53
124000 -- (-1832.152) [-1828.650] (-1824.756) (-1824.890) * (-1820.504) (-1826.961) (-1830.465) [-1826.633] -- 0:01:53
124500 -- (-1829.597) [-1832.687] (-1822.451) (-1822.403) * (-1832.191) (-1835.714) (-1824.790) [-1821.533] -- 0:01:52
125000 -- (-1831.018) (-1820.215) [-1827.062] (-1829.620) * (-1829.837) [-1831.403] (-1828.123) (-1832.589) -- 0:01:52
Average standard deviation of split frequencies: 0.021379
125500 -- (-1823.162) [-1826.343] (-1827.068) (-1833.867) * (-1827.436) (-1821.258) [-1826.548] (-1823.536) -- 0:01:51
126000 -- (-1828.929) (-1834.333) (-1827.385) [-1826.804] * (-1819.684) [-1822.221] (-1829.471) (-1830.720) -- 0:01:57
126500 -- (-1825.824) (-1831.246) [-1827.620] (-1833.640) * (-1827.104) (-1841.919) (-1829.623) [-1827.892] -- 0:01:57
127000 -- (-1822.025) (-1829.606) [-1830.221] (-1827.435) * [-1823.482] (-1825.592) (-1832.012) (-1822.424) -- 0:01:56
127500 -- (-1825.215) (-1824.552) [-1822.591] (-1824.915) * (-1832.975) [-1819.059] (-1820.599) (-1827.930) -- 0:01:56
128000 -- (-1827.823) [-1823.901] (-1826.186) (-1825.161) * (-1824.349) [-1819.892] (-1832.862) (-1824.231) -- 0:01:55
128500 -- (-1824.135) [-1822.382] (-1828.993) (-1826.381) * (-1834.576) (-1826.335) [-1827.996] (-1823.640) -- 0:01:55
129000 -- (-1824.310) (-1829.529) [-1822.244] (-1822.325) * (-1827.951) [-1827.696] (-1829.441) (-1825.218) -- 0:01:54
129500 -- (-1830.170) (-1821.605) [-1821.577] (-1827.134) * (-1824.286) (-1827.983) (-1826.251) [-1826.128] -- 0:01:54
130000 -- (-1829.140) (-1822.215) (-1824.353) [-1822.795] * (-1834.934) [-1820.779] (-1826.712) (-1824.983) -- 0:01:53
Average standard deviation of split frequencies: 0.021474
130500 -- [-1823.738] (-1825.167) (-1825.508) (-1823.027) * (-1828.197) [-1826.094] (-1825.051) (-1835.761) -- 0:01:53
131000 -- (-1824.379) [-1820.030] (-1828.831) (-1826.251) * (-1820.063) [-1825.481] (-1831.331) (-1828.168) -- 0:01:52
131500 -- [-1824.317] (-1819.262) (-1828.788) (-1829.172) * (-1832.665) [-1823.013] (-1823.895) (-1834.886) -- 0:01:52
132000 -- (-1822.782) (-1828.069) (-1826.112) [-1829.881] * (-1840.420) (-1828.142) [-1831.720] (-1824.598) -- 0:01:51
132500 -- [-1825.975] (-1821.589) (-1831.810) (-1825.477) * [-1827.953] (-1833.654) (-1825.248) (-1823.538) -- 0:01:51
133000 -- (-1829.785) (-1826.936) (-1837.442) [-1828.991] * (-1829.593) (-1828.677) [-1823.929] (-1825.546) -- 0:01:50
133500 -- (-1828.496) [-1827.674] (-1829.995) (-1822.537) * (-1826.417) [-1827.557] (-1831.359) (-1827.120) -- 0:01:56
134000 -- (-1828.132) [-1825.349] (-1827.595) (-1826.951) * [-1823.650] (-1832.290) (-1831.127) (-1829.181) -- 0:01:56
134500 -- [-1827.122] (-1823.356) (-1825.527) (-1827.118) * [-1820.707] (-1823.952) (-1823.910) (-1825.464) -- 0:01:55
135000 -- (-1822.778) [-1822.496] (-1824.082) (-1823.247) * (-1825.171) (-1822.838) [-1831.191] (-1833.701) -- 0:01:55
Average standard deviation of split frequencies: 0.020467
135500 -- (-1827.152) (-1831.437) (-1828.590) [-1828.391] * [-1825.246] (-1835.162) (-1826.074) (-1828.994) -- 0:01:54
136000 -- (-1820.801) (-1827.146) (-1833.758) [-1834.680] * (-1825.572) [-1825.432] (-1821.545) (-1835.835) -- 0:01:54
136500 -- [-1822.756] (-1825.489) (-1832.439) (-1826.383) * (-1822.501) (-1829.496) [-1822.506] (-1829.640) -- 0:01:53
137000 -- (-1828.139) (-1824.065) (-1831.755) [-1825.195] * (-1829.606) (-1831.987) (-1825.872) [-1829.903] -- 0:01:53
137500 -- (-1831.260) (-1823.757) (-1822.259) [-1822.989] * (-1824.224) (-1821.741) (-1831.481) [-1830.085] -- 0:01:52
138000 -- (-1832.976) [-1825.601] (-1830.769) (-1827.138) * (-1824.505) (-1832.522) [-1819.430] (-1823.100) -- 0:01:52
138500 -- (-1830.220) (-1822.658) (-1824.027) [-1823.196] * (-1831.126) (-1837.286) (-1828.772) [-1816.739] -- 0:01:51
139000 -- [-1824.987] (-1822.722) (-1825.460) (-1829.178) * [-1829.520] (-1821.536) (-1824.970) (-1828.102) -- 0:01:51
139500 -- [-1826.280] (-1830.545) (-1828.499) (-1831.116) * [-1828.476] (-1835.374) (-1826.784) (-1832.851) -- 0:01:51
140000 -- (-1831.460) (-1828.921) (-1821.354) [-1823.863] * [-1823.573] (-1831.885) (-1825.600) (-1827.913) -- 0:01:50
Average standard deviation of split frequencies: 0.021518
140500 -- (-1825.937) (-1826.495) [-1822.365] (-1825.483) * [-1831.724] (-1827.511) (-1821.858) (-1831.072) -- 0:01:50
141000 -- [-1823.850] (-1831.764) (-1829.640) (-1827.476) * (-1824.866) (-1825.740) (-1828.671) [-1819.207] -- 0:01:55
141500 -- (-1826.880) (-1823.166) [-1822.548] (-1827.385) * (-1834.875) [-1828.270] (-1827.833) (-1821.101) -- 0:01:55
142000 -- [-1820.330] (-1826.230) (-1830.148) (-1824.158) * [-1827.515] (-1828.339) (-1833.915) (-1825.549) -- 0:01:54
142500 -- (-1825.398) [-1820.596] (-1831.918) (-1824.801) * [-1822.101] (-1832.904) (-1821.766) (-1828.344) -- 0:01:54
143000 -- (-1831.329) (-1830.408) [-1820.619] (-1829.571) * (-1827.072) (-1835.518) (-1830.417) [-1829.112] -- 0:01:53
143500 -- (-1828.979) [-1825.762] (-1823.268) (-1825.320) * (-1827.271) (-1824.687) (-1832.532) [-1828.905] -- 0:01:53
144000 -- (-1827.214) [-1827.575] (-1838.769) (-1825.246) * (-1823.772) [-1823.224] (-1824.631) (-1826.711) -- 0:01:52
144500 -- (-1825.087) (-1829.189) (-1829.766) [-1818.879] * (-1837.242) [-1825.941] (-1828.184) (-1828.098) -- 0:01:52
145000 -- (-1829.713) (-1832.681) [-1819.565] (-1832.008) * (-1836.627) [-1827.102] (-1819.668) (-1823.614) -- 0:01:52
Average standard deviation of split frequencies: 0.019988
145500 -- (-1823.869) [-1830.957] (-1828.305) (-1825.170) * (-1829.894) (-1826.782) [-1827.114] (-1820.265) -- 0:01:51
146000 -- [-1822.048] (-1830.325) (-1823.297) (-1821.991) * (-1830.113) (-1831.471) (-1830.017) [-1826.810] -- 0:01:51
146500 -- [-1822.509] (-1834.353) (-1822.391) (-1822.744) * [-1822.739] (-1827.894) (-1829.216) (-1824.895) -- 0:01:50
147000 -- (-1837.760) (-1850.338) (-1825.943) [-1818.026] * (-1821.435) (-1828.109) (-1818.926) [-1824.931] -- 0:01:50
147500 -- [-1824.160] (-1823.287) (-1828.860) (-1827.127) * (-1826.302) (-1827.725) [-1818.934] (-1826.371) -- 0:01:49
148000 -- (-1833.057) [-1828.678] (-1827.208) (-1828.547) * (-1820.828) [-1824.647] (-1829.146) (-1829.475) -- 0:01:49
148500 -- (-1829.519) [-1828.861] (-1828.064) (-1829.334) * [-1828.089] (-1827.588) (-1826.639) (-1830.377) -- 0:01:54
149000 -- [-1824.272] (-1827.922) (-1823.344) (-1822.576) * (-1822.934) (-1828.108) (-1836.865) [-1820.471] -- 0:01:54
149500 -- [-1824.064] (-1826.043) (-1829.620) (-1832.866) * [-1821.178] (-1828.647) (-1826.169) (-1820.821) -- 0:01:53
150000 -- [-1819.392] (-1826.626) (-1827.052) (-1830.594) * (-1826.164) [-1827.006] (-1829.287) (-1823.346) -- 0:01:53
Average standard deviation of split frequencies: 0.019199
150500 -- (-1826.715) (-1825.314) [-1819.409] (-1824.285) * (-1827.226) [-1820.151] (-1825.433) (-1824.233) -- 0:01:52
151000 -- (-1823.407) (-1821.883) [-1823.716] (-1827.247) * (-1824.037) (-1828.413) [-1825.109] (-1825.553) -- 0:01:52
151500 -- (-1824.484) (-1833.916) [-1825.915] (-1826.246) * (-1824.830) [-1822.819] (-1831.095) (-1832.565) -- 0:01:52
152000 -- (-1822.494) (-1828.928) [-1825.296] (-1821.374) * [-1829.851] (-1826.737) (-1827.182) (-1825.903) -- 0:01:51
152500 -- (-1820.465) [-1830.359] (-1831.897) (-1831.549) * (-1820.244) (-1825.331) (-1820.498) [-1825.527] -- 0:01:51
153000 -- (-1826.156) (-1823.981) (-1825.061) [-1825.559] * (-1827.627) [-1823.400] (-1829.254) (-1832.459) -- 0:01:50
153500 -- [-1821.427] (-1825.761) (-1835.619) (-1827.394) * [-1825.509] (-1828.424) (-1823.222) (-1830.490) -- 0:01:50
154000 -- [-1822.831] (-1827.112) (-1822.189) (-1821.324) * (-1826.930) [-1825.934] (-1824.929) (-1832.187) -- 0:01:49
154500 -- (-1822.537) [-1823.127] (-1826.492) (-1833.413) * (-1829.799) [-1829.280] (-1828.078) (-1832.166) -- 0:01:49
155000 -- (-1839.385) (-1830.649) (-1828.926) [-1827.926] * (-1830.314) (-1830.037) (-1827.366) [-1827.582] -- 0:01:49
Average standard deviation of split frequencies: 0.017829
155500 -- (-1825.566) [-1824.962] (-1825.351) (-1834.685) * [-1828.590] (-1823.125) (-1827.080) (-1828.060) -- 0:01:48
156000 -- (-1826.954) (-1823.854) (-1824.707) [-1824.017] * [-1819.652] (-1831.100) (-1826.980) (-1833.942) -- 0:01:53
156500 -- (-1822.806) (-1829.999) [-1822.302] (-1828.866) * (-1827.198) [-1826.620] (-1828.146) (-1825.537) -- 0:01:53
157000 -- [-1823.811] (-1824.410) (-1832.779) (-1832.047) * (-1824.496) (-1826.024) (-1822.286) [-1827.467] -- 0:01:52
157500 -- (-1832.943) [-1826.353] (-1823.346) (-1829.242) * (-1826.471) (-1826.692) [-1817.076] (-1823.767) -- 0:01:52
158000 -- (-1834.119) (-1826.137) (-1830.384) [-1829.141] * (-1830.281) (-1826.728) (-1823.763) [-1823.853] -- 0:01:51
158500 -- (-1820.612) (-1842.531) [-1828.522] (-1828.580) * [-1823.005] (-1825.752) (-1824.556) (-1828.674) -- 0:01:51
159000 -- (-1827.685) [-1826.988] (-1826.351) (-1826.533) * (-1828.765) (-1827.720) [-1820.903] (-1820.658) -- 0:01:51
159500 -- (-1828.663) (-1824.809) (-1826.733) [-1826.449] * [-1821.550] (-1823.854) (-1829.350) (-1824.615) -- 0:01:50
160000 -- (-1824.280) (-1832.467) [-1829.142] (-1828.634) * (-1825.747) (-1826.232) (-1827.268) [-1819.948] -- 0:01:50
Average standard deviation of split frequencies: 0.017164
160500 -- (-1822.902) (-1827.157) (-1829.786) [-1827.350] * (-1831.493) [-1822.684] (-1826.927) (-1825.221) -- 0:01:49
161000 -- (-1823.824) (-1827.146) [-1826.071] (-1829.992) * (-1827.852) (-1820.956) (-1824.754) [-1826.109] -- 0:01:49
161500 -- [-1820.605] (-1826.965) (-1839.067) (-1822.571) * (-1828.876) (-1822.717) (-1833.992) [-1826.779] -- 0:01:49
162000 -- (-1824.744) (-1827.946) [-1822.131] (-1829.425) * (-1824.793) [-1826.105] (-1825.349) (-1836.322) -- 0:01:48
162500 -- (-1821.030) (-1828.412) [-1823.420] (-1822.916) * [-1820.309] (-1835.847) (-1817.828) (-1833.061) -- 0:01:48
163000 -- [-1824.631] (-1821.751) (-1830.705) (-1827.924) * (-1835.046) (-1823.518) [-1822.775] (-1829.056) -- 0:01:47
163500 -- (-1826.031) [-1831.416] (-1829.568) (-1828.294) * (-1830.645) [-1822.318] (-1830.322) (-1828.117) -- 0:01:52
164000 -- [-1822.963] (-1824.150) (-1832.085) (-1830.596) * (-1830.227) (-1826.478) [-1825.315] (-1826.130) -- 0:01:52
164500 -- (-1825.586) (-1831.160) [-1829.493] (-1837.386) * [-1835.153] (-1840.129) (-1825.294) (-1835.444) -- 0:01:51
165000 -- (-1831.678) (-1831.811) (-1832.741) [-1830.344] * (-1826.571) (-1826.847) [-1825.783] (-1821.604) -- 0:01:51
Average standard deviation of split frequencies: 0.019202
165500 -- (-1826.432) (-1823.388) [-1823.949] (-1838.595) * [-1828.467] (-1834.622) (-1824.471) (-1823.255) -- 0:01:50
166000 -- (-1830.913) (-1825.715) [-1832.454] (-1821.426) * (-1827.534) (-1832.051) (-1830.706) [-1826.947] -- 0:01:50
166500 -- (-1824.114) [-1824.978] (-1826.330) (-1830.526) * (-1827.636) [-1833.731] (-1828.036) (-1819.559) -- 0:01:50
167000 -- (-1834.392) [-1830.376] (-1820.348) (-1839.578) * (-1841.405) (-1829.859) (-1826.888) [-1821.637] -- 0:01:49
167500 -- (-1822.699) (-1830.396) (-1828.386) [-1821.876] * (-1821.841) [-1827.250] (-1820.825) (-1821.570) -- 0:01:49
168000 -- (-1831.556) [-1825.582] (-1828.570) (-1825.998) * (-1830.712) (-1825.773) (-1825.097) [-1825.526] -- 0:01:48
168500 -- [-1828.526] (-1830.104) (-1826.538) (-1829.384) * [-1823.298] (-1826.237) (-1825.704) (-1825.508) -- 0:01:48
169000 -- (-1826.613) (-1821.874) (-1830.318) [-1818.773] * (-1822.833) [-1831.551] (-1825.993) (-1832.551) -- 0:01:48
169500 -- [-1820.977] (-1822.807) (-1832.669) (-1824.622) * (-1826.764) (-1827.906) (-1826.947) [-1824.265] -- 0:01:47
170000 -- (-1824.067) (-1831.168) (-1819.486) [-1828.849] * (-1829.254) (-1822.302) (-1835.646) [-1825.536] -- 0:01:47
Average standard deviation of split frequencies: 0.019466
170500 -- [-1821.982] (-1828.845) (-1828.540) (-1822.672) * (-1830.156) (-1829.973) [-1820.301] (-1830.470) -- 0:01:47
171000 -- (-1838.725) (-1836.729) [-1822.040] (-1830.027) * (-1833.087) (-1828.431) [-1820.761] (-1831.616) -- 0:01:51
171500 -- (-1828.662) (-1829.528) (-1822.852) [-1827.937] * (-1826.173) (-1827.054) (-1827.768) [-1824.137] -- 0:01:51
172000 -- [-1824.968] (-1826.563) (-1825.823) (-1819.576) * (-1827.549) (-1825.140) [-1826.640] (-1819.798) -- 0:01:50
172500 -- [-1826.703] (-1832.093) (-1836.317) (-1824.130) * (-1840.645) (-1830.441) (-1836.901) [-1821.810] -- 0:01:50
173000 -- [-1825.835] (-1830.108) (-1829.431) (-1824.249) * [-1820.884] (-1828.100) (-1823.464) (-1824.730) -- 0:01:49
173500 -- (-1823.176) [-1825.473] (-1828.886) (-1824.165) * [-1826.375] (-1826.842) (-1828.198) (-1826.714) -- 0:01:49
174000 -- (-1826.188) (-1828.660) [-1824.600] (-1827.614) * [-1823.543] (-1829.060) (-1827.350) (-1823.207) -- 0:01:49
174500 -- (-1825.363) [-1825.754] (-1832.623) (-1832.197) * [-1822.123] (-1823.628) (-1831.746) (-1828.402) -- 0:01:48
175000 -- (-1826.931) [-1825.123] (-1828.069) (-1823.165) * (-1824.144) (-1823.889) (-1832.706) [-1826.172] -- 0:01:48
Average standard deviation of split frequencies: 0.018347
175500 -- [-1823.303] (-1827.931) (-1832.214) (-1823.682) * (-1833.161) [-1825.355] (-1822.838) (-1824.764) -- 0:01:48
176000 -- (-1825.618) (-1827.041) [-1831.478] (-1834.629) * [-1821.836] (-1827.896) (-1838.105) (-1823.837) -- 0:01:47
176500 -- (-1823.283) (-1824.511) (-1825.962) [-1827.640] * (-1830.826) [-1826.670] (-1826.710) (-1838.572) -- 0:01:47
177000 -- [-1819.648] (-1828.609) (-1826.364) (-1833.965) * (-1822.778) (-1821.412) (-1833.626) [-1823.972] -- 0:01:46
177500 -- (-1825.136) (-1829.855) [-1823.951] (-1833.749) * (-1830.113) [-1823.822] (-1830.105) (-1834.253) -- 0:01:46
178000 -- (-1824.477) (-1829.011) [-1829.839] (-1826.865) * (-1822.569) (-1826.039) [-1826.895] (-1832.331) -- 0:01:46
178500 -- (-1823.447) (-1831.167) [-1824.053] (-1827.041) * (-1822.649) (-1828.469) [-1822.102] (-1835.107) -- 0:01:50
179000 -- (-1822.829) (-1820.452) (-1833.335) [-1828.678] * (-1836.935) [-1836.289] (-1838.511) (-1829.106) -- 0:01:50
179500 -- (-1826.519) (-1827.640) (-1825.978) [-1824.027] * (-1829.486) (-1825.493) (-1824.167) [-1833.850] -- 0:01:49
180000 -- (-1829.869) (-1831.006) (-1827.854) [-1825.075] * (-1834.098) [-1832.671] (-1827.855) (-1823.057) -- 0:01:49
Average standard deviation of split frequencies: 0.017743
180500 -- (-1829.194) (-1821.569) (-1821.288) [-1823.785] * (-1828.495) (-1837.568) [-1826.080] (-1826.022) -- 0:01:48
181000 -- (-1826.547) (-1826.001) [-1822.926] (-1840.067) * (-1825.321) (-1830.488) (-1823.787) [-1830.458] -- 0:01:48
181500 -- (-1832.005) (-1824.575) [-1822.723] (-1820.479) * [-1826.873] (-1826.294) (-1825.395) (-1832.279) -- 0:01:48
182000 -- (-1830.921) (-1831.478) [-1832.331] (-1825.968) * (-1832.899) (-1838.951) [-1821.292] (-1825.222) -- 0:01:47
182500 -- [-1823.646] (-1825.489) (-1828.555) (-1827.926) * [-1832.261] (-1826.942) (-1825.735) (-1823.750) -- 0:01:47
183000 -- (-1827.872) (-1833.408) (-1827.807) [-1820.545] * (-1828.150) [-1825.053] (-1824.303) (-1828.565) -- 0:01:47
183500 -- [-1826.045] (-1831.904) (-1843.383) (-1822.784) * (-1829.982) [-1822.303] (-1833.905) (-1834.649) -- 0:01:46
184000 -- (-1827.865) (-1828.583) (-1828.930) [-1825.414] * (-1838.310) (-1822.444) [-1820.997] (-1834.803) -- 0:01:46
184500 -- (-1829.205) [-1829.848] (-1829.103) (-1820.115) * [-1829.421] (-1837.560) (-1831.515) (-1830.185) -- 0:01:46
185000 -- (-1828.185) [-1828.686] (-1826.888) (-1824.593) * (-1829.357) [-1829.555] (-1830.447) (-1830.856) -- 0:01:45
Average standard deviation of split frequencies: 0.016807
185500 -- (-1822.227) (-1832.007) [-1829.891] (-1829.239) * (-1833.135) (-1829.062) [-1829.689] (-1837.818) -- 0:01:45
186000 -- (-1823.917) (-1824.344) (-1832.151) [-1825.576] * (-1830.064) (-1826.543) [-1824.690] (-1834.508) -- 0:01:49
186500 -- (-1828.642) (-1825.203) [-1824.212] (-1830.710) * [-1824.168] (-1830.874) (-1833.610) (-1823.334) -- 0:01:49
187000 -- (-1830.065) (-1823.715) (-1824.835) [-1825.196] * (-1825.107) (-1832.461) [-1828.423] (-1827.499) -- 0:01:48
187500 -- [-1822.033] (-1826.577) (-1831.384) (-1827.239) * (-1827.965) (-1835.439) [-1837.306] (-1823.373) -- 0:01:48
188000 -- (-1826.905) (-1832.930) [-1827.566] (-1827.855) * (-1832.039) (-1829.505) (-1837.005) [-1825.827] -- 0:01:47
188500 -- (-1828.325) (-1831.022) [-1825.736] (-1827.604) * (-1826.860) [-1829.456] (-1829.124) (-1826.755) -- 0:01:47
189000 -- (-1823.660) (-1826.143) (-1846.777) [-1821.810] * (-1823.604) [-1824.373] (-1835.213) (-1828.912) -- 0:01:47
189500 -- (-1826.062) (-1828.880) [-1824.448] (-1824.588) * (-1829.379) (-1828.021) (-1831.461) [-1823.496] -- 0:01:46
190000 -- (-1822.779) (-1824.066) (-1824.320) [-1822.094] * (-1826.236) (-1830.371) (-1825.325) [-1824.503] -- 0:01:46
Average standard deviation of split frequencies: 0.017177
190500 -- (-1822.777) [-1822.835] (-1819.937) (-1822.706) * (-1828.959) (-1827.768) (-1836.415) [-1825.928] -- 0:01:46
191000 -- [-1824.601] (-1824.429) (-1819.299) (-1832.888) * (-1825.637) [-1834.444] (-1825.112) (-1828.988) -- 0:01:45
191500 -- (-1825.615) (-1828.230) [-1822.690] (-1847.439) * (-1827.654) (-1846.830) (-1830.418) [-1826.455] -- 0:01:45
192000 -- (-1832.781) (-1826.088) (-1826.317) [-1828.553] * [-1831.899] (-1826.305) (-1830.450) (-1819.621) -- 0:01:45
192500 -- [-1825.881] (-1827.042) (-1827.728) (-1823.506) * (-1834.245) (-1833.499) (-1826.481) [-1827.222] -- 0:01:44
193000 -- (-1829.480) (-1827.503) [-1822.397] (-1828.156) * (-1833.224) (-1834.121) (-1838.168) [-1827.117] -- 0:01:44
193500 -- (-1828.392) [-1823.778] (-1827.240) (-1826.481) * (-1833.455) (-1832.969) (-1830.750) [-1825.839] -- 0:01:48
194000 -- (-1826.814) (-1822.973) (-1827.290) [-1830.536] * [-1826.658] (-1835.561) (-1830.004) (-1822.986) -- 0:01:48
194500 -- (-1823.264) (-1830.738) [-1834.279] (-1831.390) * (-1826.375) (-1835.281) (-1826.161) [-1823.845] -- 0:01:47
195000 -- (-1835.692) (-1823.409) (-1823.182) [-1822.476] * (-1823.583) (-1831.382) [-1831.763] (-1836.232) -- 0:01:47
Average standard deviation of split frequencies: 0.015823
195500 -- (-1830.959) (-1836.344) [-1822.204] (-1828.985) * (-1821.979) [-1831.576] (-1832.233) (-1832.550) -- 0:01:46
196000 -- (-1823.693) (-1829.992) [-1823.087] (-1839.719) * [-1824.101] (-1834.106) (-1837.943) (-1833.252) -- 0:01:46
196500 -- (-1825.335) [-1836.022] (-1824.248) (-1826.734) * (-1831.014) [-1827.133] (-1826.412) (-1825.603) -- 0:01:46
197000 -- (-1833.256) [-1827.207] (-1831.810) (-1833.999) * (-1833.596) (-1834.073) [-1826.677] (-1836.890) -- 0:01:45
197500 -- (-1825.543) (-1831.834) [-1825.024] (-1826.507) * (-1829.386) (-1826.336) [-1825.429] (-1831.306) -- 0:01:45
198000 -- [-1823.410] (-1834.528) (-1823.815) (-1836.817) * (-1824.114) [-1831.445] (-1837.317) (-1830.168) -- 0:01:45
198500 -- (-1826.132) [-1834.308] (-1824.114) (-1833.475) * (-1829.810) (-1826.519) [-1842.491] (-1830.204) -- 0:01:44
199000 -- (-1825.579) (-1832.083) [-1826.932] (-1826.961) * (-1822.007) [-1830.322] (-1830.982) (-1831.014) -- 0:01:44
199500 -- (-1830.149) (-1830.028) (-1821.585) [-1828.250] * (-1827.834) (-1829.769) [-1822.595] (-1830.049) -- 0:01:44
200000 -- (-1820.364) [-1823.019] (-1834.951) (-1832.254) * (-1831.685) [-1829.041] (-1832.404) (-1840.008) -- 0:01:43
Average standard deviation of split frequencies: 0.014342
200500 -- (-1826.095) [-1828.766] (-1829.206) (-1836.681) * (-1823.304) (-1840.496) (-1821.432) [-1824.248] -- 0:01:43
201000 -- (-1821.483) (-1825.309) (-1831.677) [-1827.768] * [-1830.083] (-1827.583) (-1824.762) (-1831.106) -- 0:01:47
201500 -- (-1825.800) [-1821.177] (-1834.071) (-1834.402) * (-1828.448) (-1834.139) [-1825.454] (-1828.002) -- 0:01:46
202000 -- (-1821.981) (-1822.802) [-1837.003] (-1826.245) * (-1828.617) (-1827.456) [-1822.091] (-1822.521) -- 0:01:46
202500 -- (-1824.284) (-1825.964) (-1829.194) [-1832.763] * (-1827.580) (-1827.327) (-1827.837) [-1822.551] -- 0:01:46
203000 -- [-1830.154] (-1830.290) (-1839.737) (-1833.949) * (-1826.483) [-1827.012] (-1831.697) (-1827.027) -- 0:01:46
203500 -- [-1833.968] (-1828.233) (-1831.572) (-1836.029) * (-1822.085) [-1831.233] (-1826.855) (-1827.215) -- 0:01:45
204000 -- [-1827.364] (-1834.190) (-1830.590) (-1830.402) * [-1820.577] (-1825.988) (-1832.190) (-1822.837) -- 0:01:45
204500 -- (-1823.919) (-1828.387) [-1824.198] (-1831.909) * [-1820.810] (-1824.648) (-1825.669) (-1828.028) -- 0:01:45
205000 -- (-1828.084) [-1832.449] (-1825.764) (-1830.781) * (-1825.661) [-1827.977] (-1825.988) (-1824.806) -- 0:01:44
Average standard deviation of split frequencies: 0.013273
205500 -- [-1830.007] (-1834.478) (-1824.161) (-1828.421) * [-1825.716] (-1827.510) (-1828.067) (-1827.067) -- 0:01:44
206000 -- (-1819.818) (-1830.561) [-1827.671] (-1822.256) * [-1820.384] (-1830.725) (-1828.225) (-1825.980) -- 0:01:44
206500 -- [-1822.183] (-1830.032) (-1824.594) (-1836.509) * (-1826.112) [-1827.650] (-1829.809) (-1828.328) -- 0:01:43
207000 -- (-1824.252) (-1840.100) (-1823.191) [-1829.247] * (-1825.292) [-1825.917] (-1829.405) (-1833.228) -- 0:01:43
207500 -- (-1840.911) (-1826.205) (-1827.261) [-1828.436] * (-1832.443) [-1827.446] (-1827.078) (-1828.967) -- 0:01:43
208000 -- (-1832.776) [-1826.846] (-1834.279) (-1835.440) * (-1825.814) [-1831.821] (-1835.021) (-1823.511) -- 0:01:42
208500 -- (-1829.143) (-1829.683) [-1824.142] (-1827.881) * (-1828.259) (-1828.495) (-1824.406) [-1822.390] -- 0:01:46
209000 -- (-1827.653) (-1825.475) (-1818.828) [-1825.524] * (-1824.551) (-1829.423) [-1826.823] (-1825.143) -- 0:01:45
209500 -- (-1829.373) (-1824.660) (-1826.883) [-1823.172] * (-1832.902) [-1837.100] (-1828.167) (-1830.906) -- 0:01:45
210000 -- (-1827.695) [-1822.919] (-1832.708) (-1826.763) * (-1830.114) [-1840.538] (-1828.002) (-1824.658) -- 0:01:45
Average standard deviation of split frequencies: 0.014048
210500 -- (-1830.998) (-1823.535) (-1823.558) [-1824.704] * (-1837.760) (-1836.159) (-1823.028) [-1829.694] -- 0:01:45
211000 -- (-1828.110) [-1824.516] (-1825.546) (-1824.818) * (-1825.966) (-1823.089) (-1824.510) [-1825.078] -- 0:01:44
211500 -- (-1827.429) (-1828.746) [-1819.026] (-1820.256) * (-1823.441) [-1826.855] (-1830.993) (-1824.535) -- 0:01:44
212000 -- (-1823.799) (-1833.848) [-1823.300] (-1821.328) * [-1827.201] (-1825.847) (-1822.290) (-1820.596) -- 0:01:44
212500 -- [-1824.964] (-1832.157) (-1824.838) (-1824.294) * (-1831.042) (-1821.166) [-1827.753] (-1827.345) -- 0:01:43
213000 -- (-1824.886) (-1831.239) [-1823.251] (-1821.085) * (-1823.054) [-1821.126] (-1825.893) (-1820.869) -- 0:01:43
213500 -- (-1824.336) [-1825.993] (-1820.258) (-1826.331) * (-1836.850) (-1828.742) (-1831.656) [-1826.808] -- 0:01:43
214000 -- (-1830.462) (-1829.545) [-1825.592] (-1826.201) * (-1821.455) (-1831.666) (-1827.301) [-1822.713] -- 0:01:42
214500 -- (-1826.773) [-1828.814] (-1825.950) (-1823.846) * (-1821.988) (-1822.590) (-1828.720) [-1829.541] -- 0:01:42
215000 -- (-1821.875) (-1823.635) (-1827.545) [-1820.727] * (-1826.549) (-1833.737) [-1830.973] (-1822.886) -- 0:01:42
Average standard deviation of split frequencies: 0.013504
215500 -- (-1827.423) (-1829.087) [-1820.258] (-1822.981) * (-1827.514) [-1822.084] (-1824.963) (-1831.260) -- 0:01:41
216000 -- (-1827.284) (-1819.930) [-1831.300] (-1824.176) * [-1829.307] (-1827.609) (-1823.358) (-1823.559) -- 0:01:45
216500 -- (-1825.249) [-1823.499] (-1829.862) (-1818.873) * (-1826.668) (-1825.217) [-1822.644] (-1828.976) -- 0:01:44
217000 -- (-1827.346) (-1828.164) (-1827.804) [-1825.865] * (-1829.140) [-1820.971] (-1823.182) (-1833.242) -- 0:01:44
217500 -- (-1823.762) (-1822.272) (-1825.237) [-1825.159] * (-1827.065) (-1827.197) [-1820.006] (-1827.328) -- 0:01:44
218000 -- (-1828.537) [-1827.051] (-1824.979) (-1823.123) * (-1828.556) [-1824.089] (-1830.321) (-1821.255) -- 0:01:44
218500 -- (-1827.319) [-1818.992] (-1827.653) (-1825.287) * (-1825.502) [-1824.508] (-1823.687) (-1832.931) -- 0:01:43
219000 -- (-1824.375) (-1826.743) (-1823.882) [-1821.424] * [-1826.288] (-1820.800) (-1823.820) (-1825.891) -- 0:01:43
219500 -- (-1824.274) [-1828.631] (-1824.825) (-1824.657) * [-1826.687] (-1824.993) (-1822.370) (-1833.180) -- 0:01:43
220000 -- (-1820.625) [-1823.292] (-1831.284) (-1822.631) * (-1824.125) (-1824.556) (-1826.692) [-1825.668] -- 0:01:42
Average standard deviation of split frequencies: 0.013352
220500 -- (-1826.458) (-1823.605) [-1825.388] (-1835.715) * (-1827.408) (-1819.911) (-1833.199) [-1825.409] -- 0:01:42
221000 -- (-1829.693) (-1828.975) (-1827.532) [-1824.705] * (-1829.163) [-1823.000] (-1836.257) (-1829.555) -- 0:01:42
221500 -- [-1825.875] (-1829.524) (-1830.102) (-1833.614) * [-1830.168] (-1824.355) (-1831.290) (-1823.607) -- 0:01:41
222000 -- [-1824.172] (-1827.201) (-1825.068) (-1830.596) * (-1830.275) [-1829.214] (-1838.347) (-1829.488) -- 0:01:41
222500 -- [-1824.869] (-1831.515) (-1825.651) (-1826.127) * (-1830.905) [-1823.901] (-1826.018) (-1832.940) -- 0:01:41
223000 -- (-1825.419) [-1827.902] (-1829.013) (-1828.524) * (-1832.599) [-1825.136] (-1817.301) (-1830.448) -- 0:01:41
223500 -- (-1830.531) (-1833.307) (-1826.367) [-1822.139] * [-1829.680] (-1828.132) (-1822.910) (-1825.193) -- 0:01:44
224000 -- [-1822.174] (-1828.367) (-1831.942) (-1823.974) * (-1822.495) (-1821.777) [-1821.099] (-1842.521) -- 0:01:43
224500 -- [-1826.836] (-1830.375) (-1830.751) (-1825.312) * (-1827.219) [-1822.187] (-1826.616) (-1823.244) -- 0:01:43
225000 -- [-1824.141] (-1828.531) (-1827.828) (-1825.572) * (-1821.573) (-1830.207) [-1824.826] (-1820.229) -- 0:01:43
Average standard deviation of split frequencies: 0.014233
225500 -- [-1825.690] (-1831.207) (-1827.301) (-1832.618) * (-1829.517) (-1821.749) (-1825.361) [-1824.833] -- 0:01:43
226000 -- [-1825.787] (-1824.524) (-1823.747) (-1820.166) * (-1818.650) [-1826.175] (-1827.453) (-1827.001) -- 0:01:42
226500 -- (-1828.307) (-1823.795) (-1828.737) [-1823.412] * [-1830.264] (-1826.741) (-1838.277) (-1825.881) -- 0:01:42
227000 -- (-1838.274) (-1828.743) (-1828.256) [-1823.123] * (-1824.944) (-1833.825) [-1829.036] (-1825.358) -- 0:01:42
227500 -- (-1822.835) (-1825.393) (-1830.416) [-1820.854] * (-1826.463) [-1826.869] (-1827.762) (-1828.743) -- 0:01:41
228000 -- (-1826.330) (-1827.942) (-1835.997) [-1825.344] * (-1826.713) [-1825.629] (-1831.145) (-1831.514) -- 0:01:41
228500 -- (-1831.137) (-1825.705) (-1829.947) [-1831.407] * (-1826.820) [-1820.882] (-1833.885) (-1826.048) -- 0:01:41
229000 -- [-1823.934] (-1825.892) (-1828.455) (-1825.897) * [-1821.777] (-1832.819) (-1826.764) (-1822.166) -- 0:01:41
229500 -- (-1832.696) (-1834.937) [-1823.200] (-1822.548) * (-1830.957) (-1822.950) [-1821.605] (-1822.915) -- 0:01:40
230000 -- (-1827.900) (-1830.284) [-1830.517] (-1826.393) * (-1824.732) (-1822.808) (-1825.279) [-1824.471] -- 0:01:40
Average standard deviation of split frequencies: 0.014413
230500 -- (-1825.142) (-1831.599) (-1827.781) [-1821.018] * (-1826.824) (-1827.261) (-1821.533) [-1822.988] -- 0:01:40
231000 -- (-1824.084) (-1829.791) (-1833.365) [-1820.876] * (-1826.983) (-1828.548) (-1830.701) [-1828.520] -- 0:01:43
231500 -- [-1821.876] (-1835.779) (-1835.843) (-1827.555) * (-1837.674) (-1830.786) (-1831.864) [-1822.309] -- 0:01:42
232000 -- (-1823.104) (-1821.265) (-1831.343) [-1821.294] * (-1832.868) (-1825.113) [-1824.408] (-1822.767) -- 0:01:42
232500 -- (-1827.455) (-1824.501) (-1841.163) [-1831.725] * (-1822.133) (-1824.549) (-1832.503) [-1821.602] -- 0:01:42
233000 -- [-1825.086] (-1828.862) (-1836.803) (-1821.821) * [-1823.635] (-1829.174) (-1830.997) (-1820.364) -- 0:01:42
233500 -- [-1824.492] (-1836.627) (-1833.334) (-1826.219) * (-1826.368) (-1823.313) [-1824.766] (-1822.890) -- 0:01:41
234000 -- (-1829.854) (-1827.073) (-1830.622) [-1824.082] * [-1828.344] (-1819.152) (-1829.302) (-1822.400) -- 0:01:41
234500 -- (-1826.724) (-1835.143) [-1825.164] (-1824.575) * [-1826.440] (-1828.917) (-1825.511) (-1839.153) -- 0:01:41
235000 -- (-1829.545) [-1826.464] (-1821.798) (-1824.975) * (-1825.992) [-1819.076] (-1837.691) (-1828.230) -- 0:01:40
Average standard deviation of split frequencies: 0.014981
235500 -- (-1826.914) (-1823.456) (-1830.826) [-1822.381] * [-1826.310] (-1832.257) (-1833.892) (-1834.544) -- 0:01:40
236000 -- (-1827.207) [-1824.877] (-1831.584) (-1831.686) * (-1822.120) (-1826.713) [-1821.433] (-1831.264) -- 0:01:40
236500 -- (-1832.192) (-1821.795) (-1831.030) [-1823.548] * (-1829.181) (-1824.102) [-1820.250] (-1833.173) -- 0:01:40
237000 -- (-1831.345) [-1821.511] (-1830.176) (-1822.721) * (-1829.639) [-1825.171] (-1834.821) (-1828.068) -- 0:01:39
237500 -- [-1822.736] (-1824.486) (-1834.377) (-1828.290) * (-1830.517) [-1829.313] (-1825.731) (-1836.105) -- 0:01:39
238000 -- (-1828.412) (-1832.848) [-1826.749] (-1832.044) * (-1826.699) (-1822.698) (-1826.267) [-1821.046] -- 0:01:39
238500 -- (-1830.881) (-1829.370) [-1835.046] (-1825.742) * (-1833.465) (-1837.887) (-1841.026) [-1821.693] -- 0:01:42
239000 -- (-1833.862) (-1818.583) [-1824.374] (-1835.527) * [-1827.138] (-1824.425) (-1829.789) (-1827.795) -- 0:01:41
239500 -- (-1824.952) (-1828.186) (-1832.038) [-1832.392] * [-1827.280] (-1822.492) (-1831.121) (-1827.470) -- 0:01:41
240000 -- (-1830.009) [-1830.008] (-1825.465) (-1826.989) * (-1824.989) [-1825.606] (-1830.078) (-1828.550) -- 0:01:41
Average standard deviation of split frequencies: 0.015361
240500 -- (-1822.735) (-1825.486) (-1828.130) [-1826.839] * [-1823.926] (-1832.514) (-1822.071) (-1817.671) -- 0:01:41
241000 -- [-1823.690] (-1829.869) (-1826.847) (-1832.079) * (-1824.190) (-1835.456) (-1831.690) [-1830.950] -- 0:01:40
241500 -- (-1819.925) (-1823.958) [-1824.797] (-1831.188) * [-1826.844] (-1825.909) (-1829.163) (-1828.543) -- 0:01:40
242000 -- (-1824.603) (-1821.722) [-1818.008] (-1825.839) * (-1826.200) [-1827.777] (-1829.742) (-1824.707) -- 0:01:40
242500 -- [-1820.404] (-1836.167) (-1825.711) (-1834.963) * [-1828.062] (-1827.464) (-1833.257) (-1827.507) -- 0:01:39
243000 -- (-1829.699) (-1821.740) [-1827.706] (-1823.330) * [-1827.045] (-1825.165) (-1831.381) (-1831.648) -- 0:01:39
243500 -- (-1825.262) (-1828.792) (-1827.617) [-1824.921] * (-1828.207) [-1827.907] (-1829.137) (-1831.113) -- 0:01:39
244000 -- (-1826.595) (-1820.406) [-1825.704] (-1826.402) * (-1826.000) (-1827.704) [-1826.134] (-1825.372) -- 0:01:39
244500 -- (-1828.446) (-1827.709) (-1824.173) [-1827.453] * (-1832.154) [-1825.332] (-1823.491) (-1824.039) -- 0:01:38
245000 -- [-1822.169] (-1834.893) (-1832.123) (-1824.487) * (-1830.885) [-1823.733] (-1825.634) (-1835.563) -- 0:01:38
Average standard deviation of split frequencies: 0.015229
245500 -- (-1823.359) (-1831.162) [-1828.608] (-1827.292) * (-1830.213) (-1823.306) [-1828.865] (-1821.876) -- 0:01:41
246000 -- (-1827.102) (-1838.085) (-1830.358) [-1824.973] * [-1828.407] (-1822.869) (-1824.849) (-1827.169) -- 0:01:41
246500 -- (-1829.703) (-1825.856) [-1822.683] (-1819.656) * (-1831.817) [-1836.227] (-1820.486) (-1833.144) -- 0:01:40
247000 -- (-1831.554) [-1823.370] (-1828.932) (-1826.346) * (-1829.978) [-1824.513] (-1830.236) (-1831.687) -- 0:01:40
247500 -- (-1829.851) (-1828.798) [-1825.942] (-1827.887) * (-1838.985) (-1828.551) (-1828.391) [-1824.373] -- 0:01:40
248000 -- (-1823.383) (-1835.122) [-1822.805] (-1823.850) * (-1821.100) (-1832.108) [-1828.234] (-1825.868) -- 0:01:40
248500 -- [-1826.557] (-1829.712) (-1831.576) (-1825.264) * (-1826.252) (-1826.044) [-1828.274] (-1837.857) -- 0:01:39
249000 -- (-1825.690) (-1835.662) (-1824.031) [-1825.320] * [-1830.024] (-1823.373) (-1832.864) (-1831.748) -- 0:01:39
249500 -- [-1820.551] (-1831.881) (-1826.901) (-1823.546) * (-1829.753) (-1827.159) (-1822.533) [-1825.842] -- 0:01:39
250000 -- (-1827.972) [-1833.976] (-1829.208) (-1823.945) * (-1831.517) (-1830.814) [-1819.804] (-1822.708) -- 0:01:39
Average standard deviation of split frequencies: 0.015837
250500 -- (-1824.267) (-1823.078) [-1825.062] (-1828.345) * (-1830.216) (-1840.235) (-1820.422) [-1825.645] -- 0:01:38
251000 -- (-1827.520) (-1823.099) (-1820.228) [-1824.698] * (-1835.192) (-1826.609) (-1830.071) [-1822.322] -- 0:01:38
251500 -- (-1819.506) (-1820.145) (-1827.735) [-1822.113] * [-1821.932] (-1826.583) (-1832.370) (-1830.591) -- 0:01:38
252000 -- (-1823.786) (-1831.785) [-1822.986] (-1825.637) * (-1824.839) (-1833.072) (-1826.951) [-1825.123] -- 0:01:37
252500 -- (-1832.000) (-1827.498) (-1829.226) [-1824.544] * [-1824.264] (-1834.094) (-1827.320) (-1826.301) -- 0:01:37
253000 -- (-1826.675) [-1824.875] (-1829.521) (-1836.857) * [-1821.061] (-1825.064) (-1834.189) (-1829.745) -- 0:01:37
253500 -- (-1836.698) (-1825.024) [-1825.929] (-1825.268) * (-1823.993) [-1820.290] (-1826.241) (-1832.300) -- 0:01:40
254000 -- (-1826.930) (-1831.710) [-1826.173] (-1834.605) * (-1828.580) [-1820.272] (-1826.608) (-1828.216) -- 0:01:39
254500 -- [-1825.687] (-1822.997) (-1827.715) (-1820.840) * (-1824.942) (-1829.914) (-1832.545) [-1831.808] -- 0:01:39
255000 -- (-1841.402) (-1822.594) [-1826.167] (-1830.909) * (-1829.995) (-1824.767) [-1828.882] (-1837.615) -- 0:01:39
Average standard deviation of split frequencies: 0.015652
255500 -- (-1820.886) (-1824.950) [-1823.582] (-1827.351) * (-1830.217) [-1821.485] (-1823.623) (-1831.483) -- 0:01:39
256000 -- (-1821.429) (-1829.778) [-1829.752] (-1818.826) * (-1821.525) [-1832.260] (-1826.069) (-1828.739) -- 0:01:38
256500 -- (-1828.840) (-1826.416) [-1829.814] (-1826.042) * (-1828.830) (-1825.253) [-1831.467] (-1829.821) -- 0:01:38
257000 -- (-1828.302) [-1826.167] (-1828.341) (-1834.726) * [-1825.710] (-1828.000) (-1825.022) (-1824.535) -- 0:01:38
257500 -- (-1828.724) [-1823.177] (-1825.755) (-1832.924) * (-1828.771) (-1829.687) (-1827.244) [-1828.850] -- 0:01:38
258000 -- (-1829.139) [-1825.447] (-1821.473) (-1824.675) * (-1833.937) (-1826.215) [-1836.999] (-1831.218) -- 0:01:37
258500 -- (-1827.907) (-1828.524) [-1821.689] (-1831.517) * (-1833.731) [-1827.749] (-1826.456) (-1829.510) -- 0:01:37
259000 -- (-1825.698) (-1828.159) [-1824.153] (-1827.979) * (-1837.550) (-1826.503) (-1834.324) [-1834.366] -- 0:01:37
259500 -- [-1819.288] (-1833.969) (-1826.384) (-1831.075) * (-1826.159) [-1825.689] (-1827.178) (-1828.757) -- 0:01:37
260000 -- (-1827.560) [-1822.727] (-1822.956) (-1824.929) * (-1827.629) (-1825.001) (-1831.429) [-1821.528] -- 0:01:36
Average standard deviation of split frequencies: 0.015744
260500 -- (-1825.695) (-1827.828) (-1825.212) [-1825.728] * (-1842.845) [-1826.003] (-1825.017) (-1827.814) -- 0:01:39
261000 -- (-1821.993) [-1822.408] (-1835.867) (-1831.672) * (-1835.536) (-1826.262) (-1828.224) [-1826.010] -- 0:01:39
261500 -- (-1819.133) [-1827.155] (-1826.989) (-1828.359) * (-1840.053) (-1828.397) [-1822.297] (-1832.188) -- 0:01:38
262000 -- [-1825.326] (-1825.052) (-1820.635) (-1829.751) * [-1824.508] (-1835.852) (-1823.245) (-1831.753) -- 0:01:38
262500 -- [-1824.911] (-1827.536) (-1835.009) (-1827.949) * (-1834.947) (-1828.280) [-1826.416] (-1825.135) -- 0:01:38
263000 -- (-1824.726) [-1829.669] (-1830.161) (-1825.050) * (-1827.650) (-1831.511) [-1826.400] (-1822.910) -- 0:01:38
263500 -- [-1824.195] (-1829.034) (-1828.969) (-1829.862) * (-1829.382) (-1821.163) (-1826.994) [-1826.178] -- 0:01:37
264000 -- (-1828.980) (-1823.900) (-1826.971) [-1820.964] * [-1825.531] (-1823.256) (-1827.363) (-1828.156) -- 0:01:37
264500 -- (-1833.202) [-1824.635] (-1844.899) (-1830.116) * (-1836.851) (-1821.313) [-1823.846] (-1831.999) -- 0:01:37
265000 -- (-1829.317) [-1827.228] (-1826.415) (-1823.362) * (-1834.977) (-1823.643) (-1823.982) [-1827.880] -- 0:01:37
Average standard deviation of split frequencies: 0.015637
265500 -- (-1835.708) (-1827.227) (-1831.427) [-1824.261] * (-1831.171) (-1827.693) (-1819.331) [-1825.411] -- 0:01:36
266000 -- (-1826.728) (-1824.746) [-1820.895] (-1838.403) * (-1822.760) [-1825.985] (-1827.446) (-1830.941) -- 0:01:36
266500 -- (-1828.726) (-1835.704) (-1829.569) [-1825.855] * [-1826.093] (-1822.058) (-1821.994) (-1835.436) -- 0:01:36
267000 -- (-1824.153) [-1822.621] (-1822.000) (-1829.570) * (-1835.328) (-1825.350) [-1829.411] (-1828.822) -- 0:01:36
267500 -- (-1832.250) (-1835.899) (-1828.119) [-1823.372] * [-1822.948] (-1824.949) (-1826.654) (-1833.762) -- 0:01:35
268000 -- [-1826.395] (-1826.564) (-1829.583) (-1830.542) * (-1824.831) (-1825.811) [-1834.315] (-1827.519) -- 0:01:38
268500 -- (-1833.515) [-1828.610] (-1831.449) (-1822.464) * (-1824.427) [-1825.909] (-1835.003) (-1829.407) -- 0:01:38
269000 -- (-1828.233) (-1825.367) (-1826.674) [-1825.147] * (-1826.656) [-1823.508] (-1829.781) (-1823.591) -- 0:01:37
269500 -- (-1826.631) (-1824.323) [-1827.341] (-1830.814) * (-1830.251) (-1827.503) (-1835.337) [-1834.606] -- 0:01:37
270000 -- [-1823.057] (-1836.343) (-1824.710) (-1840.178) * [-1828.827] (-1823.055) (-1822.575) (-1831.213) -- 0:01:37
Average standard deviation of split frequencies: 0.016187
270500 -- (-1828.390) (-1823.285) (-1831.651) [-1836.212] * (-1824.450) [-1825.080] (-1822.366) (-1827.409) -- 0:01:37
271000 -- (-1825.698) (-1822.572) [-1822.966] (-1835.368) * (-1825.903) (-1830.219) (-1829.256) [-1823.864] -- 0:01:36
271500 -- (-1832.344) (-1824.378) [-1836.037] (-1827.920) * (-1825.728) (-1834.888) (-1832.734) [-1825.954] -- 0:01:36
272000 -- (-1828.650) (-1832.683) (-1827.001) [-1826.111] * [-1827.798] (-1825.971) (-1830.270) (-1835.774) -- 0:01:36
272500 -- [-1830.680] (-1823.993) (-1828.210) (-1825.559) * (-1829.098) [-1829.327] (-1827.590) (-1834.307) -- 0:01:36
273000 -- (-1825.618) [-1827.272] (-1820.267) (-1823.206) * (-1826.124) [-1827.356] (-1824.687) (-1821.004) -- 0:01:35
273500 -- (-1824.537) [-1821.653] (-1824.566) (-1840.348) * (-1835.591) (-1827.809) [-1827.576] (-1823.023) -- 0:01:35
274000 -- (-1825.770) [-1826.763] (-1827.544) (-1827.283) * (-1821.918) [-1831.482] (-1825.906) (-1827.662) -- 0:01:35
274500 -- (-1833.448) [-1826.466] (-1833.926) (-1822.313) * [-1820.855] (-1832.258) (-1826.888) (-1823.774) -- 0:01:35
275000 -- (-1822.811) (-1825.983) [-1826.557] (-1827.610) * (-1829.373) (-1830.854) (-1827.318) [-1827.544] -- 0:01:34
Average standard deviation of split frequencies: 0.015774
275500 -- (-1827.695) [-1822.991] (-1828.192) (-1838.824) * (-1828.674) (-1831.579) (-1824.427) [-1827.237] -- 0:01:37
276000 -- (-1824.091) [-1824.918] (-1828.938) (-1822.311) * (-1828.695) (-1825.465) (-1831.954) [-1825.253] -- 0:01:37
276500 -- (-1832.454) (-1826.496) [-1820.871] (-1826.068) * [-1830.204] (-1830.598) (-1837.415) (-1823.927) -- 0:01:36
277000 -- (-1831.714) [-1827.325] (-1825.009) (-1822.974) * (-1836.920) [-1822.661] (-1826.248) (-1831.661) -- 0:01:36
277500 -- [-1824.027] (-1830.148) (-1832.902) (-1828.418) * (-1827.109) (-1831.437) (-1824.007) [-1821.179] -- 0:01:36
278000 -- [-1829.234] (-1829.867) (-1827.989) (-1826.139) * (-1835.592) (-1826.145) [-1824.820] (-1838.674) -- 0:01:36
278500 -- (-1823.842) (-1825.506) [-1829.072] (-1827.981) * [-1830.193] (-1830.075) (-1824.841) (-1823.064) -- 0:01:35
279000 -- (-1823.402) (-1831.577) [-1824.830] (-1828.286) * [-1824.326] (-1832.600) (-1830.122) (-1826.785) -- 0:01:35
279500 -- (-1835.894) (-1821.711) (-1834.154) [-1820.209] * (-1833.510) [-1833.566] (-1829.933) (-1828.125) -- 0:01:35
280000 -- [-1827.239] (-1824.044) (-1832.619) (-1824.137) * (-1822.173) (-1830.338) [-1825.882] (-1833.389) -- 0:01:35
Average standard deviation of split frequencies: 0.014425
280500 -- [-1823.065] (-1830.703) (-1827.104) (-1836.988) * (-1832.161) [-1826.850] (-1832.264) (-1827.567) -- 0:01:34
281000 -- (-1835.802) (-1825.899) [-1826.189] (-1827.188) * [-1827.482] (-1827.132) (-1827.502) (-1835.915) -- 0:01:34
281500 -- (-1824.598) [-1831.404] (-1822.303) (-1825.900) * [-1826.185] (-1828.150) (-1831.556) (-1835.733) -- 0:01:34
282000 -- (-1831.000) [-1825.818] (-1830.305) (-1826.890) * (-1826.842) (-1822.011) [-1820.533] (-1834.545) -- 0:01:34
282500 -- [-1825.341] (-1825.629) (-1831.874) (-1826.464) * (-1832.967) (-1825.319) [-1825.550] (-1821.453) -- 0:01:33
283000 -- (-1822.397) [-1823.929] (-1823.772) (-1827.104) * (-1824.700) (-1840.771) [-1827.342] (-1835.041) -- 0:01:36
283500 -- (-1825.013) (-1823.833) (-1822.197) [-1823.462] * [-1824.847] (-1833.235) (-1824.540) (-1827.859) -- 0:01:36
284000 -- [-1824.967] (-1827.031) (-1822.833) (-1820.864) * (-1830.727) [-1823.793] (-1830.409) (-1823.331) -- 0:01:35
284500 -- [-1829.072] (-1825.719) (-1834.377) (-1824.505) * (-1828.823) (-1826.651) (-1826.467) [-1825.487] -- 0:01:35
285000 -- (-1832.788) [-1829.414] (-1834.279) (-1824.790) * (-1835.011) (-1825.752) (-1831.518) [-1820.629] -- 0:01:35
Average standard deviation of split frequencies: 0.014102
285500 -- (-1827.354) (-1827.623) (-1824.389) [-1824.520] * (-1822.715) [-1828.809] (-1825.145) (-1827.315) -- 0:01:35
286000 -- (-1835.237) (-1824.847) [-1827.304] (-1828.347) * (-1825.739) (-1823.204) (-1822.462) [-1827.941] -- 0:01:34
286500 -- (-1831.115) [-1826.999] (-1831.256) (-1827.003) * (-1824.560) (-1833.445) [-1825.503] (-1825.488) -- 0:01:34
287000 -- (-1829.742) (-1829.503) (-1831.711) [-1829.445] * (-1830.311) (-1822.640) (-1819.226) [-1822.537] -- 0:01:34
287500 -- (-1831.600) [-1819.780] (-1822.691) (-1835.707) * (-1824.595) [-1822.629] (-1833.782) (-1819.831) -- 0:01:34
288000 -- (-1822.660) (-1824.799) [-1823.395] (-1825.530) * (-1825.155) [-1824.253] (-1829.647) (-1829.838) -- 0:01:33
288500 -- (-1832.693) [-1823.985] (-1829.345) (-1829.164) * (-1826.433) [-1821.185] (-1825.074) (-1831.206) -- 0:01:33
289000 -- (-1835.499) (-1830.934) (-1829.558) [-1818.357] * (-1829.482) (-1823.925) (-1835.209) [-1827.824] -- 0:01:33
289500 -- (-1821.169) (-1827.169) (-1829.965) [-1832.577] * [-1828.986] (-1826.274) (-1825.448) (-1825.827) -- 0:01:33
290000 -- (-1819.764) (-1829.883) [-1830.052] (-1827.527) * (-1824.119) (-1831.250) (-1832.049) [-1819.451] -- 0:01:33
Average standard deviation of split frequencies: 0.014957
290500 -- (-1822.795) (-1831.671) (-1828.278) [-1826.178] * [-1828.652] (-1831.322) (-1825.924) (-1833.969) -- 0:01:35
291000 -- (-1821.417) [-1821.783] (-1843.962) (-1828.348) * (-1836.601) [-1826.470] (-1825.519) (-1823.540) -- 0:01:35
291500 -- (-1828.513) (-1824.401) (-1833.332) [-1829.757] * [-1831.108] (-1826.710) (-1827.180) (-1828.967) -- 0:01:34
292000 -- [-1827.717] (-1827.144) (-1827.685) (-1822.370) * [-1833.278] (-1821.304) (-1828.872) (-1829.387) -- 0:01:34
292500 -- (-1820.342) (-1834.078) [-1821.831] (-1825.504) * (-1830.908) (-1822.283) (-1828.250) [-1829.091] -- 0:01:34
293000 -- (-1830.820) [-1828.058] (-1832.517) (-1838.414) * (-1833.287) (-1826.380) [-1826.889] (-1828.477) -- 0:01:34
293500 -- [-1824.680] (-1828.424) (-1829.519) (-1822.920) * [-1831.263] (-1821.500) (-1826.783) (-1842.908) -- 0:01:33
294000 -- (-1830.845) (-1824.561) [-1830.820] (-1831.018) * (-1830.657) (-1830.537) [-1824.163] (-1832.879) -- 0:01:33
294500 -- (-1828.402) (-1826.105) (-1821.294) [-1828.188] * (-1826.076) (-1830.276) (-1834.975) [-1828.999] -- 0:01:33
295000 -- (-1841.138) (-1827.615) [-1825.188] (-1830.976) * (-1832.814) (-1835.272) [-1821.518] (-1833.416) -- 0:01:33
Average standard deviation of split frequencies: 0.013584
295500 -- (-1827.473) (-1827.985) [-1821.534] (-1829.566) * (-1831.270) (-1832.637) [-1822.192] (-1826.586) -- 0:01:32
296000 -- (-1826.740) [-1836.178] (-1823.268) (-1829.659) * (-1827.308) (-1838.871) [-1821.514] (-1830.755) -- 0:01:32
296500 -- (-1829.536) [-1819.319] (-1822.313) (-1834.525) * (-1826.540) (-1826.033) (-1825.100) [-1829.148] -- 0:01:32
297000 -- (-1831.872) (-1824.595) [-1831.218] (-1828.805) * (-1825.862) (-1827.636) (-1818.881) [-1823.860] -- 0:01:32
297500 -- (-1836.488) (-1826.594) (-1824.109) [-1819.175] * (-1823.322) (-1827.437) [-1829.435] (-1820.541) -- 0:01:32
298000 -- [-1828.506] (-1830.781) (-1822.459) (-1823.604) * (-1824.404) [-1822.420] (-1834.005) (-1830.324) -- 0:01:34
298500 -- (-1834.356) [-1821.069] (-1827.710) (-1826.255) * (-1821.890) [-1824.642] (-1833.249) (-1827.885) -- 0:01:34
299000 -- (-1834.214) [-1822.770] (-1817.435) (-1827.928) * (-1828.328) (-1829.919) (-1837.974) [-1825.511] -- 0:01:33
299500 -- (-1826.434) [-1837.719] (-1824.395) (-1821.101) * (-1828.059) (-1834.293) [-1829.682] (-1830.571) -- 0:01:33
300000 -- (-1832.344) (-1825.740) [-1826.285] (-1823.112) * (-1837.406) [-1823.861] (-1839.519) (-1825.860) -- 0:01:33
Average standard deviation of split frequencies: 0.014387
300500 -- [-1829.839] (-1823.287) (-1828.177) (-1826.517) * (-1824.665) (-1846.378) (-1828.672) [-1822.079] -- 0:01:33
301000 -- (-1835.549) (-1835.718) [-1826.132] (-1830.854) * (-1830.429) [-1825.502] (-1828.937) (-1829.078) -- 0:01:32
301500 -- (-1823.992) (-1823.055) [-1820.227] (-1828.004) * [-1823.107] (-1823.499) (-1833.989) (-1830.929) -- 0:01:32
302000 -- [-1825.254] (-1830.344) (-1819.422) (-1825.645) * (-1826.453) (-1819.166) (-1822.229) [-1822.683] -- 0:01:32
302500 -- (-1833.365) (-1828.611) (-1830.409) [-1822.663] * (-1828.584) [-1828.985] (-1843.014) (-1823.789) -- 0:01:32
303000 -- [-1825.818] (-1833.740) (-1835.078) (-1822.197) * (-1834.548) [-1822.280] (-1836.109) (-1823.347) -- 0:01:32
303500 -- (-1832.608) (-1830.921) [-1824.370] (-1828.830) * (-1830.921) (-1823.070) (-1827.111) [-1824.453] -- 0:01:31
304000 -- [-1826.218] (-1834.349) (-1824.477) (-1822.631) * [-1828.894] (-1827.988) (-1836.389) (-1824.448) -- 0:01:31
304500 -- [-1824.446] (-1827.599) (-1821.051) (-1828.903) * (-1828.147) (-1823.237) (-1837.073) [-1826.723] -- 0:01:31
305000 -- (-1824.120) (-1827.490) (-1825.461) [-1823.286] * [-1816.819] (-1828.222) (-1829.835) (-1833.091) -- 0:01:31
Average standard deviation of split frequencies: 0.013480
305500 -- (-1827.882) [-1826.821] (-1822.479) (-1826.553) * (-1825.557) [-1823.904] (-1829.489) (-1821.327) -- 0:01:33
306000 -- [-1829.031] (-1829.994) (-1840.770) (-1838.255) * (-1824.169) (-1826.430) (-1828.751) [-1826.088] -- 0:01:32
306500 -- (-1833.884) (-1829.062) (-1822.294) [-1827.382] * (-1833.656) [-1821.499] (-1827.076) (-1826.722) -- 0:01:32
307000 -- (-1837.511) (-1834.671) (-1824.339) [-1829.604] * (-1831.402) (-1833.299) [-1824.894] (-1821.325) -- 0:01:32
307500 -- (-1830.028) (-1833.377) (-1827.500) [-1832.648] * (-1824.648) (-1831.184) (-1828.952) [-1825.689] -- 0:01:32
308000 -- (-1830.342) (-1827.612) [-1828.185] (-1828.341) * (-1831.138) (-1836.856) (-1826.440) [-1822.567] -- 0:01:32
308500 -- (-1825.820) [-1832.842] (-1826.252) (-1826.682) * (-1833.119) (-1824.672) (-1827.060) [-1822.925] -- 0:01:31
309000 -- (-1839.415) (-1830.921) (-1829.325) [-1832.087] * (-1822.281) (-1830.814) [-1823.558] (-1821.882) -- 0:01:31
309500 -- (-1825.006) (-1823.016) (-1824.320) [-1821.070] * [-1822.048] (-1828.457) (-1821.546) (-1826.366) -- 0:01:31
310000 -- (-1824.864) (-1823.662) (-1826.433) [-1827.794] * [-1829.441] (-1831.859) (-1833.766) (-1829.218) -- 0:01:31
Average standard deviation of split frequencies: 0.013182
310500 -- (-1832.103) (-1837.369) (-1832.791) [-1826.022] * (-1823.271) [-1823.229] (-1826.913) (-1825.093) -- 0:01:31
311000 -- (-1823.844) (-1826.178) [-1823.341] (-1829.574) * [-1833.359] (-1822.787) (-1828.595) (-1835.372) -- 0:01:30
311500 -- [-1822.591] (-1828.406) (-1825.129) (-1838.657) * [-1826.966] (-1821.763) (-1825.795) (-1836.447) -- 0:01:30
312000 -- [-1826.554] (-1825.858) (-1822.848) (-1829.107) * (-1824.745) (-1825.914) [-1822.774] (-1824.222) -- 0:01:30
312500 -- (-1836.805) (-1828.931) [-1831.355] (-1822.576) * (-1824.816) (-1825.602) [-1830.184] (-1830.996) -- 0:01:30
313000 -- (-1822.636) (-1832.909) [-1820.487] (-1827.402) * (-1827.908) (-1828.164) [-1826.142] (-1828.672) -- 0:01:32
313500 -- (-1822.552) (-1824.130) [-1824.025] (-1828.568) * [-1827.322] (-1825.749) (-1827.494) (-1833.283) -- 0:01:31
314000 -- (-1839.401) (-1821.158) (-1829.035) [-1821.350] * (-1823.786) (-1820.201) (-1824.229) [-1827.371] -- 0:01:31
314500 -- [-1827.987] (-1822.211) (-1828.487) (-1824.305) * (-1822.712) [-1822.664] (-1827.751) (-1825.496) -- 0:01:31
315000 -- (-1823.139) (-1824.415) (-1825.784) [-1824.614] * [-1833.853] (-1828.756) (-1821.569) (-1827.814) -- 0:01:31
Average standard deviation of split frequencies: 0.012773
315500 -- [-1833.290] (-1831.485) (-1831.733) (-1830.233) * (-1820.179) (-1822.514) [-1826.842] (-1823.275) -- 0:01:31
316000 -- (-1824.139) (-1821.145) [-1829.241] (-1827.038) * [-1823.111] (-1825.094) (-1836.419) (-1829.783) -- 0:01:30
316500 -- [-1822.231] (-1824.795) (-1829.972) (-1828.460) * (-1824.643) [-1826.394] (-1836.134) (-1824.897) -- 0:01:30
317000 -- (-1830.058) (-1822.438) (-1832.472) [-1827.357] * [-1827.970] (-1831.473) (-1828.470) (-1825.268) -- 0:01:30
317500 -- (-1820.490) (-1826.315) (-1829.261) [-1822.931] * [-1823.161] (-1828.231) (-1823.952) (-1819.616) -- 0:01:30
318000 -- (-1831.165) (-1824.803) (-1821.954) [-1817.734] * (-1828.411) (-1827.822) [-1822.915] (-1821.227) -- 0:01:30
318500 -- (-1824.772) [-1824.054] (-1828.032) (-1829.279) * (-1826.278) [-1822.858] (-1829.774) (-1825.489) -- 0:01:29
319000 -- (-1824.324) (-1829.442) [-1829.768] (-1824.992) * (-1824.737) (-1829.939) [-1825.424] (-1829.300) -- 0:01:29
319500 -- (-1825.952) (-1826.042) (-1827.676) [-1826.920] * (-1840.019) [-1826.054] (-1827.107) (-1829.927) -- 0:01:29
320000 -- (-1823.372) (-1820.454) (-1828.444) [-1823.425] * (-1827.303) [-1825.403] (-1819.530) (-1823.936) -- 0:01:29
Average standard deviation of split frequencies: 0.011669
320500 -- (-1825.677) [-1829.415] (-1830.362) (-1826.071) * (-1824.421) (-1830.795) (-1828.550) [-1824.983] -- 0:01:31
321000 -- (-1832.087) [-1825.088] (-1841.570) (-1824.329) * (-1827.020) (-1830.804) [-1825.199] (-1826.109) -- 0:01:30
321500 -- (-1833.305) (-1820.410) (-1831.913) [-1825.424] * (-1827.096) [-1822.578] (-1830.584) (-1824.159) -- 0:01:30
322000 -- (-1825.485) (-1819.532) (-1827.553) [-1826.669] * (-1820.294) (-1826.374) (-1830.271) [-1832.665] -- 0:01:30
322500 -- (-1828.724) (-1824.017) (-1828.960) [-1821.920] * (-1824.641) (-1833.453) [-1831.840] (-1822.764) -- 0:01:30
323000 -- (-1826.584) (-1825.980) [-1834.569] (-1824.223) * [-1823.820] (-1822.882) (-1830.696) (-1828.847) -- 0:01:30
323500 -- [-1821.615] (-1826.652) (-1836.871) (-1824.502) * (-1826.795) [-1823.768] (-1828.902) (-1829.997) -- 0:01:29
324000 -- (-1827.692) (-1822.614) (-1832.049) [-1824.256] * (-1826.292) [-1828.391] (-1824.208) (-1836.299) -- 0:01:29
324500 -- (-1822.460) (-1826.785) [-1838.669] (-1826.416) * (-1822.172) (-1828.388) [-1828.127] (-1826.274) -- 0:01:29
325000 -- (-1827.587) [-1822.779] (-1835.078) (-1824.639) * [-1834.445] (-1827.460) (-1823.906) (-1827.289) -- 0:01:29
Average standard deviation of split frequencies: 0.011659
325500 -- (-1820.179) [-1821.689] (-1848.039) (-1825.242) * (-1825.328) [-1822.955] (-1831.464) (-1833.832) -- 0:01:29
326000 -- (-1826.691) [-1827.652] (-1828.669) (-1831.407) * (-1824.576) [-1825.013] (-1835.844) (-1836.791) -- 0:01:28
326500 -- (-1826.226) [-1828.378] (-1834.175) (-1827.291) * (-1829.062) (-1829.893) (-1829.126) [-1827.793] -- 0:01:28
327000 -- (-1824.795) (-1823.126) [-1831.905] (-1833.553) * (-1822.573) (-1829.541) (-1822.593) [-1832.620] -- 0:01:28
327500 -- [-1828.119] (-1825.611) (-1836.101) (-1825.337) * (-1825.146) (-1841.203) [-1819.648] (-1834.460) -- 0:01:28
328000 -- (-1824.890) [-1832.744] (-1826.714) (-1822.418) * (-1825.610) [-1825.432] (-1824.025) (-1827.758) -- 0:01:30
328500 -- (-1828.045) (-1826.067) (-1824.845) [-1832.804] * (-1832.249) (-1825.801) [-1820.810] (-1826.197) -- 0:01:29
329000 -- (-1828.734) [-1821.824] (-1827.167) (-1829.286) * (-1828.398) (-1820.899) [-1820.938] (-1828.431) -- 0:01:29
329500 -- (-1841.080) [-1829.732] (-1831.191) (-1826.148) * (-1839.062) [-1826.734] (-1829.689) (-1819.499) -- 0:01:29
330000 -- (-1823.594) (-1827.805) [-1825.991] (-1821.766) * (-1823.900) (-1821.402) (-1830.567) [-1826.461] -- 0:01:29
Average standard deviation of split frequencies: 0.011138
330500 -- (-1837.314) (-1827.179) (-1829.372) [-1826.554] * (-1822.323) [-1823.030] (-1825.056) (-1820.317) -- 0:01:29
331000 -- (-1827.552) (-1829.116) [-1829.561] (-1823.958) * (-1834.242) (-1825.921) [-1828.932] (-1832.845) -- 0:01:28
331500 -- [-1833.386] (-1827.713) (-1837.602) (-1836.674) * (-1832.778) [-1833.607] (-1829.777) (-1832.623) -- 0:01:28
332000 -- (-1833.493) (-1837.537) [-1822.762] (-1830.835) * (-1826.024) (-1821.959) [-1824.909] (-1829.293) -- 0:01:28
332500 -- [-1823.727] (-1832.930) (-1824.983) (-1830.953) * [-1823.882] (-1833.777) (-1832.935) (-1831.288) -- 0:01:28
333000 -- (-1828.907) (-1826.346) (-1828.508) [-1825.387] * (-1830.370) [-1823.959] (-1824.866) (-1822.500) -- 0:01:28
333500 -- [-1818.728] (-1822.306) (-1830.543) (-1827.533) * [-1824.940] (-1827.775) (-1824.612) (-1826.759) -- 0:01:27
334000 -- (-1822.579) (-1824.537) (-1829.989) [-1821.129] * (-1826.083) (-1833.964) (-1828.320) [-1832.621] -- 0:01:27
334500 -- (-1833.054) (-1824.855) [-1825.182] (-1825.213) * (-1826.805) (-1824.648) [-1835.127] (-1822.964) -- 0:01:27
335000 -- (-1825.063) (-1822.163) [-1824.116] (-1830.608) * [-1824.957] (-1830.041) (-1826.173) (-1825.741) -- 0:01:27
Average standard deviation of split frequencies: 0.010698
335500 -- (-1827.538) (-1843.039) [-1821.086] (-1826.859) * (-1828.198) (-1832.579) (-1833.023) [-1834.661] -- 0:01:29
336000 -- (-1824.089) (-1831.671) (-1822.746) [-1822.411] * (-1821.462) (-1826.239) (-1821.472) [-1827.346] -- 0:01:28
336500 -- (-1831.389) (-1825.289) [-1826.453] (-1825.880) * (-1827.920) (-1834.669) (-1831.982) [-1820.717] -- 0:01:28
337000 -- (-1829.510) (-1832.934) [-1820.868] (-1838.646) * (-1826.994) (-1823.626) (-1829.019) [-1827.228] -- 0:01:28
337500 -- [-1819.662] (-1829.245) (-1828.650) (-1824.756) * (-1827.991) (-1826.904) (-1825.347) [-1825.623] -- 0:01:28
338000 -- [-1822.974] (-1828.080) (-1829.212) (-1825.160) * (-1828.519) [-1829.145] (-1820.551) (-1829.676) -- 0:01:28
338500 -- (-1823.361) (-1835.285) [-1826.370] (-1835.092) * (-1824.590) (-1830.863) [-1823.792] (-1826.080) -- 0:01:27
339000 -- (-1828.712) (-1832.067) (-1826.892) [-1827.643] * (-1824.021) (-1832.931) [-1826.117] (-1831.081) -- 0:01:27
339500 -- [-1823.149] (-1824.063) (-1826.454) (-1833.876) * (-1832.976) [-1821.924] (-1819.167) (-1827.480) -- 0:01:27
340000 -- [-1825.584] (-1825.962) (-1827.843) (-1829.906) * (-1829.059) (-1825.420) [-1817.574] (-1821.875) -- 0:01:27
Average standard deviation of split frequencies: 0.010465
340500 -- (-1822.846) (-1824.725) (-1838.254) [-1819.586] * (-1836.328) (-1830.550) [-1825.350] (-1820.370) -- 0:01:27
341000 -- (-1828.849) (-1840.136) (-1825.484) [-1824.751] * (-1827.355) [-1826.384] (-1830.582) (-1827.706) -- 0:01:26
341500 -- (-1831.662) (-1823.051) [-1822.838] (-1832.358) * (-1826.497) (-1825.757) [-1819.317] (-1829.261) -- 0:01:26
342000 -- (-1829.986) (-1823.718) (-1826.660) [-1822.753] * (-1822.587) (-1828.069) (-1824.728) [-1829.086] -- 0:01:26
342500 -- (-1836.485) (-1825.236) [-1824.472] (-1824.485) * [-1824.130] (-1832.668) (-1828.855) (-1826.724) -- 0:01:26
343000 -- (-1829.323) (-1829.267) [-1829.503] (-1823.913) * (-1825.851) [-1828.004] (-1824.191) (-1829.972) -- 0:01:28
343500 -- (-1829.286) [-1830.867] (-1835.553) (-1821.986) * [-1821.177] (-1828.759) (-1823.789) (-1828.813) -- 0:01:27
344000 -- (-1830.714) [-1825.898] (-1840.233) (-1825.697) * [-1822.590] (-1829.816) (-1827.050) (-1828.683) -- 0:01:27
344500 -- (-1836.504) (-1823.554) (-1830.553) [-1831.774] * [-1824.940] (-1828.886) (-1826.062) (-1832.202) -- 0:01:27
345000 -- (-1831.712) [-1824.729] (-1832.959) (-1821.361) * (-1830.453) (-1835.008) (-1817.742) [-1827.818] -- 0:01:27
Average standard deviation of split frequencies: 0.010559
345500 -- [-1844.535] (-1829.604) (-1825.272) (-1829.608) * (-1832.976) (-1822.810) [-1829.046] (-1834.508) -- 0:01:27
346000 -- (-1843.458) (-1825.640) (-1829.060) [-1822.108] * (-1828.269) [-1823.848] (-1824.529) (-1831.287) -- 0:01:26
346500 -- [-1827.198] (-1823.416) (-1823.605) (-1822.426) * (-1820.700) (-1829.621) [-1823.236] (-1826.930) -- 0:01:26
347000 -- (-1826.717) (-1827.490) (-1824.825) [-1823.430] * (-1830.106) (-1822.682) [-1820.166] (-1834.538) -- 0:01:26
347500 -- [-1830.856] (-1827.471) (-1829.008) (-1820.400) * (-1841.547) [-1821.635] (-1830.611) (-1825.986) -- 0:01:26
348000 -- (-1827.533) [-1828.113] (-1835.575) (-1825.091) * (-1829.773) (-1823.144) (-1823.206) [-1826.203] -- 0:01:26
348500 -- (-1828.555) (-1825.689) (-1825.054) [-1821.427] * (-1826.829) (-1835.041) [-1823.758] (-1837.078) -- 0:01:25
349000 -- [-1825.021] (-1827.706) (-1824.179) (-1823.233) * (-1820.995) (-1824.524) (-1836.128) [-1830.310] -- 0:01:25
349500 -- [-1829.834] (-1829.049) (-1825.446) (-1830.967) * [-1829.093] (-1825.575) (-1827.266) (-1826.947) -- 0:01:25
350000 -- (-1831.308) [-1822.580] (-1822.637) (-1831.080) * (-1820.009) (-1823.818) (-1824.091) [-1828.863] -- 0:01:25
Average standard deviation of split frequencies: 0.010670
350500 -- [-1825.524] (-1836.763) (-1830.992) (-1828.268) * (-1827.213) (-1824.550) (-1822.547) [-1829.557] -- 0:01:27
351000 -- [-1818.900] (-1831.495) (-1841.890) (-1829.547) * [-1833.795] (-1828.947) (-1839.797) (-1826.462) -- 0:01:26
351500 -- (-1823.372) (-1828.418) [-1823.997] (-1836.654) * (-1830.649) [-1826.118] (-1820.444) (-1830.290) -- 0:01:26
352000 -- (-1826.837) (-1826.372) [-1825.117] (-1829.755) * (-1827.063) (-1831.452) [-1825.574] (-1826.674) -- 0:01:26
352500 -- [-1833.506] (-1824.491) (-1831.357) (-1831.442) * [-1828.172] (-1824.891) (-1822.869) (-1836.387) -- 0:01:26
353000 -- [-1820.703] (-1836.740) (-1825.024) (-1832.083) * (-1829.867) (-1823.750) (-1831.815) [-1822.780] -- 0:01:26
353500 -- (-1824.447) (-1826.695) (-1822.873) [-1829.937] * [-1823.980] (-1827.710) (-1825.026) (-1828.393) -- 0:01:25
354000 -- (-1834.033) (-1830.351) [-1824.512] (-1840.178) * [-1823.548] (-1824.143) (-1831.825) (-1825.703) -- 0:01:25
354500 -- (-1832.668) [-1830.684] (-1823.736) (-1827.455) * [-1832.434] (-1838.457) (-1830.008) (-1828.480) -- 0:01:25
355000 -- (-1826.596) (-1826.139) (-1827.625) [-1821.337] * (-1825.190) [-1828.159] (-1820.482) (-1825.205) -- 0:01:25
Average standard deviation of split frequencies: 0.010345
355500 -- (-1829.810) [-1827.785] (-1821.113) (-1827.499) * (-1827.069) (-1832.318) [-1824.908] (-1827.214) -- 0:01:25
356000 -- (-1822.836) (-1831.675) [-1831.264] (-1831.472) * [-1820.101] (-1842.569) (-1824.812) (-1824.285) -- 0:01:25
356500 -- [-1820.472] (-1834.671) (-1823.209) (-1827.362) * [-1830.186] (-1832.094) (-1824.989) (-1822.938) -- 0:01:24
357000 -- [-1836.229] (-1825.744) (-1829.910) (-1827.112) * (-1832.169) [-1830.500] (-1832.970) (-1825.054) -- 0:01:24
357500 -- (-1824.875) (-1830.591) [-1827.316] (-1834.857) * (-1823.195) [-1830.707] (-1829.994) (-1825.444) -- 0:01:24
358000 -- (-1836.228) (-1829.284) (-1825.478) [-1825.975] * (-1828.049) (-1830.854) (-1823.507) [-1828.499] -- 0:01:26
358500 -- (-1836.119) (-1825.187) [-1822.051] (-1827.578) * [-1826.990] (-1832.460) (-1829.133) (-1837.621) -- 0:01:25
359000 -- [-1818.562] (-1828.376) (-1828.762) (-1826.225) * (-1828.741) (-1835.448) [-1824.304] (-1838.840) -- 0:01:25
359500 -- (-1829.276) [-1825.830] (-1835.073) (-1834.772) * (-1826.574) (-1837.320) [-1822.350] (-1827.857) -- 0:01:25
360000 -- [-1826.940] (-1818.735) (-1833.918) (-1834.745) * (-1828.164) (-1829.082) [-1824.779] (-1829.702) -- 0:01:25
Average standard deviation of split frequencies: 0.010293
360500 -- (-1828.236) [-1829.476] (-1822.137) (-1823.647) * (-1827.307) (-1826.051) [-1827.853] (-1826.510) -- 0:01:25
361000 -- (-1823.593) (-1824.575) [-1820.745] (-1828.104) * (-1834.339) [-1823.380] (-1825.960) (-1836.832) -- 0:01:24
361500 -- [-1828.579] (-1826.201) (-1821.303) (-1827.626) * (-1834.985) (-1828.579) (-1826.564) [-1830.468] -- 0:01:24
362000 -- (-1823.943) (-1827.546) [-1822.507] (-1828.771) * [-1829.578] (-1829.001) (-1825.171) (-1831.013) -- 0:01:24
362500 -- (-1829.943) (-1820.742) [-1824.027] (-1825.579) * (-1829.544) [-1821.697] (-1825.034) (-1833.810) -- 0:01:24
363000 -- (-1827.021) (-1825.575) [-1825.449] (-1824.269) * (-1831.332) (-1825.946) (-1828.671) [-1828.364] -- 0:01:24
363500 -- (-1824.067) (-1830.883) (-1828.585) [-1829.701] * (-1833.644) [-1827.430] (-1828.148) (-1827.075) -- 0:01:24
364000 -- [-1825.182] (-1828.493) (-1829.488) (-1835.181) * (-1839.779) (-1836.142) (-1825.075) [-1827.039] -- 0:01:23
364500 -- (-1829.656) (-1825.165) (-1833.070) [-1832.739] * [-1834.092] (-1830.773) (-1831.917) (-1832.066) -- 0:01:23
365000 -- [-1823.913] (-1830.594) (-1826.563) (-1820.594) * (-1832.645) [-1822.639] (-1824.560) (-1828.348) -- 0:01:23
Average standard deviation of split frequencies: 0.009622
365500 -- (-1831.809) (-1830.672) (-1830.432) [-1825.830] * (-1835.080) (-1828.814) [-1829.574] (-1832.003) -- 0:01:25
366000 -- (-1831.148) (-1829.342) (-1831.538) [-1825.466] * (-1832.445) (-1825.531) [-1832.498] (-1830.825) -- 0:01:24
366500 -- (-1825.974) (-1829.045) [-1824.841] (-1831.068) * (-1829.312) [-1824.321] (-1829.534) (-1832.614) -- 0:01:24
367000 -- [-1824.870] (-1833.731) (-1826.295) (-1827.660) * (-1826.901) (-1826.386) [-1824.472] (-1829.432) -- 0:01:24
367500 -- [-1822.557] (-1826.028) (-1825.718) (-1827.581) * (-1826.738) [-1820.253] (-1827.151) (-1828.920) -- 0:01:24
368000 -- [-1820.233] (-1828.482) (-1830.606) (-1819.721) * (-1832.023) (-1825.869) [-1820.241] (-1845.501) -- 0:01:24
368500 -- [-1820.748] (-1831.600) (-1832.130) (-1827.229) * [-1829.631] (-1831.552) (-1826.948) (-1824.918) -- 0:01:23
369000 -- [-1835.175] (-1825.252) (-1826.761) (-1825.493) * (-1825.306) [-1821.450] (-1825.118) (-1841.299) -- 0:01:23
369500 -- (-1826.779) (-1827.340) [-1822.171] (-1823.216) * (-1823.907) (-1820.728) [-1823.169] (-1836.278) -- 0:01:23
370000 -- (-1834.804) [-1824.580] (-1832.141) (-1829.866) * (-1834.169) (-1829.531) [-1820.279] (-1830.371) -- 0:01:23
Average standard deviation of split frequencies: 0.009856
370500 -- (-1825.534) [-1821.308] (-1836.920) (-1837.699) * (-1829.535) (-1835.978) [-1816.691] (-1822.670) -- 0:01:23
371000 -- (-1834.968) [-1822.031] (-1831.345) (-1822.493) * (-1837.955) (-1826.133) (-1829.199) [-1825.119] -- 0:01:23
371500 -- (-1830.623) [-1828.168] (-1829.009) (-1824.179) * (-1841.195) (-1826.643) [-1820.864] (-1832.322) -- 0:01:22
372000 -- (-1823.428) (-1821.374) (-1835.234) [-1825.274] * (-1827.996) (-1829.242) [-1822.877] (-1827.177) -- 0:01:22
372500 -- (-1824.644) [-1828.002] (-1833.484) (-1822.519) * [-1827.199] (-1829.188) (-1824.131) (-1826.909) -- 0:01:22
373000 -- (-1829.719) (-1821.172) [-1830.100] (-1825.407) * (-1833.066) (-1826.028) (-1837.044) [-1830.843] -- 0:01:24
373500 -- (-1832.012) [-1825.614] (-1831.455) (-1821.331) * (-1828.447) [-1824.833] (-1839.204) (-1832.737) -- 0:01:23
374000 -- (-1819.878) (-1821.930) (-1835.545) [-1822.290] * [-1829.801] (-1829.201) (-1823.924) (-1836.241) -- 0:01:23
374500 -- [-1831.269] (-1824.981) (-1824.622) (-1831.344) * [-1823.365] (-1831.386) (-1831.771) (-1830.832) -- 0:01:23
375000 -- (-1825.999) [-1830.865] (-1822.721) (-1829.325) * (-1822.918) (-1828.323) [-1832.270] (-1833.028) -- 0:01:23
Average standard deviation of split frequencies: 0.009219
375500 -- (-1829.585) (-1838.888) [-1826.225] (-1823.198) * (-1839.851) [-1824.273] (-1827.465) (-1827.492) -- 0:01:23
376000 -- [-1825.660] (-1831.626) (-1824.933) (-1823.024) * [-1837.536] (-1825.240) (-1829.797) (-1828.000) -- 0:01:22
376500 -- (-1820.916) [-1825.936] (-1827.147) (-1827.668) * (-1828.162) (-1834.450) (-1831.508) [-1822.847] -- 0:01:22
377000 -- [-1822.751] (-1830.591) (-1825.842) (-1829.554) * [-1828.822] (-1832.745) (-1831.882) (-1829.630) -- 0:01:22
377500 -- (-1822.239) (-1830.813) [-1823.507] (-1836.045) * (-1831.309) (-1823.248) [-1829.938] (-1829.796) -- 0:01:22
378000 -- (-1824.007) (-1830.079) [-1823.888] (-1828.892) * (-1830.363) (-1828.416) (-1833.437) [-1828.847] -- 0:01:22
378500 -- [-1823.406] (-1828.184) (-1828.765) (-1823.743) * (-1835.219) (-1831.813) [-1825.269] (-1825.294) -- 0:01:22
379000 -- (-1826.125) (-1828.657) [-1825.323] (-1822.516) * (-1844.186) [-1826.139] (-1829.375) (-1837.571) -- 0:01:21
379500 -- [-1828.787] (-1826.427) (-1828.174) (-1829.914) * (-1829.214) (-1831.426) [-1827.616] (-1821.248) -- 0:01:21
380000 -- (-1821.810) [-1823.416] (-1826.371) (-1823.215) * (-1827.696) (-1829.252) (-1825.309) [-1826.735] -- 0:01:21
Average standard deviation of split frequencies: 0.008746
380500 -- [-1828.656] (-1827.288) (-1832.885) (-1822.881) * (-1828.824) (-1825.575) (-1825.980) [-1822.469] -- 0:01:23
381000 -- (-1825.008) (-1826.063) [-1825.934] (-1827.757) * (-1829.074) (-1831.854) (-1825.191) [-1821.244] -- 0:01:22
381500 -- [-1825.346] (-1824.772) (-1828.252) (-1835.820) * [-1829.981] (-1828.321) (-1835.315) (-1830.805) -- 0:01:22
382000 -- [-1827.003] (-1825.483) (-1834.437) (-1824.234) * (-1840.186) [-1825.885] (-1829.786) (-1828.076) -- 0:01:22
382500 -- (-1831.966) [-1823.696] (-1835.197) (-1833.873) * (-1830.717) (-1824.285) (-1824.882) [-1824.699] -- 0:01:22
383000 -- (-1828.500) [-1820.598] (-1826.162) (-1822.680) * (-1825.451) [-1833.598] (-1828.990) (-1825.779) -- 0:01:22
383500 -- (-1829.269) (-1824.995) (-1836.549) [-1832.554] * (-1824.992) (-1831.797) [-1822.416] (-1830.091) -- 0:01:21
384000 -- [-1821.622] (-1824.256) (-1824.809) (-1822.346) * (-1833.688) (-1826.964) [-1826.766] (-1829.432) -- 0:01:21
384500 -- (-1829.357) (-1832.091) [-1822.216] (-1823.123) * [-1822.548] (-1823.556) (-1825.826) (-1824.213) -- 0:01:21
385000 -- (-1821.239) (-1824.324) [-1820.282] (-1824.730) * (-1825.096) [-1822.336] (-1832.949) (-1829.337) -- 0:01:21
Average standard deviation of split frequencies: 0.009083
385500 -- [-1824.103] (-1823.524) (-1829.077) (-1826.496) * [-1833.660] (-1822.530) (-1832.120) (-1824.754) -- 0:01:21
386000 -- (-1828.073) [-1829.144] (-1824.324) (-1831.885) * (-1829.899) (-1821.566) (-1834.647) [-1824.713] -- 0:01:21
386500 -- [-1826.257] (-1823.732) (-1836.866) (-1828.056) * [-1822.958] (-1825.913) (-1829.893) (-1828.324) -- 0:01:20
387000 -- (-1829.437) (-1826.368) (-1829.166) [-1818.728] * (-1824.020) (-1829.264) (-1825.984) [-1826.215] -- 0:01:20
387500 -- (-1822.561) [-1819.945] (-1828.096) (-1832.722) * (-1823.019) (-1830.805) [-1822.877] (-1831.500) -- 0:01:20
388000 -- (-1827.258) [-1823.361] (-1827.419) (-1825.790) * [-1824.784] (-1832.983) (-1824.911) (-1832.940) -- 0:01:22
388500 -- (-1837.639) (-1835.518) (-1826.870) [-1825.931] * [-1826.040] (-1831.836) (-1840.070) (-1823.522) -- 0:01:21
389000 -- (-1824.318) (-1823.597) (-1825.081) [-1821.277] * [-1824.531] (-1837.740) (-1829.104) (-1829.120) -- 0:01:21
389500 -- [-1828.725] (-1825.726) (-1826.859) (-1829.513) * (-1825.999) [-1823.994] (-1828.538) (-1817.142) -- 0:01:21
390000 -- (-1830.679) (-1831.181) (-1831.875) [-1836.377] * (-1819.536) [-1824.888] (-1829.973) (-1827.098) -- 0:01:21
Average standard deviation of split frequencies: 0.008673
390500 -- (-1830.822) (-1827.617) (-1828.074) [-1820.758] * (-1826.782) (-1825.684) (-1823.630) [-1831.061] -- 0:01:21
391000 -- (-1828.290) (-1835.348) [-1824.957] (-1832.375) * (-1825.285) (-1824.367) (-1821.028) [-1821.561] -- 0:01:20
391500 -- (-1826.080) (-1830.564) (-1835.356) [-1830.688] * (-1825.399) [-1828.965] (-1831.923) (-1831.175) -- 0:01:20
392000 -- [-1820.062] (-1828.442) (-1827.856) (-1829.565) * (-1826.381) (-1823.831) [-1829.794] (-1832.947) -- 0:01:20
392500 -- (-1824.135) (-1827.252) [-1827.551] (-1824.881) * (-1833.427) (-1827.531) [-1821.832] (-1827.192) -- 0:01:20
393000 -- (-1824.878) (-1844.830) (-1828.662) [-1822.568] * (-1825.190) (-1822.990) (-1823.825) [-1833.865] -- 0:01:20
393500 -- (-1821.674) (-1828.830) [-1825.017] (-1831.103) * (-1835.167) (-1825.108) [-1826.901] (-1825.084) -- 0:01:20
394000 -- (-1823.664) (-1826.928) (-1832.899) [-1828.354] * (-1821.281) (-1834.070) [-1823.810] (-1825.638) -- 0:01:19
394500 -- (-1821.409) (-1828.687) (-1823.917) [-1837.801] * (-1828.286) [-1826.022] (-1820.109) (-1827.852) -- 0:01:19
395000 -- (-1832.677) (-1826.334) (-1825.002) [-1826.606] * (-1831.218) (-1827.822) [-1824.123] (-1829.347) -- 0:01:19
Average standard deviation of split frequencies: 0.008705
395500 -- (-1830.108) (-1829.932) [-1824.018] (-1828.744) * (-1827.457) [-1826.427] (-1826.989) (-1827.028) -- 0:01:21
396000 -- (-1827.520) [-1821.373] (-1826.133) (-1822.501) * (-1825.082) [-1824.242] (-1828.979) (-1826.239) -- 0:01:20
396500 -- (-1820.978) [-1822.750] (-1829.197) (-1820.390) * (-1830.351) (-1824.475) [-1824.934] (-1831.281) -- 0:01:20
397000 -- [-1825.911] (-1824.093) (-1831.066) (-1821.735) * (-1825.196) (-1839.853) [-1826.046] (-1827.406) -- 0:01:20
397500 -- (-1828.932) (-1832.736) [-1824.644] (-1830.993) * [-1826.140] (-1830.656) (-1826.666) (-1826.180) -- 0:01:20
398000 -- (-1829.841) (-1823.901) (-1828.431) [-1822.917] * (-1821.897) (-1826.943) (-1829.880) [-1830.339] -- 0:01:20
398500 -- (-1824.456) (-1828.404) [-1824.887] (-1827.219) * (-1825.353) (-1828.220) [-1818.888] (-1827.649) -- 0:01:19
399000 -- (-1824.249) [-1827.481] (-1828.568) (-1822.518) * (-1827.460) (-1827.719) (-1827.516) [-1833.129] -- 0:01:19
399500 -- [-1822.798] (-1824.749) (-1828.627) (-1820.976) * (-1823.510) (-1825.795) (-1825.863) [-1824.080] -- 0:01:19
400000 -- (-1828.541) (-1825.592) (-1829.841) [-1827.199] * (-1818.801) [-1827.960] (-1826.184) (-1829.006) -- 0:01:19
Average standard deviation of split frequencies: 0.009412
400500 -- (-1823.630) (-1828.434) [-1821.040] (-1830.063) * [-1822.254] (-1831.011) (-1823.916) (-1821.013) -- 0:01:19
401000 -- (-1829.254) (-1822.297) [-1823.558] (-1818.630) * (-1831.148) (-1833.311) [-1821.654] (-1820.835) -- 0:01:19
401500 -- (-1832.300) [-1825.713] (-1827.105) (-1824.903) * (-1828.311) (-1829.045) [-1822.850] (-1825.437) -- 0:01:19
402000 -- (-1825.314) [-1828.291] (-1833.308) (-1827.209) * (-1825.502) (-1831.958) (-1826.182) [-1822.046] -- 0:01:18
402500 -- (-1822.674) [-1827.314] (-1827.209) (-1825.965) * (-1822.330) (-1825.379) (-1830.312) [-1825.057] -- 0:01:18
403000 -- (-1834.423) (-1822.069) (-1823.611) [-1827.770] * (-1829.206) (-1831.041) (-1828.557) [-1832.199] -- 0:01:19
403500 -- (-1832.089) (-1829.223) (-1826.670) [-1830.218] * (-1823.672) [-1825.465] (-1828.181) (-1832.236) -- 0:01:19
404000 -- (-1827.865) (-1828.703) [-1824.577] (-1826.169) * (-1822.686) (-1823.638) (-1827.016) [-1825.033] -- 0:01:19
404500 -- [-1824.899] (-1833.482) (-1833.131) (-1827.986) * [-1826.620] (-1824.258) (-1826.600) (-1826.974) -- 0:01:19
405000 -- [-1820.894] (-1830.325) (-1831.071) (-1823.292) * (-1821.369) (-1825.686) [-1821.039] (-1828.287) -- 0:01:19
Average standard deviation of split frequencies: 0.009216
405500 -- (-1830.409) (-1829.557) [-1825.293] (-1823.845) * (-1821.404) (-1839.478) [-1823.746] (-1834.381) -- 0:01:19
406000 -- (-1826.170) [-1823.691] (-1834.403) (-1832.252) * [-1826.070] (-1825.143) (-1835.717) (-1822.704) -- 0:01:19
406500 -- [-1829.766] (-1829.430) (-1831.146) (-1830.320) * (-1823.616) [-1827.244] (-1832.936) (-1830.330) -- 0:01:18
407000 -- (-1828.382) (-1826.286) (-1832.776) [-1822.982] * (-1826.174) (-1828.145) (-1832.365) [-1825.257] -- 0:01:18
407500 -- [-1829.519] (-1823.555) (-1831.425) (-1827.872) * (-1832.806) (-1827.609) [-1824.254] (-1838.725) -- 0:01:18
408000 -- [-1826.401] (-1824.616) (-1827.620) (-1825.945) * (-1836.315) [-1824.148] (-1824.524) (-1831.959) -- 0:01:18
408500 -- [-1823.049] (-1833.206) (-1825.514) (-1824.143) * [-1837.021] (-1825.730) (-1826.642) (-1832.146) -- 0:01:18
409000 -- (-1820.599) (-1826.095) (-1824.744) [-1828.561] * (-1833.153) [-1825.835] (-1830.553) (-1825.465) -- 0:01:18
409500 -- (-1831.896) [-1823.718] (-1827.081) (-1828.090) * [-1836.418] (-1825.475) (-1825.254) (-1831.007) -- 0:01:17
410000 -- (-1826.665) [-1827.860] (-1825.526) (-1825.932) * [-1827.997] (-1824.589) (-1831.709) (-1827.443) -- 0:01:17
Average standard deviation of split frequencies: 0.009757
410500 -- (-1829.363) (-1829.450) (-1827.619) [-1823.365] * [-1819.066] (-1829.385) (-1837.502) (-1829.115) -- 0:01:18
411000 -- (-1829.213) (-1828.131) (-1827.497) [-1830.367] * (-1828.270) (-1833.186) (-1829.906) [-1830.000] -- 0:01:18
411500 -- (-1825.355) (-1828.827) [-1826.348] (-1833.514) * [-1826.782] (-1829.349) (-1824.035) (-1828.811) -- 0:01:18
412000 -- [-1828.988] (-1831.574) (-1835.968) (-1821.667) * [-1821.460] (-1826.347) (-1831.654) (-1829.153) -- 0:01:18
412500 -- (-1836.946) (-1829.033) [-1824.369] (-1819.769) * (-1821.668) (-1828.334) (-1834.232) [-1824.079] -- 0:01:18
413000 -- [-1825.296] (-1831.758) (-1825.310) (-1826.470) * (-1835.823) (-1834.779) [-1831.978] (-1828.942) -- 0:01:18
413500 -- (-1829.084) (-1828.764) (-1826.338) [-1824.768] * (-1830.013) (-1824.179) [-1828.022] (-1823.544) -- 0:01:18
414000 -- (-1828.287) [-1820.549] (-1826.006) (-1824.879) * (-1824.479) [-1827.227] (-1832.807) (-1831.408) -- 0:01:17
414500 -- [-1824.112] (-1828.309) (-1825.912) (-1834.325) * [-1826.199] (-1827.663) (-1825.126) (-1825.649) -- 0:01:17
415000 -- (-1841.080) (-1821.509) [-1832.349] (-1829.671) * (-1833.214) (-1819.858) (-1824.116) [-1824.439] -- 0:01:17
Average standard deviation of split frequencies: 0.009420
415500 -- (-1823.135) (-1823.883) [-1827.129] (-1824.094) * (-1829.166) (-1826.218) [-1823.660] (-1828.652) -- 0:01:17
416000 -- (-1828.033) [-1828.235] (-1823.536) (-1825.944) * (-1825.076) (-1838.254) [-1822.578] (-1823.658) -- 0:01:17
416500 -- (-1823.242) (-1823.853) [-1826.076] (-1825.825) * (-1826.474) [-1822.266] (-1825.124) (-1820.203) -- 0:01:17
417000 -- (-1829.775) [-1821.081] (-1828.799) (-1825.365) * (-1828.777) (-1828.317) [-1822.954] (-1829.728) -- 0:01:16
417500 -- (-1833.644) (-1831.415) [-1821.043] (-1826.659) * (-1832.980) (-1829.902) [-1828.206] (-1830.768) -- 0:01:16
418000 -- (-1832.667) [-1824.489] (-1820.096) (-1825.665) * (-1828.737) (-1825.138) (-1826.964) [-1823.204] -- 0:01:17
418500 -- (-1833.023) (-1826.323) [-1824.724] (-1835.887) * (-1829.573) [-1826.432] (-1828.706) (-1831.416) -- 0:01:17
419000 -- (-1826.095) (-1823.972) [-1822.884] (-1822.791) * (-1838.348) [-1830.479] (-1831.042) (-1829.679) -- 0:01:17
419500 -- (-1831.142) (-1839.059) (-1827.125) [-1827.743] * (-1825.964) (-1828.784) [-1833.620] (-1830.521) -- 0:01:17
420000 -- (-1825.883) (-1825.697) (-1834.858) [-1826.414] * [-1830.826] (-1829.557) (-1826.822) (-1825.175) -- 0:01:17
Average standard deviation of split frequencies: 0.010086
420500 -- (-1823.328) (-1825.052) (-1830.946) [-1828.226] * (-1832.146) (-1838.041) [-1828.419] (-1838.353) -- 0:01:17
421000 -- [-1824.814] (-1826.355) (-1828.642) (-1827.509) * (-1833.086) (-1825.857) [-1825.020] (-1828.501) -- 0:01:17
421500 -- [-1824.412] (-1827.909) (-1837.112) (-1830.590) * [-1829.065] (-1829.817) (-1819.671) (-1828.637) -- 0:01:16
422000 -- [-1822.195] (-1827.071) (-1829.046) (-1828.441) * (-1824.039) (-1824.254) (-1835.257) [-1830.163] -- 0:01:16
422500 -- (-1836.990) (-1827.228) [-1829.107] (-1835.101) * [-1827.177] (-1828.390) (-1830.002) (-1830.052) -- 0:01:16
423000 -- (-1822.605) (-1827.969) [-1823.572] (-1828.874) * [-1825.526] (-1826.535) (-1836.205) (-1824.063) -- 0:01:16
423500 -- [-1826.150] (-1826.636) (-1828.370) (-1829.084) * (-1826.092) [-1826.694] (-1831.041) (-1821.437) -- 0:01:16
424000 -- (-1832.503) [-1821.022] (-1832.743) (-1830.663) * [-1816.216] (-1834.905) (-1828.489) (-1827.227) -- 0:01:16
424500 -- (-1828.928) (-1821.136) (-1821.701) [-1816.890] * [-1828.140] (-1838.982) (-1821.548) (-1829.690) -- 0:01:15
425000 -- (-1821.753) (-1831.913) (-1827.589) [-1821.842] * (-1831.344) [-1832.328] (-1828.385) (-1822.308) -- 0:01:15
Average standard deviation of split frequencies: 0.010789
425500 -- (-1825.142) (-1823.184) (-1829.977) [-1823.234] * (-1823.374) (-1834.792) (-1832.072) [-1822.266] -- 0:01:16
426000 -- (-1828.684) (-1830.865) [-1831.298] (-1825.906) * (-1834.172) (-1823.661) (-1825.750) [-1820.912] -- 0:01:16
426500 -- (-1821.816) (-1825.200) [-1820.522] (-1822.849) * (-1834.581) (-1822.060) [-1829.738] (-1827.398) -- 0:01:16
427000 -- (-1821.117) (-1831.692) (-1824.402) [-1823.727] * (-1830.666) (-1831.707) (-1828.632) [-1822.238] -- 0:01:16
427500 -- (-1820.064) (-1832.939) [-1820.450] (-1824.393) * (-1821.402) (-1829.955) [-1824.895] (-1827.251) -- 0:01:16
428000 -- [-1823.005] (-1829.732) (-1823.217) (-1832.632) * (-1823.989) (-1829.353) [-1833.646] (-1834.035) -- 0:01:16
428500 -- (-1826.907) [-1829.201] (-1822.713) (-1832.069) * (-1830.111) [-1824.060] (-1828.534) (-1835.280) -- 0:01:16
429000 -- (-1823.113) (-1832.087) (-1827.104) [-1823.053] * [-1821.562] (-1819.961) (-1829.512) (-1834.239) -- 0:01:15
429500 -- (-1828.616) [-1834.322] (-1831.616) (-1836.834) * (-1828.322) (-1825.794) (-1825.262) [-1819.535] -- 0:01:15
430000 -- (-1830.831) (-1832.853) [-1820.596] (-1839.176) * (-1831.972) (-1826.813) [-1825.593] (-1834.599) -- 0:01:15
Average standard deviation of split frequencies: 0.010672
430500 -- (-1826.107) (-1825.241) [-1821.523] (-1830.180) * (-1823.320) [-1824.475] (-1825.059) (-1831.972) -- 0:01:15
431000 -- (-1827.557) (-1831.036) (-1822.659) [-1824.614] * (-1829.559) (-1825.426) (-1827.203) [-1832.415] -- 0:01:15
431500 -- (-1825.149) (-1839.248) [-1827.472] (-1831.787) * [-1824.514] (-1827.950) (-1828.372) (-1827.577) -- 0:01:15
432000 -- (-1834.821) [-1826.545] (-1825.224) (-1822.434) * (-1824.295) (-1821.419) [-1828.533] (-1832.371) -- 0:01:14
432500 -- (-1828.209) [-1819.417] (-1830.404) (-1840.198) * (-1830.912) (-1829.758) (-1835.545) [-1833.280] -- 0:01:14
433000 -- [-1830.595] (-1834.996) (-1830.004) (-1828.713) * (-1820.465) [-1824.195] (-1824.977) (-1822.493) -- 0:01:15
433500 -- [-1825.987] (-1820.905) (-1829.051) (-1821.608) * (-1827.943) (-1827.702) [-1822.449] (-1826.012) -- 0:01:15
434000 -- [-1820.463] (-1826.978) (-1829.754) (-1829.219) * (-1827.843) [-1827.797] (-1824.953) (-1825.329) -- 0:01:15
434500 -- (-1823.793) (-1833.421) [-1830.777] (-1836.142) * [-1825.979] (-1826.611) (-1826.188) (-1835.623) -- 0:01:15
435000 -- [-1831.357] (-1829.202) (-1834.441) (-1832.798) * (-1827.663) (-1828.268) [-1832.850] (-1820.885) -- 0:01:15
Average standard deviation of split frequencies: 0.011217
435500 -- (-1827.115) (-1822.808) (-1832.477) [-1821.141] * (-1827.951) [-1821.256] (-1824.217) (-1829.540) -- 0:01:15
436000 -- [-1825.757] (-1827.786) (-1826.604) (-1831.631) * (-1831.289) (-1830.650) [-1821.815] (-1832.250) -- 0:01:15
436500 -- (-1825.481) (-1829.737) [-1822.565] (-1823.951) * (-1828.691) (-1828.084) (-1836.916) [-1823.462] -- 0:01:14
437000 -- (-1825.530) (-1829.147) (-1822.198) [-1825.135] * (-1825.767) (-1824.613) (-1829.319) [-1819.782] -- 0:01:14
437500 -- (-1831.186) (-1823.194) (-1831.255) [-1825.714] * (-1832.127) (-1835.045) [-1829.120] (-1831.325) -- 0:01:14
438000 -- (-1831.132) (-1840.659) (-1824.965) [-1817.383] * (-1827.306) [-1823.418] (-1823.477) (-1824.106) -- 0:01:14
438500 -- (-1826.156) [-1831.583] (-1823.378) (-1827.190) * (-1826.896) (-1828.693) (-1822.855) [-1824.511] -- 0:01:14
439000 -- (-1822.629) [-1834.826] (-1829.067) (-1823.805) * [-1832.817] (-1827.854) (-1826.522) (-1817.377) -- 0:01:14
439500 -- [-1816.724] (-1838.235) (-1824.016) (-1826.775) * (-1822.838) (-1828.669) (-1832.407) [-1822.451] -- 0:01:13
440000 -- (-1824.810) (-1827.821) [-1825.358] (-1818.559) * (-1830.955) [-1831.457] (-1824.627) (-1825.567) -- 0:01:13
Average standard deviation of split frequencies: 0.012102
440500 -- (-1832.368) [-1829.754] (-1823.111) (-1829.282) * (-1825.220) (-1827.637) [-1825.609] (-1827.053) -- 0:01:14
441000 -- (-1828.757) (-1834.351) [-1829.344] (-1826.041) * (-1823.455) (-1824.565) (-1828.816) [-1824.498] -- 0:01:14
441500 -- (-1821.516) [-1831.478] (-1822.746) (-1822.469) * [-1823.577] (-1836.988) (-1831.432) (-1822.557) -- 0:01:14
442000 -- (-1826.066) (-1834.004) (-1826.711) [-1820.705] * (-1828.030) (-1827.493) [-1820.573] (-1825.736) -- 0:01:14
442500 -- (-1825.899) (-1828.104) [-1829.327] (-1825.858) * [-1818.276] (-1823.926) (-1829.060) (-1833.439) -- 0:01:14
443000 -- (-1826.769) (-1829.026) (-1825.221) [-1823.971] * (-1821.902) [-1819.434] (-1827.929) (-1823.335) -- 0:01:14
443500 -- (-1824.280) (-1823.021) (-1821.827) [-1831.406] * (-1825.809) (-1827.502) (-1825.718) [-1826.441] -- 0:01:14
444000 -- (-1823.299) (-1824.566) [-1827.149] (-1833.065) * (-1828.385) (-1825.885) (-1823.702) [-1831.040] -- 0:01:13
444500 -- [-1823.232] (-1830.863) (-1827.269) (-1825.365) * [-1831.512] (-1832.470) (-1825.388) (-1828.429) -- 0:01:13
445000 -- (-1830.172) [-1829.459] (-1823.893) (-1823.646) * (-1825.176) (-1832.173) [-1825.968] (-1821.026) -- 0:01:13
Average standard deviation of split frequencies: 0.012684
445500 -- (-1828.390) [-1832.178] (-1831.206) (-1830.621) * (-1833.376) (-1831.412) [-1823.506] (-1827.791) -- 0:01:13
446000 -- (-1830.223) (-1824.538) (-1839.062) [-1825.650] * [-1822.763] (-1828.142) (-1822.604) (-1826.301) -- 0:01:13
446500 -- (-1829.199) (-1831.324) [-1827.989] (-1827.322) * (-1821.877) (-1836.305) [-1824.363] (-1828.779) -- 0:01:13
447000 -- (-1829.131) (-1827.453) (-1827.067) [-1825.438] * [-1826.504] (-1827.873) (-1822.313) (-1831.792) -- 0:01:12
447500 -- (-1825.238) (-1823.576) [-1828.139] (-1826.651) * (-1829.769) (-1829.945) [-1817.236] (-1827.466) -- 0:01:12
448000 -- (-1833.062) (-1822.335) [-1830.251] (-1832.254) * [-1827.259] (-1825.286) (-1829.116) (-1834.297) -- 0:01:13
448500 -- (-1833.008) (-1831.766) (-1827.456) [-1823.299] * (-1819.953) (-1833.403) (-1831.549) [-1824.877] -- 0:01:13
449000 -- (-1829.827) (-1829.345) [-1828.857] (-1828.549) * (-1829.997) (-1834.899) [-1822.369] (-1834.434) -- 0:01:13
449500 -- [-1838.066] (-1831.768) (-1832.031) (-1825.204) * (-1825.439) [-1826.553] (-1822.125) (-1827.683) -- 0:01:13
450000 -- (-1833.995) (-1829.549) [-1824.537] (-1824.920) * (-1825.377) (-1828.547) (-1822.397) [-1822.922] -- 0:01:13
Average standard deviation of split frequencies: 0.013075
450500 -- (-1821.648) (-1822.302) [-1818.613] (-1830.641) * (-1821.147) (-1837.240) (-1826.335) [-1822.400] -- 0:01:13
451000 -- (-1824.216) [-1819.636] (-1826.456) (-1825.135) * [-1827.461] (-1834.209) (-1832.809) (-1829.377) -- 0:01:13
451500 -- (-1833.425) (-1822.434) (-1826.374) [-1822.576] * (-1823.980) (-1825.865) [-1830.730] (-1822.766) -- 0:01:12
452000 -- (-1826.464) [-1826.190] (-1823.205) (-1819.666) * [-1833.552] (-1822.815) (-1824.250) (-1823.434) -- 0:01:12
452500 -- (-1825.248) [-1828.802] (-1827.916) (-1819.534) * (-1828.619) [-1824.388] (-1823.740) (-1826.344) -- 0:01:12
453000 -- (-1829.477) [-1823.179] (-1825.272) (-1824.830) * [-1825.838] (-1835.864) (-1834.376) (-1823.824) -- 0:01:12
453500 -- [-1823.542] (-1827.753) (-1826.848) (-1821.179) * (-1826.766) (-1828.636) (-1830.515) [-1828.931] -- 0:01:12
454000 -- (-1833.752) [-1825.690] (-1825.058) (-1828.936) * [-1822.170] (-1831.967) (-1830.321) (-1825.715) -- 0:01:12
454500 -- (-1838.308) (-1820.915) [-1825.322] (-1822.703) * (-1823.538) [-1830.796] (-1839.190) (-1822.090) -- 0:01:12
455000 -- (-1831.053) (-1822.036) [-1826.418] (-1825.434) * (-1833.868) (-1826.514) [-1832.896] (-1823.610) -- 0:01:11
Average standard deviation of split frequencies: 0.012599
455500 -- (-1832.366) (-1832.815) [-1829.702] (-1824.512) * [-1836.349] (-1828.694) (-1828.644) (-1821.662) -- 0:01:12
456000 -- (-1829.686) (-1821.458) (-1820.926) [-1822.107] * (-1823.651) (-1825.422) (-1835.833) [-1821.835] -- 0:01:12
456500 -- (-1836.404) [-1827.026] (-1829.006) (-1823.159) * (-1829.189) (-1833.471) (-1834.594) [-1826.287] -- 0:01:12
457000 -- [-1830.823] (-1829.506) (-1832.090) (-1836.282) * [-1824.473] (-1825.152) (-1835.414) (-1827.479) -- 0:01:12
457500 -- (-1834.441) (-1828.975) (-1826.367) [-1824.728] * (-1836.662) (-1825.755) (-1830.479) [-1827.888] -- 0:01:12
458000 -- (-1834.117) (-1834.563) [-1825.363] (-1822.680) * (-1827.498) [-1826.895] (-1834.757) (-1821.175) -- 0:01:12
458500 -- (-1829.617) (-1840.258) [-1827.354] (-1825.206) * (-1822.126) [-1822.204] (-1830.418) (-1827.122) -- 0:01:12
459000 -- (-1821.375) (-1830.543) (-1826.603) [-1821.129] * (-1829.278) [-1826.776] (-1834.526) (-1828.040) -- 0:01:11
459500 -- (-1822.202) (-1828.454) (-1824.864) [-1825.830] * (-1820.427) (-1831.724) (-1829.065) [-1828.543] -- 0:01:11
460000 -- (-1832.290) (-1825.055) [-1823.718] (-1829.663) * (-1824.743) (-1834.241) [-1821.369] (-1824.557) -- 0:01:11
Average standard deviation of split frequencies: 0.012152
460500 -- (-1825.147) (-1830.203) (-1828.562) [-1826.854] * (-1822.025) (-1822.074) [-1838.072] (-1821.346) -- 0:01:11
461000 -- [-1824.811] (-1832.902) (-1826.858) (-1827.469) * (-1819.323) (-1827.106) [-1830.343] (-1828.951) -- 0:01:11
461500 -- (-1827.336) [-1824.488] (-1824.566) (-1827.324) * [-1834.369] (-1827.889) (-1829.795) (-1820.685) -- 0:01:11
462000 -- (-1834.942) (-1826.367) [-1826.912] (-1832.495) * (-1832.514) (-1832.827) (-1826.351) [-1825.728] -- 0:01:11
462500 -- (-1825.832) (-1824.702) [-1823.275] (-1820.958) * (-1832.411) (-1835.386) [-1827.210] (-1824.618) -- 0:01:10
463000 -- (-1838.800) (-1831.412) [-1828.870] (-1825.405) * (-1827.535) (-1834.972) [-1828.091] (-1827.788) -- 0:01:11
463500 -- (-1828.631) [-1823.808] (-1826.287) (-1826.835) * (-1828.046) (-1834.858) (-1831.991) [-1830.260] -- 0:01:11
464000 -- (-1840.933) (-1822.944) [-1821.038] (-1829.117) * [-1825.239] (-1837.255) (-1828.686) (-1825.763) -- 0:01:11
464500 -- [-1827.855] (-1837.044) (-1828.418) (-1824.448) * (-1830.015) (-1831.079) (-1829.445) [-1825.838] -- 0:01:11
465000 -- (-1828.000) [-1831.070] (-1825.010) (-1826.958) * (-1824.317) [-1832.286] (-1829.298) (-1826.742) -- 0:01:11
Average standard deviation of split frequencies: 0.011570
465500 -- (-1824.626) [-1822.915] (-1824.929) (-1822.114) * [-1826.310] (-1832.156) (-1823.542) (-1823.977) -- 0:01:11
466000 -- (-1822.238) [-1824.918] (-1827.757) (-1820.856) * [-1822.870] (-1820.690) (-1826.851) (-1831.007) -- 0:01:11
466500 -- (-1827.762) (-1834.216) [-1826.799] (-1835.857) * (-1828.845) [-1821.304] (-1823.321) (-1826.294) -- 0:01:10
467000 -- (-1828.381) (-1823.043) (-1823.816) [-1823.254] * (-1823.345) (-1826.110) (-1829.328) [-1825.734] -- 0:01:10
467500 -- (-1826.183) (-1825.737) [-1831.854] (-1839.353) * (-1824.395) [-1829.383] (-1823.643) (-1821.425) -- 0:01:10
468000 -- [-1825.599] (-1825.992) (-1822.301) (-1828.438) * (-1834.396) [-1820.903] (-1825.819) (-1827.714) -- 0:01:10
468500 -- (-1825.473) (-1830.307) (-1822.529) [-1821.466] * (-1827.591) (-1830.801) [-1828.860] (-1827.387) -- 0:01:10
469000 -- (-1830.795) [-1828.802] (-1824.213) (-1836.386) * (-1832.999) (-1830.583) (-1827.354) [-1823.109] -- 0:01:10
469500 -- (-1825.378) (-1828.867) (-1826.386) [-1826.441] * (-1831.316) (-1820.823) [-1827.452] (-1823.649) -- 0:01:10
470000 -- (-1826.054) (-1836.633) [-1829.047] (-1823.673) * [-1821.500] (-1830.444) (-1830.624) (-1824.089) -- 0:01:09
Average standard deviation of split frequencies: 0.010579
470500 -- [-1822.270] (-1822.280) (-1827.898) (-1833.807) * [-1825.000] (-1829.560) (-1830.279) (-1834.017) -- 0:01:10
471000 -- [-1831.532] (-1828.131) (-1823.677) (-1837.219) * [-1823.119] (-1822.101) (-1829.679) (-1831.374) -- 0:01:10
471500 -- (-1819.407) (-1821.743) [-1824.331] (-1825.143) * (-1828.455) (-1834.414) [-1827.566] (-1824.913) -- 0:01:10
472000 -- (-1821.858) [-1824.792] (-1830.444) (-1832.348) * [-1822.906] (-1825.924) (-1828.457) (-1835.686) -- 0:01:10
472500 -- (-1819.695) (-1824.906) (-1833.776) [-1827.952] * (-1824.994) [-1819.869] (-1831.058) (-1832.110) -- 0:01:10
473000 -- (-1818.492) (-1829.257) (-1817.997) [-1833.946] * (-1838.856) [-1834.807] (-1826.655) (-1830.297) -- 0:01:10
473500 -- (-1828.618) (-1835.597) [-1823.277] (-1827.083) * (-1835.660) (-1832.833) (-1826.933) [-1817.842] -- 0:01:10
474000 -- [-1830.504] (-1825.982) (-1826.478) (-1825.095) * [-1823.091] (-1829.182) (-1831.035) (-1831.717) -- 0:01:09
474500 -- (-1825.885) [-1832.173] (-1831.955) (-1830.015) * [-1828.768] (-1824.288) (-1828.092) (-1829.375) -- 0:01:09
475000 -- (-1825.564) (-1821.441) [-1826.615] (-1833.683) * (-1822.250) [-1827.440] (-1824.754) (-1833.770) -- 0:01:09
Average standard deviation of split frequencies: 0.010832
475500 -- [-1825.780] (-1836.299) (-1828.229) (-1832.385) * (-1819.770) [-1818.590] (-1824.180) (-1834.994) -- 0:01:09
476000 -- [-1821.844] (-1824.065) (-1819.754) (-1826.177) * (-1830.636) (-1826.497) [-1821.017] (-1833.483) -- 0:01:09
476500 -- (-1830.844) (-1833.262) [-1835.889] (-1834.463) * (-1830.623) (-1828.654) [-1819.405] (-1830.080) -- 0:01:09
477000 -- [-1818.934] (-1838.595) (-1831.799) (-1821.468) * [-1824.011] (-1822.942) (-1826.864) (-1828.828) -- 0:01:09
477500 -- (-1830.032) [-1824.692] (-1832.514) (-1829.580) * (-1830.276) [-1823.097] (-1828.502) (-1835.278) -- 0:01:08
478000 -- (-1822.457) (-1817.669) [-1837.702] (-1828.519) * (-1830.266) [-1817.972] (-1821.519) (-1828.186) -- 0:01:09
478500 -- (-1822.515) (-1835.336) [-1827.699] (-1832.032) * [-1823.177] (-1829.992) (-1830.133) (-1835.925) -- 0:01:09
479000 -- (-1822.356) (-1833.472) (-1834.187) [-1829.584] * (-1824.386) (-1826.646) [-1822.471] (-1828.564) -- 0:01:09
479500 -- (-1820.895) (-1836.710) [-1829.660] (-1826.540) * (-1832.575) (-1837.637) (-1836.077) [-1827.975] -- 0:01:09
480000 -- [-1831.194] (-1829.195) (-1823.529) (-1832.570) * (-1826.999) (-1824.679) [-1825.590] (-1829.860) -- 0:01:09
Average standard deviation of split frequencies: 0.011401
480500 -- [-1820.306] (-1826.897) (-1840.934) (-1835.090) * (-1824.324) (-1828.285) [-1824.623] (-1829.463) -- 0:01:09
481000 -- [-1820.939] (-1832.958) (-1825.977) (-1825.308) * (-1819.744) [-1824.963] (-1818.265) (-1831.040) -- 0:01:09
481500 -- [-1821.435] (-1821.663) (-1825.102) (-1829.415) * [-1823.424] (-1826.002) (-1824.250) (-1823.111) -- 0:01:08
482000 -- (-1822.813) (-1825.732) (-1828.173) [-1828.284] * (-1828.454) (-1835.074) (-1819.766) [-1830.551] -- 0:01:08
482500 -- [-1827.092] (-1827.545) (-1826.302) (-1828.342) * [-1825.367] (-1832.082) (-1821.704) (-1822.849) -- 0:01:08
483000 -- (-1820.300) [-1822.749] (-1830.116) (-1823.999) * (-1828.204) [-1824.171] (-1832.431) (-1827.525) -- 0:01:08
483500 -- (-1825.426) (-1829.628) (-1836.427) [-1828.899] * (-1829.286) (-1823.568) [-1827.687] (-1832.638) -- 0:01:08
484000 -- (-1824.841) (-1834.287) [-1832.257] (-1833.286) * [-1825.567] (-1821.197) (-1832.139) (-1829.334) -- 0:01:08
484500 -- (-1827.932) (-1835.673) (-1832.672) [-1827.445] * (-1822.823) (-1831.409) (-1830.097) [-1830.179] -- 0:01:08
485000 -- (-1827.957) (-1828.525) [-1833.664] (-1827.948) * (-1826.832) (-1825.909) (-1823.228) [-1825.822] -- 0:01:07
Average standard deviation of split frequencies: 0.010973
485500 -- (-1818.094) (-1827.418) [-1821.153] (-1824.750) * (-1823.647) [-1826.099] (-1832.271) (-1825.826) -- 0:01:08
486000 -- [-1827.196] (-1837.679) (-1820.187) (-1823.704) * [-1825.732] (-1824.296) (-1828.335) (-1824.583) -- 0:01:08
486500 -- (-1822.444) (-1826.028) (-1824.668) [-1825.062] * [-1828.380] (-1820.117) (-1830.985) (-1823.258) -- 0:01:08
487000 -- (-1827.326) (-1835.721) (-1831.816) [-1818.955] * (-1824.173) [-1821.942] (-1825.866) (-1829.715) -- 0:01:08
487500 -- (-1825.605) [-1830.118] (-1832.791) (-1830.320) * (-1827.431) [-1822.727] (-1834.683) (-1820.440) -- 0:01:08
488000 -- (-1824.257) [-1824.485] (-1821.874) (-1831.680) * (-1825.934) [-1829.888] (-1833.040) (-1831.403) -- 0:01:08
488500 -- [-1825.693] (-1829.857) (-1830.826) (-1829.213) * (-1830.491) (-1824.668) (-1824.897) [-1829.633] -- 0:01:08
489000 -- (-1828.718) [-1829.512] (-1833.101) (-1835.774) * (-1820.150) (-1825.433) (-1828.911) [-1822.671] -- 0:01:07
489500 -- (-1834.466) (-1830.424) (-1829.637) [-1829.081] * (-1827.573) (-1827.596) [-1823.694] (-1828.762) -- 0:01:07
490000 -- (-1825.720) [-1828.063] (-1829.330) (-1830.968) * (-1824.541) (-1830.342) [-1820.828] (-1826.790) -- 0:01:07
Average standard deviation of split frequencies: 0.010148
490500 -- (-1824.060) [-1819.838] (-1831.776) (-1822.474) * (-1829.092) (-1835.313) (-1823.211) [-1819.869] -- 0:01:07
491000 -- (-1830.960) (-1825.398) [-1831.620] (-1829.571) * (-1823.284) [-1826.421] (-1829.417) (-1825.497) -- 0:01:07
491500 -- (-1820.720) (-1832.213) [-1827.989] (-1834.120) * (-1837.103) (-1825.484) (-1825.670) [-1824.141] -- 0:01:07
492000 -- [-1819.170] (-1822.582) (-1828.399) (-1830.121) * (-1829.841) (-1830.387) [-1822.867] (-1824.217) -- 0:01:07
492500 -- (-1830.816) (-1824.949) (-1827.005) [-1823.370] * (-1826.504) (-1827.451) [-1826.069] (-1824.711) -- 0:01:06
493000 -- (-1827.587) (-1824.280) [-1829.959] (-1834.354) * (-1824.239) [-1829.453] (-1830.603) (-1825.956) -- 0:01:07
493500 -- (-1838.477) (-1828.434) [-1827.442] (-1827.968) * [-1820.867] (-1829.134) (-1834.204) (-1832.726) -- 0:01:07
494000 -- [-1829.065] (-1831.318) (-1836.646) (-1826.006) * (-1831.537) [-1824.645] (-1840.006) (-1835.151) -- 0:01:07
494500 -- (-1835.086) [-1828.353] (-1819.777) (-1820.472) * (-1832.903) [-1824.308] (-1829.250) (-1832.152) -- 0:01:07
495000 -- (-1833.919) (-1827.866) (-1825.153) [-1826.315] * [-1826.436] (-1822.884) (-1838.264) (-1828.719) -- 0:01:07
Average standard deviation of split frequencies: 0.010217
495500 -- [-1826.694] (-1833.035) (-1832.772) (-1826.507) * [-1825.209] (-1832.963) (-1827.947) (-1828.352) -- 0:01:07
496000 -- (-1825.031) (-1835.645) (-1824.255) [-1822.009] * (-1827.135) [-1826.829] (-1819.298) (-1840.379) -- 0:01:07
496500 -- (-1824.632) (-1827.165) [-1825.752] (-1829.569) * (-1829.072) (-1827.987) [-1823.097] (-1830.703) -- 0:01:06
497000 -- (-1829.944) [-1821.616] (-1837.040) (-1824.922) * (-1834.008) (-1831.402) (-1823.539) [-1828.846] -- 0:01:06
497500 -- [-1826.578] (-1820.991) (-1832.308) (-1825.841) * [-1822.391] (-1828.382) (-1829.213) (-1832.727) -- 0:01:06
498000 -- (-1825.467) (-1827.743) [-1830.575] (-1821.766) * (-1833.374) (-1823.520) [-1820.275] (-1833.088) -- 0:01:06
498500 -- [-1825.148] (-1827.429) (-1837.101) (-1834.535) * (-1824.859) [-1826.500] (-1821.764) (-1828.321) -- 0:01:06
499000 -- (-1823.578) (-1826.270) [-1830.331] (-1838.933) * (-1834.772) (-1832.153) [-1820.685] (-1826.776) -- 0:01:06
499500 -- (-1834.003) [-1819.556] (-1831.773) (-1826.642) * (-1829.937) (-1824.525) [-1823.071] (-1833.204) -- 0:01:06
500000 -- (-1829.165) (-1820.533) [-1822.438] (-1827.231) * (-1823.636) (-1826.429) [-1819.958] (-1829.752) -- 0:01:06
Average standard deviation of split frequencies: 0.010063
500500 -- [-1822.301] (-1838.287) (-1829.868) (-1831.195) * [-1826.444] (-1830.675) (-1819.786) (-1828.805) -- 0:01:06
501000 -- (-1834.376) (-1827.045) [-1833.975] (-1822.653) * (-1833.976) [-1825.509] (-1818.658) (-1827.410) -- 0:01:06
501500 -- (-1834.339) (-1828.093) [-1826.145] (-1828.162) * (-1831.183) [-1833.629] (-1822.290) (-1829.938) -- 0:01:06
502000 -- (-1836.386) [-1824.819] (-1831.727) (-1832.930) * (-1828.283) (-1828.622) (-1826.003) [-1824.663] -- 0:01:06
502500 -- (-1826.275) (-1828.872) [-1835.027] (-1830.373) * [-1822.133] (-1828.697) (-1826.797) (-1830.968) -- 0:01:06
503000 -- (-1827.383) (-1826.159) [-1822.019] (-1827.257) * (-1831.395) (-1827.443) [-1818.797] (-1824.495) -- 0:01:06
503500 -- (-1828.706) (-1828.112) (-1825.963) [-1825.105] * [-1825.164] (-1825.620) (-1823.723) (-1827.016) -- 0:01:06
504000 -- (-1833.660) [-1826.777] (-1823.247) (-1833.315) * (-1834.551) [-1825.581] (-1828.079) (-1830.579) -- 0:01:05
504500 -- [-1824.923] (-1827.527) (-1826.760) (-1828.056) * (-1823.819) (-1822.331) [-1825.910] (-1825.389) -- 0:01:05
505000 -- (-1826.809) [-1828.435] (-1832.661) (-1833.666) * (-1839.584) (-1822.305) [-1821.237] (-1835.954) -- 0:01:05
Average standard deviation of split frequencies: 0.009724
505500 -- (-1820.325) (-1828.409) [-1828.571] (-1824.608) * (-1832.352) (-1824.337) [-1834.614] (-1823.979) -- 0:01:05
506000 -- (-1826.796) (-1825.563) [-1825.343] (-1824.621) * (-1824.395) (-1828.272) (-1823.359) [-1821.752] -- 0:01:05
506500 -- (-1824.374) [-1828.948] (-1823.759) (-1824.981) * [-1820.678] (-1840.124) (-1830.059) (-1829.426) -- 0:01:05
507000 -- (-1832.327) (-1829.177) (-1827.753) [-1822.410] * (-1830.810) (-1827.461) [-1818.383] (-1829.292) -- 0:01:05
507500 -- (-1832.512) [-1827.370] (-1839.531) (-1820.179) * (-1832.305) (-1828.995) [-1824.265] (-1825.802) -- 0:01:05
508000 -- (-1828.643) (-1825.843) [-1827.795] (-1825.538) * (-1822.332) (-1828.133) (-1832.619) [-1828.350] -- 0:01:05
508500 -- (-1821.285) (-1826.729) [-1830.552] (-1828.139) * (-1828.111) (-1823.610) [-1826.402] (-1827.918) -- 0:01:05
509000 -- (-1825.708) (-1828.145) (-1826.538) [-1820.557] * (-1830.611) (-1830.963) [-1825.605] (-1834.076) -- 0:01:05
509500 -- (-1834.202) (-1830.412) (-1826.736) [-1826.457] * (-1838.221) (-1824.092) [-1824.317] (-1823.722) -- 0:01:05
510000 -- (-1830.237) (-1830.978) [-1832.721] (-1826.966) * (-1828.634) [-1829.012] (-1834.465) (-1829.560) -- 0:01:05
Average standard deviation of split frequencies: 0.010039
510500 -- (-1824.782) [-1827.263] (-1825.666) (-1828.961) * (-1828.582) [-1827.687] (-1831.791) (-1819.320) -- 0:01:05
511000 -- [-1830.950] (-1832.188) (-1824.577) (-1822.436) * (-1825.708) [-1833.228] (-1823.458) (-1825.494) -- 0:01:05
511500 -- [-1836.444] (-1824.315) (-1830.464) (-1822.735) * (-1836.425) [-1827.583] (-1826.397) (-1827.592) -- 0:01:04
512000 -- (-1827.707) (-1834.937) [-1824.723] (-1828.541) * (-1828.825) [-1831.724] (-1825.161) (-1827.393) -- 0:01:04
512500 -- (-1826.406) [-1822.589] (-1821.008) (-1838.900) * (-1828.268) [-1823.780] (-1834.023) (-1822.717) -- 0:01:04
513000 -- (-1829.267) (-1830.258) [-1825.174] (-1831.083) * (-1830.964) (-1827.844) (-1824.187) [-1822.887] -- 0:01:04
513500 -- (-1828.485) (-1826.487) (-1833.478) [-1822.107] * (-1829.456) (-1826.578) [-1822.798] (-1829.788) -- 0:01:04
514000 -- (-1821.294) (-1829.113) [-1824.682] (-1822.529) * (-1826.783) (-1830.702) (-1824.931) [-1828.443] -- 0:01:04
514500 -- (-1823.973) (-1828.287) [-1828.646] (-1823.871) * (-1833.669) [-1822.529] (-1828.421) (-1828.750) -- 0:01:04
515000 -- (-1824.119) (-1827.011) (-1830.054) [-1830.227] * [-1831.121] (-1827.515) (-1823.722) (-1826.467) -- 0:01:04
Average standard deviation of split frequencies: 0.009928
515500 -- (-1841.829) [-1824.652] (-1825.882) (-1825.562) * (-1828.091) [-1829.370] (-1831.296) (-1827.684) -- 0:01:04
516000 -- (-1824.018) [-1825.199] (-1825.692) (-1824.142) * (-1827.204) [-1820.810] (-1827.853) (-1826.876) -- 0:01:04
516500 -- (-1832.977) (-1825.241) [-1824.417] (-1828.230) * (-1827.459) [-1822.944] (-1826.511) (-1826.588) -- 0:01:04
517000 -- (-1827.747) [-1829.025] (-1831.600) (-1828.334) * [-1826.652] (-1829.562) (-1832.762) (-1826.043) -- 0:01:04
517500 -- (-1836.614) [-1822.816] (-1824.226) (-1829.990) * (-1839.566) (-1819.127) (-1830.215) [-1825.091] -- 0:01:04
518000 -- (-1831.001) [-1827.052] (-1834.523) (-1821.789) * (-1831.753) (-1825.674) (-1826.355) [-1825.308] -- 0:01:04
518500 -- [-1826.694] (-1818.012) (-1824.343) (-1828.909) * (-1824.465) [-1822.719] (-1820.611) (-1827.722) -- 0:01:04
519000 -- (-1824.856) (-1824.079) (-1833.145) [-1825.096] * [-1822.378] (-1829.249) (-1823.162) (-1838.056) -- 0:01:03
519500 -- (-1822.080) [-1823.959] (-1836.315) (-1826.533) * [-1824.351] (-1833.183) (-1823.096) (-1836.026) -- 0:01:03
520000 -- (-1823.829) (-1819.563) (-1829.054) [-1826.108] * [-1827.383] (-1823.590) (-1828.796) (-1823.095) -- 0:01:03
Average standard deviation of split frequencies: 0.011770
520500 -- (-1831.876) [-1825.078] (-1824.855) (-1825.638) * (-1833.143) (-1826.287) [-1819.527] (-1825.011) -- 0:01:03
521000 -- (-1826.704) (-1831.830) (-1828.084) [-1824.703] * (-1827.879) (-1824.116) [-1827.804] (-1826.923) -- 0:01:03
521500 -- (-1827.466) (-1830.413) [-1821.527] (-1825.726) * [-1830.158] (-1824.054) (-1827.378) (-1829.196) -- 0:01:03
522000 -- (-1825.531) [-1826.539] (-1838.495) (-1830.289) * (-1832.418) [-1821.453] (-1833.547) (-1831.203) -- 0:01:03
522500 -- (-1826.671) (-1825.207) (-1829.962) [-1835.313] * [-1825.166] (-1825.639) (-1834.015) (-1835.038) -- 0:01:03
523000 -- [-1820.756] (-1820.929) (-1828.234) (-1821.163) * (-1837.574) [-1827.328] (-1822.901) (-1825.152) -- 0:01:03
523500 -- (-1825.923) [-1826.775] (-1828.771) (-1830.311) * (-1830.485) (-1828.917) (-1827.294) [-1823.950] -- 0:01:03
524000 -- (-1828.688) (-1833.573) [-1823.302] (-1831.081) * (-1829.303) (-1833.361) [-1823.661] (-1820.217) -- 0:01:03
524500 -- [-1822.091] (-1829.995) (-1829.566) (-1835.364) * (-1826.632) [-1825.596] (-1827.799) (-1825.516) -- 0:01:03
525000 -- (-1822.839) (-1831.056) [-1823.963] (-1830.113) * [-1827.764] (-1825.073) (-1824.203) (-1823.580) -- 0:01:03
Average standard deviation of split frequencies: 0.011334
525500 -- [-1826.318] (-1828.071) (-1826.713) (-1823.186) * [-1831.502] (-1826.642) (-1825.445) (-1828.165) -- 0:01:03
526000 -- (-1827.593) (-1827.981) (-1826.475) [-1822.079] * [-1822.850] (-1821.899) (-1827.151) (-1830.282) -- 0:01:03
526500 -- (-1835.331) (-1829.172) [-1827.950] (-1827.108) * (-1825.615) (-1825.496) [-1826.313] (-1823.552) -- 0:01:02
527000 -- [-1832.435] (-1819.868) (-1824.442) (-1824.118) * (-1836.728) (-1838.562) (-1830.522) [-1827.300] -- 0:01:02
527500 -- (-1832.490) [-1824.213] (-1822.454) (-1825.916) * (-1828.996) (-1821.026) (-1824.384) [-1831.716] -- 0:01:02
528000 -- (-1824.884) (-1819.040) [-1819.685] (-1819.901) * (-1831.466) [-1824.466] (-1829.658) (-1822.660) -- 0:01:02
528500 -- (-1827.442) [-1826.038] (-1827.851) (-1832.493) * (-1830.442) (-1830.957) (-1824.439) [-1824.922] -- 0:01:02
529000 -- [-1829.550] (-1825.247) (-1823.607) (-1829.870) * (-1835.826) (-1833.682) (-1834.296) [-1823.221] -- 0:01:02
529500 -- (-1818.881) (-1825.492) [-1821.552] (-1832.058) * [-1830.000] (-1824.610) (-1822.312) (-1827.148) -- 0:01:02
530000 -- [-1827.198] (-1827.229) (-1824.718) (-1830.412) * (-1831.416) [-1826.775] (-1830.167) (-1824.427) -- 0:01:02
Average standard deviation of split frequencies: 0.011757
530500 -- (-1835.514) (-1831.385) [-1824.489] (-1825.155) * [-1831.774] (-1829.409) (-1825.370) (-1820.054) -- 0:01:02
531000 -- [-1826.021] (-1833.218) (-1831.376) (-1831.792) * (-1831.060) [-1826.780] (-1827.132) (-1828.387) -- 0:01:02
531500 -- (-1827.522) (-1830.720) [-1822.103] (-1824.354) * [-1830.697] (-1823.246) (-1828.384) (-1824.960) -- 0:01:02
532000 -- (-1823.763) (-1833.166) [-1825.454] (-1835.019) * (-1831.664) [-1829.078] (-1825.419) (-1825.152) -- 0:01:02
532500 -- (-1828.897) [-1823.408] (-1836.633) (-1824.055) * (-1830.814) (-1825.351) (-1829.398) [-1829.484] -- 0:01:02
533000 -- (-1831.683) [-1819.281] (-1830.219) (-1834.663) * (-1833.372) (-1828.280) (-1825.882) [-1831.854] -- 0:01:02
533500 -- (-1827.788) [-1824.949] (-1825.396) (-1826.991) * (-1834.002) (-1821.345) (-1825.336) [-1823.882] -- 0:01:02
534000 -- [-1833.618] (-1827.996) (-1834.709) (-1832.278) * (-1825.612) (-1832.950) (-1831.164) [-1828.210] -- 0:01:01
534500 -- (-1830.898) (-1821.439) [-1825.757] (-1830.143) * [-1829.710] (-1824.595) (-1830.681) (-1825.377) -- 0:01:01
535000 -- (-1828.582) (-1825.807) [-1829.927] (-1827.063) * (-1827.540) (-1831.887) [-1827.982] (-1833.547) -- 0:01:01
Average standard deviation of split frequencies: 0.011537
535500 -- (-1826.411) (-1841.900) (-1830.510) [-1826.757] * (-1831.871) (-1838.520) (-1826.351) [-1822.643] -- 0:01:01
536000 -- (-1819.732) [-1822.510] (-1829.431) (-1832.140) * (-1824.954) [-1823.712] (-1825.366) (-1826.390) -- 0:01:01
536500 -- [-1822.950] (-1824.077) (-1825.385) (-1831.077) * (-1829.220) [-1828.953] (-1824.256) (-1828.288) -- 0:01:01
537000 -- (-1836.232) [-1833.700] (-1826.867) (-1827.825) * (-1820.464) (-1822.996) (-1825.380) [-1823.890] -- 0:01:01
537500 -- (-1826.554) (-1830.720) [-1819.776] (-1828.875) * (-1821.212) (-1826.161) [-1823.208] (-1824.337) -- 0:01:01
538000 -- (-1822.020) (-1828.534) (-1821.316) [-1836.794] * [-1829.583] (-1832.259) (-1823.705) (-1827.426) -- 0:01:01
538500 -- (-1827.164) (-1835.524) [-1820.996] (-1830.202) * (-1828.201) (-1831.448) (-1827.372) [-1831.128] -- 0:01:01
539000 -- (-1822.445) (-1824.914) [-1822.019] (-1838.057) * (-1824.175) [-1835.062] (-1825.320) (-1821.333) -- 0:01:01
539500 -- (-1826.272) (-1832.201) (-1823.197) [-1828.746] * [-1829.118] (-1828.652) (-1824.113) (-1820.850) -- 0:01:01
540000 -- (-1833.215) (-1827.713) [-1818.602] (-1832.104) * (-1832.153) (-1827.633) (-1832.282) [-1825.167] -- 0:01:01
Average standard deviation of split frequencies: 0.011386
540500 -- (-1833.794) (-1830.218) [-1820.177] (-1827.328) * [-1821.413] (-1823.345) (-1832.057) (-1829.790) -- 0:01:01
541000 -- (-1826.645) [-1830.551] (-1830.130) (-1837.788) * (-1826.682) [-1821.721] (-1824.604) (-1826.417) -- 0:01:01
541500 -- [-1822.903] (-1829.203) (-1831.231) (-1832.720) * [-1820.925] (-1829.524) (-1824.142) (-1832.541) -- 0:01:00
542000 -- (-1833.984) (-1832.970) [-1824.512] (-1833.476) * [-1832.338] (-1829.977) (-1830.483) (-1830.879) -- 0:01:00
542500 -- (-1827.029) (-1834.783) (-1834.241) [-1828.206] * (-1829.119) [-1823.396] (-1823.269) (-1826.967) -- 0:01:00
543000 -- (-1833.518) [-1827.973] (-1829.200) (-1828.621) * (-1829.818) (-1832.493) [-1824.037] (-1824.206) -- 0:01:00
543500 -- (-1830.702) (-1827.062) [-1827.155] (-1829.910) * (-1826.708) [-1821.693] (-1826.328) (-1832.998) -- 0:01:00
544000 -- [-1821.481] (-1833.216) (-1823.263) (-1829.175) * (-1827.310) [-1831.634] (-1828.019) (-1828.301) -- 0:01:00
544500 -- (-1826.398) [-1826.071] (-1829.492) (-1831.536) * (-1821.250) (-1825.061) [-1828.006] (-1833.669) -- 0:01:00
545000 -- (-1833.240) (-1828.495) [-1831.936] (-1826.142) * [-1820.558] (-1826.772) (-1821.179) (-1825.235) -- 0:01:00
Average standard deviation of split frequencies: 0.012087
545500 -- (-1830.954) [-1822.826] (-1838.319) (-1830.046) * (-1833.118) (-1830.205) (-1823.801) [-1823.725] -- 0:01:00
546000 -- (-1829.213) [-1830.211] (-1832.621) (-1822.520) * (-1824.842) (-1828.244) [-1824.948] (-1827.045) -- 0:01:00
546500 -- (-1831.426) [-1821.308] (-1839.764) (-1835.217) * (-1827.032) (-1825.626) [-1820.940] (-1835.505) -- 0:01:00
547000 -- (-1823.628) (-1824.270) (-1827.306) [-1832.767] * (-1833.850) (-1828.809) (-1827.390) [-1823.751] -- 0:01:00
547500 -- (-1836.901) [-1821.435] (-1824.309) (-1821.209) * [-1830.893] (-1838.201) (-1832.019) (-1820.793) -- 0:01:00
548000 -- (-1825.843) (-1817.415) [-1822.542] (-1826.695) * (-1825.788) (-1831.766) [-1826.038] (-1830.632) -- 0:01:00
548500 -- (-1824.198) [-1833.111] (-1823.220) (-1834.605) * [-1830.725] (-1826.263) (-1832.890) (-1826.159) -- 0:01:00
549000 -- [-1826.989] (-1828.300) (-1827.774) (-1823.872) * (-1830.861) (-1824.795) [-1826.326] (-1830.981) -- 0:00:59
549500 -- (-1828.446) (-1838.835) [-1827.001] (-1827.322) * (-1828.705) (-1828.077) [-1831.717] (-1820.887) -- 0:00:59
550000 -- (-1825.193) (-1821.861) (-1827.854) [-1823.566] * [-1825.540] (-1825.363) (-1840.185) (-1833.650) -- 0:00:59
Average standard deviation of split frequencies: 0.012488
550500 -- (-1829.485) (-1827.276) [-1825.372] (-1823.506) * (-1834.970) (-1830.814) [-1821.455] (-1825.575) -- 0:00:59
551000 -- [-1821.884] (-1827.783) (-1826.203) (-1823.000) * (-1824.353) (-1824.568) [-1822.439] (-1836.791) -- 0:00:59
551500 -- [-1833.278] (-1828.112) (-1824.614) (-1823.656) * [-1825.120] (-1834.361) (-1825.009) (-1835.912) -- 0:00:59
552000 -- (-1828.996) (-1820.802) (-1825.886) [-1821.555] * (-1824.913) (-1831.931) (-1828.396) [-1823.915] -- 0:00:59
552500 -- [-1834.151] (-1822.781) (-1825.555) (-1825.923) * (-1820.177) (-1827.782) [-1828.363] (-1828.324) -- 0:00:59
553000 -- (-1824.464) (-1826.811) (-1822.335) [-1825.900] * [-1828.968] (-1823.520) (-1830.286) (-1828.135) -- 0:00:59
553500 -- (-1828.946) (-1823.180) [-1824.981] (-1824.622) * [-1823.732] (-1822.531) (-1827.499) (-1831.317) -- 0:00:59
554000 -- (-1831.536) (-1822.272) (-1823.813) [-1834.406] * [-1819.081] (-1836.220) (-1823.067) (-1829.421) -- 0:00:59
554500 -- (-1831.019) (-1827.231) [-1825.401] (-1826.995) * (-1850.199) (-1826.882) (-1829.912) [-1824.528] -- 0:00:59
555000 -- (-1827.418) [-1824.995] (-1829.391) (-1817.233) * (-1824.078) (-1827.673) [-1826.576] (-1827.549) -- 0:00:59
Average standard deviation of split frequencies: 0.012319
555500 -- [-1827.199] (-1828.483) (-1824.034) (-1823.099) * [-1839.905] (-1828.755) (-1824.135) (-1834.025) -- 0:00:59
556000 -- (-1821.251) (-1829.440) [-1822.141] (-1826.475) * [-1826.386] (-1836.057) (-1836.896) (-1825.321) -- 0:00:59
556500 -- (-1822.942) (-1831.945) (-1825.693) [-1828.226] * (-1828.558) [-1831.548] (-1826.727) (-1822.937) -- 0:00:58
557000 -- (-1832.802) (-1821.785) [-1826.730] (-1836.915) * (-1835.083) (-1826.517) (-1826.010) [-1830.635] -- 0:00:58
557500 -- (-1824.891) (-1838.272) [-1831.166] (-1827.584) * (-1838.376) [-1822.737] (-1826.542) (-1820.846) -- 0:00:58
558000 -- (-1828.526) [-1821.133] (-1832.433) (-1824.683) * (-1824.166) (-1828.960) [-1828.487] (-1826.022) -- 0:00:58
558500 -- (-1831.599) (-1825.430) (-1830.692) [-1822.908] * (-1826.335) (-1835.587) [-1826.125] (-1829.241) -- 0:00:58
559000 -- (-1825.661) [-1830.159] (-1828.610) (-1831.145) * (-1821.135) [-1820.787] (-1826.810) (-1824.077) -- 0:00:58
559500 -- [-1824.516] (-1830.561) (-1820.812) (-1821.294) * (-1826.744) (-1825.923) (-1823.293) [-1824.602] -- 0:00:58
560000 -- (-1823.635) (-1833.728) [-1833.047] (-1834.799) * (-1828.960) (-1833.172) [-1828.259] (-1831.699) -- 0:00:58
Average standard deviation of split frequencies: 0.012562
560500 -- (-1824.638) (-1834.679) [-1820.476] (-1829.291) * (-1835.141) (-1825.751) [-1825.695] (-1832.328) -- 0:00:58
561000 -- [-1827.552] (-1824.369) (-1836.400) (-1826.713) * (-1830.562) (-1830.579) (-1830.247) [-1832.149] -- 0:00:58
561500 -- (-1830.425) (-1825.454) [-1829.123] (-1834.243) * (-1827.374) [-1827.208] (-1831.980) (-1838.662) -- 0:00:58
562000 -- (-1835.947) (-1826.284) [-1827.682] (-1830.780) * (-1829.662) (-1820.224) (-1832.749) [-1833.812] -- 0:00:58
562500 -- (-1835.659) (-1829.570) (-1832.623) [-1826.361] * (-1828.430) [-1823.975] (-1834.196) (-1823.587) -- 0:00:58
563000 -- (-1826.658) [-1822.614] (-1827.875) (-1829.812) * [-1825.128] (-1828.040) (-1830.491) (-1841.877) -- 0:00:58
563500 -- (-1823.156) (-1826.601) [-1823.461] (-1823.682) * (-1824.695) [-1829.509] (-1826.862) (-1845.505) -- 0:00:58
564000 -- (-1832.102) (-1822.457) [-1823.329] (-1822.554) * [-1831.127] (-1820.059) (-1821.687) (-1835.756) -- 0:00:57
564500 -- (-1831.443) (-1822.238) (-1824.666) [-1826.208] * (-1830.926) (-1825.869) [-1822.382] (-1831.244) -- 0:00:57
565000 -- (-1826.289) (-1825.009) [-1822.725] (-1829.699) * [-1826.113] (-1827.064) (-1829.842) (-1832.768) -- 0:00:57
Average standard deviation of split frequencies: 0.012787
565500 -- (-1828.126) (-1833.876) (-1822.990) [-1825.478] * [-1827.174] (-1835.231) (-1823.542) (-1827.161) -- 0:00:57
566000 -- (-1828.139) (-1827.102) [-1821.900] (-1828.648) * (-1832.226) (-1827.813) (-1825.537) [-1826.100] -- 0:00:57
566500 -- (-1831.266) (-1840.607) [-1827.216] (-1828.982) * (-1829.058) [-1826.286] (-1830.311) (-1826.107) -- 0:00:57
567000 -- (-1832.669) (-1824.303) (-1832.152) [-1824.689] * [-1824.502] (-1824.659) (-1833.872) (-1832.222) -- 0:00:57
567500 -- (-1823.585) (-1830.700) [-1821.985] (-1834.328) * (-1831.127) [-1829.193] (-1833.953) (-1831.473) -- 0:00:57
568000 -- (-1823.739) (-1830.983) [-1829.977] (-1827.559) * [-1820.690] (-1832.303) (-1827.676) (-1825.552) -- 0:00:57
568500 -- [-1826.707] (-1829.066) (-1833.012) (-1823.794) * [-1828.128] (-1826.306) (-1827.480) (-1827.423) -- 0:00:57
569000 -- (-1832.772) (-1824.896) (-1823.861) [-1835.612] * [-1829.512] (-1830.041) (-1830.516) (-1834.166) -- 0:00:57
569500 -- (-1826.422) (-1831.563) [-1827.423] (-1826.397) * [-1835.683] (-1825.865) (-1827.667) (-1827.244) -- 0:00:57
570000 -- [-1821.527] (-1822.266) (-1839.970) (-1822.485) * (-1829.848) [-1824.986] (-1830.537) (-1831.748) -- 0:00:57
Average standard deviation of split frequencies: 0.012148
570500 -- (-1819.289) (-1828.883) (-1832.220) [-1820.437] * (-1828.679) (-1824.997) (-1827.823) [-1827.583] -- 0:00:57
571000 -- (-1832.686) (-1828.767) (-1834.708) [-1824.799] * (-1829.210) (-1823.589) (-1838.685) [-1827.025] -- 0:00:57
571500 -- (-1823.701) (-1838.677) [-1828.510] (-1828.370) * (-1824.974) (-1827.884) (-1830.482) [-1827.497] -- 0:00:56
572000 -- (-1830.432) (-1833.196) (-1830.718) [-1827.685] * (-1832.836) [-1825.880] (-1840.570) (-1827.490) -- 0:00:56
572500 -- [-1826.245] (-1839.032) (-1823.500) (-1835.551) * (-1834.500) (-1828.957) [-1826.843] (-1832.149) -- 0:00:56
573000 -- [-1823.014] (-1822.117) (-1823.427) (-1824.202) * (-1830.784) (-1823.462) (-1826.662) [-1825.581] -- 0:00:56
573500 -- (-1821.205) [-1825.614] (-1827.367) (-1826.622) * (-1834.829) (-1828.425) [-1829.482] (-1831.621) -- 0:00:56
574000 -- (-1834.540) [-1825.701] (-1822.420) (-1827.429) * (-1839.769) [-1827.415] (-1830.545) (-1835.408) -- 0:00:56
574500 -- [-1827.764] (-1824.419) (-1823.526) (-1830.171) * (-1832.846) [-1825.903] (-1827.616) (-1831.726) -- 0:00:56
575000 -- (-1830.715) (-1831.523) [-1820.544] (-1825.769) * [-1832.581] (-1828.590) (-1830.390) (-1834.407) -- 0:00:56
Average standard deviation of split frequencies: 0.011843
575500 -- (-1826.325) (-1825.590) (-1821.511) [-1820.520] * [-1820.587] (-1842.380) (-1827.136) (-1830.018) -- 0:00:56
576000 -- (-1828.844) (-1827.185) [-1823.184] (-1825.355) * [-1837.245] (-1836.389) (-1826.685) (-1823.357) -- 0:00:56
576500 -- [-1831.349] (-1830.173) (-1825.742) (-1828.938) * (-1825.177) [-1832.848] (-1833.428) (-1822.773) -- 0:00:56
577000 -- (-1826.741) (-1823.998) [-1827.301] (-1831.162) * (-1826.705) (-1835.317) [-1826.596] (-1833.939) -- 0:00:56
577500 -- (-1830.383) (-1833.573) (-1824.947) [-1820.306] * [-1819.427] (-1823.253) (-1827.399) (-1825.991) -- 0:00:56
578000 -- [-1828.351] (-1828.970) (-1839.982) (-1830.150) * [-1828.082] (-1835.907) (-1823.594) (-1829.778) -- 0:00:56
578500 -- (-1824.831) (-1831.670) (-1824.813) [-1820.662] * (-1824.815) (-1823.196) (-1832.575) [-1819.244] -- 0:00:56
579000 -- (-1826.417) [-1834.554] (-1827.882) (-1823.425) * (-1827.139) (-1830.052) [-1832.798] (-1832.916) -- 0:00:55
579500 -- (-1824.865) (-1843.170) [-1824.708] (-1821.474) * (-1824.634) (-1829.003) [-1826.218] (-1826.531) -- 0:00:55
580000 -- (-1830.603) (-1832.527) [-1821.635] (-1833.726) * [-1829.886] (-1822.112) (-1826.360) (-1826.407) -- 0:00:55
Average standard deviation of split frequencies: 0.011061
580500 -- (-1824.997) [-1823.252] (-1824.049) (-1829.345) * (-1826.809) (-1826.230) (-1825.452) [-1821.229] -- 0:00:55
581000 -- (-1833.709) [-1822.766] (-1821.871) (-1825.633) * (-1823.720) [-1830.331] (-1827.622) (-1826.038) -- 0:00:55
581500 -- (-1828.426) (-1829.876) (-1819.537) [-1827.184] * (-1823.595) [-1828.726] (-1826.860) (-1831.371) -- 0:00:55
582000 -- [-1827.947] (-1829.546) (-1822.852) (-1829.344) * (-1829.091) [-1824.956] (-1825.551) (-1821.833) -- 0:00:55
582500 -- (-1824.122) [-1827.771] (-1829.556) (-1825.632) * (-1823.863) [-1823.817] (-1827.122) (-1823.911) -- 0:00:55
583000 -- [-1823.541] (-1828.310) (-1827.311) (-1823.324) * (-1831.183) [-1826.332] (-1828.733) (-1823.095) -- 0:00:55
583500 -- (-1825.477) (-1830.236) [-1824.789] (-1825.012) * [-1823.452] (-1827.165) (-1833.155) (-1837.995) -- 0:00:55
584000 -- (-1837.888) (-1825.341) [-1828.030] (-1828.736) * (-1835.325) [-1825.841] (-1820.516) (-1819.008) -- 0:00:55
584500 -- (-1830.430) (-1830.254) [-1826.754] (-1833.466) * (-1824.151) (-1830.049) (-1837.110) [-1821.234] -- 0:00:55
585000 -- (-1831.736) (-1830.843) (-1827.984) [-1830.966] * [-1824.686] (-1826.775) (-1824.872) (-1826.232) -- 0:00:55
Average standard deviation of split frequencies: 0.010458
585500 -- (-1820.543) (-1820.557) [-1827.690] (-1828.657) * (-1833.721) (-1823.596) (-1822.850) [-1823.545] -- 0:00:55
586000 -- (-1827.645) (-1829.386) [-1820.771] (-1820.809) * (-1829.705) [-1831.152] (-1827.533) (-1837.148) -- 0:00:55
586500 -- (-1824.992) (-1831.114) (-1829.676) [-1830.679] * (-1827.067) [-1828.724] (-1824.318) (-1827.141) -- 0:00:54
587000 -- [-1823.005] (-1829.136) (-1825.261) (-1826.127) * (-1821.709) (-1827.017) (-1834.529) [-1823.265] -- 0:00:54
587500 -- [-1819.995] (-1825.092) (-1830.958) (-1835.411) * (-1831.010) [-1825.939] (-1826.767) (-1828.973) -- 0:00:54
588000 -- (-1822.906) (-1827.872) [-1828.296] (-1823.066) * (-1828.614) [-1822.652] (-1823.150) (-1823.042) -- 0:00:54
588500 -- [-1823.923] (-1829.691) (-1828.607) (-1835.182) * (-1823.760) (-1825.708) (-1829.114) [-1827.929] -- 0:00:54
589000 -- [-1826.356] (-1836.368) (-1820.716) (-1832.604) * (-1828.881) (-1829.708) [-1821.789] (-1827.312) -- 0:00:54
589500 -- (-1833.697) (-1828.122) [-1825.804] (-1829.989) * (-1831.304) (-1825.369) [-1824.443] (-1828.018) -- 0:00:54
590000 -- (-1838.753) (-1823.082) (-1824.350) [-1823.546] * (-1823.735) [-1827.803] (-1826.903) (-1824.850) -- 0:00:54
Average standard deviation of split frequencies: 0.010428
590500 -- (-1829.095) (-1821.139) (-1821.317) [-1823.487] * (-1825.619) (-1826.670) [-1826.409] (-1828.395) -- 0:00:54
591000 -- (-1831.262) [-1826.584] (-1824.969) (-1841.629) * (-1831.224) (-1828.122) [-1819.662] (-1826.885) -- 0:00:54
591500 -- (-1833.693) (-1827.817) [-1826.174] (-1821.680) * [-1828.655] (-1830.366) (-1825.854) (-1824.656) -- 0:00:54
592000 -- (-1824.713) (-1823.598) (-1824.646) [-1826.363] * [-1824.454] (-1829.971) (-1830.290) (-1824.610) -- 0:00:54
592500 -- (-1824.875) (-1827.381) (-1826.936) [-1827.772] * (-1825.922) [-1832.436] (-1826.440) (-1824.278) -- 0:00:54
593000 -- (-1820.975) (-1825.297) [-1831.068] (-1822.231) * (-1820.941) (-1831.859) (-1826.970) [-1828.864] -- 0:00:54
593500 -- (-1828.647) (-1835.158) [-1824.138] (-1825.460) * (-1831.913) (-1828.207) [-1824.331] (-1829.515) -- 0:00:54
594000 -- [-1826.097] (-1835.045) (-1821.187) (-1823.168) * (-1826.134) (-1828.172) [-1828.528] (-1826.026) -- 0:00:53
594500 -- [-1823.687] (-1830.223) (-1833.642) (-1829.271) * [-1826.454] (-1826.164) (-1830.043) (-1822.029) -- 0:00:53
595000 -- [-1824.074] (-1832.470) (-1818.801) (-1826.795) * (-1822.480) (-1833.537) (-1831.793) [-1821.125] -- 0:00:53
Average standard deviation of split frequencies: 0.010230
595500 -- (-1827.521) (-1827.391) (-1833.231) [-1827.774] * (-1829.589) (-1832.145) [-1828.400] (-1821.543) -- 0:00:53
596000 -- (-1821.755) (-1827.481) (-1827.340) [-1821.692] * (-1827.168) (-1825.269) [-1818.454] (-1824.572) -- 0:00:53
596500 -- (-1827.109) (-1824.177) [-1835.350] (-1826.667) * (-1827.580) (-1830.838) (-1829.649) [-1830.483] -- 0:00:53
597000 -- (-1824.364) (-1827.382) (-1825.873) [-1828.622] * [-1821.280] (-1836.753) (-1829.999) (-1825.837) -- 0:00:53
597500 -- (-1832.403) (-1830.212) [-1822.723] (-1824.405) * (-1830.495) (-1825.595) [-1821.907] (-1823.820) -- 0:00:53
598000 -- (-1831.133) (-1828.403) [-1826.582] (-1824.392) * (-1827.466) (-1825.263) [-1829.696] (-1831.936) -- 0:00:53
598500 -- [-1824.628] (-1825.861) (-1833.260) (-1827.110) * (-1824.275) [-1829.671] (-1829.682) (-1827.417) -- 0:00:53
599000 -- (-1820.194) (-1830.428) [-1824.816] (-1826.652) * [-1826.743] (-1833.886) (-1833.948) (-1825.554) -- 0:00:53
599500 -- [-1826.104] (-1831.976) (-1830.567) (-1820.749) * [-1828.514] (-1836.130) (-1824.300) (-1821.691) -- 0:00:53
600000 -- (-1824.394) (-1824.948) [-1828.987] (-1821.453) * (-1828.650) (-1827.646) [-1829.123] (-1828.978) -- 0:00:53
Average standard deviation of split frequencies: 0.010307
600500 -- [-1822.047] (-1822.737) (-1825.763) (-1826.906) * [-1832.038] (-1826.937) (-1831.910) (-1823.568) -- 0:00:53
601000 -- (-1823.979) (-1828.294) (-1829.979) [-1826.056] * (-1828.591) [-1827.626] (-1825.230) (-1834.331) -- 0:00:53
601500 -- (-1825.700) (-1828.387) [-1825.571] (-1824.125) * (-1833.834) [-1826.752] (-1836.840) (-1824.786) -- 0:00:53
602000 -- (-1827.876) (-1826.942) (-1823.255) [-1822.455] * [-1829.830] (-1825.230) (-1830.627) (-1827.024) -- 0:00:52
602500 -- (-1822.650) (-1833.245) [-1825.172] (-1827.736) * [-1831.614] (-1829.517) (-1824.744) (-1840.942) -- 0:00:52
603000 -- (-1831.728) (-1829.796) [-1823.615] (-1822.003) * (-1832.015) (-1824.054) [-1823.165] (-1830.595) -- 0:00:52
603500 -- [-1822.731] (-1827.436) (-1820.810) (-1826.946) * [-1827.735] (-1830.394) (-1827.315) (-1838.177) -- 0:00:52
604000 -- [-1823.782] (-1825.447) (-1821.503) (-1828.670) * [-1824.470] (-1826.120) (-1825.913) (-1836.077) -- 0:00:52
604500 -- (-1835.586) [-1825.141] (-1824.871) (-1825.492) * (-1828.988) (-1832.044) [-1825.710] (-1839.643) -- 0:00:52
605000 -- (-1830.733) [-1825.162] (-1827.259) (-1829.848) * [-1828.260] (-1832.630) (-1825.329) (-1826.766) -- 0:00:52
Average standard deviation of split frequencies: 0.010061
605500 -- [-1822.848] (-1831.158) (-1820.877) (-1833.330) * (-1826.343) [-1826.250] (-1834.851) (-1823.314) -- 0:00:52
606000 -- (-1826.184) (-1823.820) [-1825.504] (-1828.494) * [-1825.165] (-1825.581) (-1830.259) (-1826.647) -- 0:00:52
606500 -- (-1826.860) [-1830.466] (-1825.255) (-1821.258) * [-1821.829] (-1828.649) (-1839.124) (-1832.953) -- 0:00:52
607000 -- [-1819.998] (-1824.932) (-1823.450) (-1830.033) * [-1820.406] (-1836.049) (-1822.671) (-1825.454) -- 0:00:52
607500 -- (-1829.062) (-1830.770) [-1824.015] (-1831.975) * (-1826.771) (-1826.733) (-1825.242) [-1827.229] -- 0:00:52
608000 -- (-1818.670) (-1834.287) [-1822.067] (-1822.823) * [-1824.801] (-1823.169) (-1828.894) (-1834.382) -- 0:00:52
608500 -- (-1823.270) (-1825.487) [-1826.985] (-1829.415) * [-1825.844] (-1822.808) (-1828.445) (-1831.244) -- 0:00:52
609000 -- (-1825.320) [-1823.818] (-1824.616) (-1825.124) * (-1825.864) (-1828.332) [-1818.591] (-1824.345) -- 0:00:52
609500 -- [-1824.985] (-1833.794) (-1823.962) (-1830.760) * [-1824.811] (-1821.664) (-1830.433) (-1833.700) -- 0:00:51
610000 -- (-1824.368) [-1823.520] (-1822.861) (-1829.750) * (-1833.802) [-1820.296] (-1825.886) (-1825.976) -- 0:00:51
Average standard deviation of split frequencies: 0.009675
610500 -- (-1826.102) (-1820.902) (-1830.627) [-1824.163] * [-1826.055] (-1827.718) (-1827.508) (-1827.700) -- 0:00:51
611000 -- (-1839.426) [-1827.507] (-1830.524) (-1827.924) * [-1821.169] (-1826.918) (-1826.865) (-1823.744) -- 0:00:51
611500 -- (-1828.203) (-1824.320) [-1822.861] (-1823.858) * (-1827.382) [-1821.529] (-1827.031) (-1827.528) -- 0:00:51
612000 -- (-1819.981) [-1826.346] (-1836.222) (-1836.087) * (-1827.890) (-1825.202) (-1833.318) [-1827.764] -- 0:00:51
612500 -- (-1824.837) [-1821.007] (-1830.514) (-1828.303) * (-1832.136) (-1831.805) [-1824.675] (-1829.787) -- 0:00:51
613000 -- (-1824.895) [-1828.403] (-1823.579) (-1821.620) * (-1827.334) (-1824.124) (-1833.246) [-1824.599] -- 0:00:51
613500 -- [-1818.331] (-1832.843) (-1827.275) (-1825.739) * (-1825.025) [-1824.924] (-1826.748) (-1826.863) -- 0:00:51
614000 -- [-1824.560] (-1821.803) (-1831.314) (-1823.174) * (-1832.236) (-1832.430) [-1825.351] (-1828.293) -- 0:00:51
614500 -- (-1818.225) [-1832.476] (-1827.091) (-1825.430) * (-1816.468) (-1824.198) [-1825.591] (-1823.462) -- 0:00:51
615000 -- (-1824.788) (-1821.322) [-1825.959] (-1839.053) * (-1832.542) [-1823.743] (-1825.670) (-1819.628) -- 0:00:51
Average standard deviation of split frequencies: 0.009132
615500 -- (-1827.087) (-1825.053) [-1826.909] (-1833.323) * (-1829.571) (-1832.451) (-1834.183) [-1828.495] -- 0:00:51
616000 -- [-1820.887] (-1826.794) (-1829.518) (-1827.965) * (-1828.115) (-1843.360) (-1840.071) [-1825.329] -- 0:00:51
616500 -- [-1821.028] (-1828.387) (-1823.866) (-1823.006) * (-1827.499) (-1824.557) [-1825.201] (-1829.332) -- 0:00:51
617000 -- (-1823.949) (-1828.432) [-1831.673] (-1831.234) * (-1827.031) [-1832.114] (-1828.625) (-1829.527) -- 0:00:50
617500 -- [-1825.231] (-1833.084) (-1834.615) (-1833.081) * (-1822.962) [-1830.305] (-1830.411) (-1820.707) -- 0:00:50
618000 -- (-1828.572) [-1834.136] (-1832.993) (-1831.357) * (-1832.384) (-1830.736) (-1831.399) [-1820.740] -- 0:00:50
618500 -- (-1821.785) (-1828.129) (-1831.238) [-1823.512] * (-1821.676) [-1820.548] (-1831.317) (-1827.817) -- 0:00:50
619000 -- (-1822.884) (-1819.258) [-1824.772] (-1823.170) * [-1826.027] (-1823.593) (-1824.636) (-1819.450) -- 0:00:50
619500 -- (-1826.702) (-1829.166) [-1828.187] (-1828.626) * (-1831.895) [-1820.138] (-1824.640) (-1824.573) -- 0:00:50
620000 -- (-1834.792) [-1824.471] (-1835.544) (-1828.565) * [-1824.548] (-1829.833) (-1828.376) (-1822.337) -- 0:00:50
Average standard deviation of split frequencies: 0.009469
620500 -- (-1829.679) (-1827.496) (-1827.754) [-1825.175] * [-1827.440] (-1824.640) (-1821.412) (-1829.997) -- 0:00:50
621000 -- (-1824.644) [-1828.353] (-1831.916) (-1824.198) * (-1825.369) [-1833.583] (-1823.215) (-1830.245) -- 0:00:50
621500 -- (-1824.572) (-1830.176) (-1828.962) [-1831.465] * (-1825.073) (-1829.863) (-1824.531) [-1827.777] -- 0:00:50
622000 -- (-1820.716) (-1825.224) (-1824.417) [-1820.699] * (-1821.664) (-1836.746) [-1828.992] (-1837.743) -- 0:00:50
622500 -- (-1824.927) (-1825.610) [-1827.579] (-1827.312) * (-1825.472) (-1830.212) [-1823.545] (-1830.868) -- 0:00:50
623000 -- (-1825.254) [-1821.528] (-1826.007) (-1820.441) * (-1825.189) (-1834.527) (-1827.950) [-1829.879] -- 0:00:50
623500 -- [-1821.086] (-1825.079) (-1820.117) (-1819.347) * (-1826.836) [-1826.859] (-1828.763) (-1832.324) -- 0:00:50
624000 -- [-1825.985] (-1828.141) (-1831.211) (-1822.473) * (-1824.726) [-1823.311] (-1832.891) (-1824.850) -- 0:00:50
624500 -- [-1829.738] (-1832.868) (-1820.408) (-1833.093) * (-1839.511) [-1823.574] (-1831.309) (-1822.732) -- 0:00:49
625000 -- [-1823.010] (-1830.617) (-1831.871) (-1827.912) * (-1833.656) (-1827.941) (-1824.949) [-1824.330] -- 0:00:49
Average standard deviation of split frequencies: 0.009438
625500 -- [-1825.191] (-1821.138) (-1825.356) (-1830.342) * [-1829.659] (-1826.935) (-1822.216) (-1826.878) -- 0:00:49
626000 -- [-1823.673] (-1827.866) (-1826.463) (-1827.764) * (-1827.947) [-1821.487] (-1830.292) (-1831.782) -- 0:00:49
626500 -- (-1830.253) (-1827.902) (-1834.084) [-1831.968] * (-1827.946) (-1831.157) [-1820.069] (-1828.457) -- 0:00:49
627000 -- [-1819.685] (-1831.102) (-1823.978) (-1828.539) * (-1827.014) (-1819.131) (-1827.008) [-1820.278] -- 0:00:49
627500 -- (-1818.644) [-1824.988] (-1824.834) (-1829.475) * (-1830.796) (-1835.523) (-1819.388) [-1831.752] -- 0:00:49
628000 -- [-1820.493] (-1829.192) (-1828.217) (-1822.412) * (-1834.604) (-1822.661) (-1826.814) [-1825.129] -- 0:00:49
628500 -- (-1828.976) (-1833.275) [-1825.847] (-1830.542) * [-1823.092] (-1824.269) (-1825.599) (-1828.212) -- 0:00:49
629000 -- [-1831.397] (-1821.705) (-1827.225) (-1828.510) * (-1830.065) (-1827.668) (-1831.726) [-1822.823] -- 0:00:49
629500 -- (-1834.824) [-1822.079] (-1832.497) (-1823.746) * (-1832.025) (-1822.273) (-1825.340) [-1822.739] -- 0:00:49
630000 -- [-1820.677] (-1827.821) (-1821.593) (-1818.675) * (-1824.514) (-1823.690) (-1823.616) [-1820.164] -- 0:00:49
Average standard deviation of split frequencies: 0.009418
630500 -- (-1818.737) (-1828.366) [-1829.106] (-1828.468) * (-1829.663) (-1822.718) [-1823.972] (-1824.618) -- 0:00:49
631000 -- (-1825.262) [-1818.517] (-1833.257) (-1828.830) * (-1828.399) [-1830.336] (-1827.149) (-1825.690) -- 0:00:49
631500 -- (-1824.496) (-1830.074) [-1826.834] (-1828.108) * (-1825.329) (-1826.250) (-1822.943) [-1824.166] -- 0:00:49
632000 -- [-1825.763] (-1831.974) (-1825.659) (-1825.183) * [-1823.733] (-1820.134) (-1826.722) (-1824.019) -- 0:00:48
632500 -- (-1826.702) [-1825.753] (-1835.048) (-1828.090) * (-1834.686) (-1821.513) [-1823.394] (-1823.311) -- 0:00:48
633000 -- (-1829.454) (-1822.826) (-1827.513) [-1840.813] * [-1829.113] (-1831.231) (-1833.736) (-1826.534) -- 0:00:48
633500 -- (-1824.617) [-1824.684] (-1831.112) (-1839.742) * (-1828.561) (-1821.447) [-1827.653] (-1820.633) -- 0:00:48
634000 -- (-1831.035) (-1828.054) [-1822.983] (-1825.889) * (-1829.244) (-1823.086) [-1823.961] (-1824.290) -- 0:00:48
634500 -- (-1822.374) (-1825.436) [-1821.613] (-1829.167) * (-1827.590) (-1823.741) (-1825.242) [-1834.262] -- 0:00:48
635000 -- (-1825.279) (-1826.701) (-1823.255) [-1824.837] * (-1826.327) [-1821.410] (-1825.886) (-1822.732) -- 0:00:48
Average standard deviation of split frequencies: 0.009487
635500 -- (-1824.860) (-1828.370) (-1827.522) [-1824.312] * [-1821.563] (-1831.267) (-1833.169) (-1829.460) -- 0:00:48
636000 -- [-1825.152] (-1830.781) (-1828.490) (-1821.250) * [-1822.197] (-1828.357) (-1837.619) (-1833.154) -- 0:00:48
636500 -- (-1837.888) [-1829.905] (-1829.948) (-1816.900) * (-1830.395) [-1822.187] (-1826.819) (-1831.681) -- 0:00:48
637000 -- (-1822.907) (-1821.037) (-1826.978) [-1819.854] * (-1826.477) (-1824.778) (-1823.184) [-1827.868] -- 0:00:48
637500 -- [-1825.483] (-1831.301) (-1841.267) (-1824.738) * [-1826.298] (-1825.277) (-1827.329) (-1830.093) -- 0:00:48
638000 -- (-1844.277) (-1822.687) [-1823.853] (-1829.309) * [-1820.138] (-1831.373) (-1825.124) (-1828.820) -- 0:00:48
638500 -- (-1822.077) (-1833.254) [-1823.710] (-1827.632) * [-1825.049] (-1830.930) (-1822.166) (-1825.345) -- 0:00:48
639000 -- (-1826.536) (-1832.772) (-1835.168) [-1827.047] * (-1829.895) [-1828.807] (-1825.334) (-1823.015) -- 0:00:48
639500 -- (-1828.562) (-1841.157) [-1830.259] (-1832.949) * [-1821.791] (-1825.557) (-1830.885) (-1830.625) -- 0:00:47
640000 -- (-1829.147) (-1833.357) [-1833.376] (-1827.838) * (-1829.756) [-1826.135] (-1820.830) (-1834.003) -- 0:00:47
Average standard deviation of split frequencies: 0.009958
640500 -- (-1833.830) (-1826.759) (-1824.400) [-1824.287] * (-1830.221) [-1832.043] (-1825.627) (-1823.157) -- 0:00:47
641000 -- (-1822.641) (-1834.412) (-1830.263) [-1828.574] * [-1824.472] (-1819.619) (-1838.571) (-1823.726) -- 0:00:47
641500 -- (-1830.976) [-1830.275] (-1828.607) (-1826.590) * (-1825.752) (-1825.727) [-1818.576] (-1825.705) -- 0:00:47
642000 -- (-1824.578) (-1831.113) [-1825.712] (-1829.410) * (-1824.366) (-1830.553) (-1833.071) [-1824.885] -- 0:00:47
642500 -- [-1825.553] (-1831.862) (-1834.049) (-1829.616) * (-1828.941) [-1823.208] (-1825.883) (-1824.108) -- 0:00:47
643000 -- [-1826.642] (-1824.803) (-1827.682) (-1824.209) * [-1820.880] (-1818.489) (-1832.201) (-1828.811) -- 0:00:47
643500 -- [-1822.911] (-1829.154) (-1832.336) (-1828.695) * (-1821.075) [-1827.401] (-1824.379) (-1825.487) -- 0:00:47
644000 -- [-1826.402] (-1827.409) (-1833.455) (-1833.282) * (-1829.944) (-1832.001) (-1823.552) [-1828.572] -- 0:00:47
644500 -- [-1829.557] (-1828.385) (-1830.057) (-1827.963) * (-1827.505) (-1826.705) (-1824.861) [-1829.742] -- 0:00:47
645000 -- (-1823.891) [-1830.392] (-1831.193) (-1825.540) * (-1827.071) (-1820.883) [-1826.118] (-1826.565) -- 0:00:47
Average standard deviation of split frequencies: 0.010265
645500 -- (-1835.636) (-1825.846) (-1830.656) [-1824.190] * [-1828.578] (-1827.786) (-1829.918) (-1829.229) -- 0:00:47
646000 -- (-1823.259) (-1830.967) (-1827.813) [-1829.911] * (-1828.198) [-1825.531] (-1827.580) (-1826.606) -- 0:00:47
646500 -- (-1832.600) (-1828.815) [-1824.600] (-1822.363) * [-1821.632] (-1825.997) (-1829.889) (-1832.591) -- 0:00:47
647000 -- (-1820.430) (-1827.973) [-1823.704] (-1830.031) * (-1824.907) [-1825.935] (-1833.710) (-1825.856) -- 0:00:46
647500 -- (-1835.655) (-1831.611) (-1828.140) [-1823.093] * [-1824.272] (-1831.227) (-1836.515) (-1829.070) -- 0:00:46
648000 -- [-1818.817] (-1844.355) (-1821.281) (-1823.612) * (-1825.131) (-1832.654) (-1831.838) [-1829.596] -- 0:00:46
648500 -- [-1822.692] (-1835.006) (-1829.196) (-1828.296) * (-1829.656) (-1838.567) (-1831.458) [-1825.450] -- 0:00:46
649000 -- (-1830.833) [-1825.387] (-1831.715) (-1825.982) * (-1823.108) [-1824.366] (-1823.600) (-1823.999) -- 0:00:46
649500 -- (-1827.216) (-1832.516) (-1824.424) [-1825.356] * (-1834.725) [-1819.948] (-1832.034) (-1825.044) -- 0:00:46
650000 -- (-1825.674) (-1828.050) (-1829.194) [-1829.306] * (-1821.395) (-1823.679) (-1824.401) [-1823.069] -- 0:00:46
Average standard deviation of split frequencies: 0.010143
650500 -- [-1827.052] (-1820.877) (-1826.869) (-1831.271) * [-1829.087] (-1833.914) (-1831.870) (-1820.222) -- 0:00:46
651000 -- (-1825.254) (-1838.855) [-1822.054] (-1821.368) * (-1826.664) [-1825.676] (-1834.081) (-1830.099) -- 0:00:46
651500 -- (-1832.957) (-1828.649) [-1820.268] (-1831.226) * [-1826.215] (-1837.447) (-1830.379) (-1826.737) -- 0:00:46
652000 -- (-1826.650) (-1832.153) [-1832.352] (-1826.227) * [-1829.297] (-1827.428) (-1826.794) (-1835.890) -- 0:00:46
652500 -- (-1827.521) (-1829.005) (-1822.705) [-1830.253] * (-1828.496) (-1821.977) (-1821.909) [-1829.413] -- 0:00:46
653000 -- (-1829.006) (-1828.814) (-1825.323) [-1829.372] * (-1825.596) (-1827.369) (-1830.143) [-1819.915] -- 0:00:46
653500 -- (-1836.467) (-1833.284) [-1823.476] (-1822.241) * (-1825.602) (-1822.725) [-1820.515] (-1828.618) -- 0:00:46
654000 -- (-1825.398) [-1826.589] (-1828.956) (-1826.902) * (-1821.463) [-1826.513] (-1827.464) (-1825.846) -- 0:00:46
654500 -- (-1830.018) (-1827.872) [-1822.414] (-1821.706) * (-1826.166) (-1822.917) (-1831.447) [-1822.623] -- 0:00:45
655000 -- (-1836.014) (-1832.297) [-1828.469] (-1823.016) * (-1825.135) [-1823.414] (-1834.761) (-1822.679) -- 0:00:45
Average standard deviation of split frequencies: 0.010348
655500 -- (-1821.345) (-1830.712) (-1829.630) [-1818.400] * (-1826.651) [-1827.836] (-1831.918) (-1827.631) -- 0:00:45
656000 -- (-1828.062) (-1825.574) (-1834.722) [-1824.323] * (-1833.229) [-1822.901] (-1821.919) (-1831.989) -- 0:00:45
656500 -- (-1833.251) [-1826.692] (-1834.872) (-1820.299) * (-1826.408) (-1827.254) (-1825.142) [-1830.153] -- 0:00:45
657000 -- (-1825.495) (-1831.697) (-1829.581) [-1832.107] * [-1822.994] (-1821.227) (-1827.537) (-1835.421) -- 0:00:45
657500 -- (-1826.661) (-1836.241) (-1830.468) [-1821.732] * [-1822.181] (-1823.749) (-1830.569) (-1825.944) -- 0:00:45
658000 -- (-1832.161) (-1827.141) [-1826.347] (-1828.658) * (-1823.420) (-1823.130) [-1823.941] (-1823.699) -- 0:00:45
658500 -- [-1821.961] (-1823.280) (-1831.150) (-1830.407) * (-1825.769) [-1824.422] (-1824.345) (-1824.167) -- 0:00:45
659000 -- (-1832.521) (-1825.441) [-1823.001] (-1837.216) * (-1835.555) (-1827.165) (-1826.968) [-1831.447] -- 0:00:45
659500 -- [-1826.169] (-1822.289) (-1828.415) (-1828.007) * [-1821.513] (-1827.652) (-1824.058) (-1835.014) -- 0:00:45
660000 -- (-1830.458) (-1832.577) (-1825.045) [-1824.727] * (-1828.656) [-1830.876] (-1829.069) (-1823.108) -- 0:00:45
Average standard deviation of split frequencies: 0.009989
660500 -- (-1825.724) [-1821.443] (-1829.382) (-1827.698) * [-1824.074] (-1828.565) (-1826.535) (-1828.949) -- 0:00:45
661000 -- [-1833.308] (-1822.360) (-1822.391) (-1821.223) * (-1822.854) (-1835.615) (-1826.842) [-1830.955] -- 0:00:45
661500 -- (-1829.245) (-1821.239) [-1823.180] (-1827.705) * [-1819.722] (-1827.503) (-1825.906) (-1837.932) -- 0:00:45
662000 -- [-1822.331] (-1829.224) (-1829.107) (-1827.314) * (-1825.921) (-1832.403) [-1832.512] (-1829.970) -- 0:00:44
662500 -- (-1822.041) (-1823.763) (-1824.952) [-1824.919] * (-1820.899) (-1827.207) [-1828.775] (-1828.827) -- 0:00:44
663000 -- (-1824.632) [-1830.250] (-1830.897) (-1827.338) * (-1830.702) [-1822.721] (-1819.530) (-1832.078) -- 0:00:44
663500 -- (-1828.405) (-1845.200) [-1830.435] (-1819.412) * (-1829.557) (-1827.292) [-1828.776] (-1837.810) -- 0:00:44
664000 -- [-1828.047] (-1823.992) (-1823.647) (-1832.777) * (-1822.478) (-1825.973) [-1826.507] (-1833.830) -- 0:00:44
664500 -- (-1828.542) (-1828.849) (-1835.653) [-1826.014] * (-1827.113) [-1824.701] (-1826.745) (-1830.195) -- 0:00:44
665000 -- (-1829.565) (-1823.213) (-1829.575) [-1833.018] * (-1828.483) [-1826.656] (-1832.022) (-1830.754) -- 0:00:44
Average standard deviation of split frequencies: 0.010193
665500 -- (-1826.246) (-1829.964) (-1837.347) [-1824.501] * (-1825.491) [-1829.193] (-1829.024) (-1837.574) -- 0:00:44
666000 -- (-1824.477) (-1825.827) (-1825.137) [-1821.370] * [-1818.563] (-1826.383) (-1818.706) (-1825.562) -- 0:00:44
666500 -- (-1825.646) [-1830.139] (-1834.688) (-1823.067) * (-1827.087) (-1819.487) (-1824.284) [-1821.275] -- 0:00:44
667000 -- (-1823.406) (-1824.718) [-1822.998] (-1825.531) * [-1834.431] (-1825.792) (-1824.448) (-1823.490) -- 0:00:44
667500 -- (-1825.868) [-1823.798] (-1825.750) (-1831.855) * (-1823.557) (-1829.726) (-1821.987) [-1828.540] -- 0:00:44
668000 -- [-1830.603] (-1829.069) (-1829.936) (-1824.429) * (-1831.332) [-1826.647] (-1829.759) (-1828.693) -- 0:00:44
668500 -- [-1829.708] (-1832.878) (-1829.641) (-1837.463) * (-1825.091) [-1827.796] (-1827.879) (-1821.413) -- 0:00:44
669000 -- [-1822.978] (-1827.928) (-1824.213) (-1837.177) * (-1833.652) (-1829.289) (-1824.498) [-1824.683] -- 0:00:44
669500 -- (-1825.466) [-1823.264] (-1829.098) (-1823.998) * (-1830.484) [-1822.562] (-1829.281) (-1832.094) -- 0:00:43
670000 -- [-1823.275] (-1842.840) (-1839.196) (-1832.306) * [-1831.111] (-1829.499) (-1831.560) (-1821.655) -- 0:00:43
Average standard deviation of split frequencies: 0.010168
670500 -- (-1823.696) (-1824.054) (-1832.946) [-1821.105] * (-1827.905) (-1832.389) [-1836.785] (-1817.610) -- 0:00:43
671000 -- (-1831.132) (-1824.748) (-1827.039) [-1824.924] * (-1828.823) (-1828.547) (-1827.267) [-1826.769] -- 0:00:43
671500 -- (-1824.958) [-1828.514] (-1825.803) (-1826.892) * (-1833.371) [-1818.831] (-1825.903) (-1826.235) -- 0:00:43
672000 -- (-1828.497) (-1822.779) [-1825.942] (-1824.444) * (-1821.758) (-1825.341) (-1831.102) [-1820.349] -- 0:00:43
672500 -- (-1830.631) (-1825.427) [-1828.101] (-1822.536) * (-1826.470) (-1828.335) (-1834.560) [-1821.923] -- 0:00:43
673000 -- (-1826.471) [-1825.572] (-1830.518) (-1827.275) * (-1823.904) [-1827.423] (-1825.140) (-1823.495) -- 0:00:43
673500 -- (-1828.573) (-1831.806) (-1825.248) [-1819.961] * [-1830.351] (-1828.209) (-1835.616) (-1830.357) -- 0:00:43
674000 -- (-1821.183) (-1825.644) [-1820.164] (-1828.272) * [-1825.075] (-1829.743) (-1830.044) (-1822.791) -- 0:00:43
674500 -- (-1826.623) [-1827.151] (-1824.972) (-1824.261) * [-1824.139] (-1834.114) (-1828.730) (-1825.365) -- 0:00:43
675000 -- (-1822.279) (-1826.321) (-1830.179) [-1821.938] * (-1832.819) (-1826.896) (-1828.151) [-1828.095] -- 0:00:43
Average standard deviation of split frequencies: 0.009856
675500 -- [-1822.386] (-1826.112) (-1826.151) (-1828.806) * (-1826.171) [-1828.296] (-1824.206) (-1835.286) -- 0:00:43
676000 -- (-1825.482) (-1823.617) [-1821.859] (-1825.207) * [-1831.807] (-1823.188) (-1824.836) (-1828.624) -- 0:00:43
676500 -- (-1822.090) (-1827.128) [-1821.471] (-1823.942) * (-1826.682) [-1821.002] (-1829.629) (-1833.441) -- 0:00:43
677000 -- (-1833.138) (-1835.490) [-1820.246] (-1826.709) * (-1824.473) (-1823.625) (-1819.925) [-1829.717] -- 0:00:42
677500 -- (-1824.419) [-1821.328] (-1830.874) (-1831.269) * (-1822.537) (-1830.695) [-1826.361] (-1828.420) -- 0:00:42
678000 -- (-1830.832) [-1819.897] (-1828.839) (-1831.995) * [-1821.017] (-1825.858) (-1830.120) (-1830.650) -- 0:00:42
678500 -- (-1827.138) [-1830.326] (-1829.355) (-1827.782) * (-1825.612) [-1824.650] (-1839.990) (-1838.931) -- 0:00:42
679000 -- (-1829.072) [-1827.638] (-1823.174) (-1826.545) * [-1820.992] (-1828.781) (-1826.967) (-1826.200) -- 0:00:42
679500 -- (-1822.077) (-1830.760) [-1817.865] (-1826.384) * (-1825.560) (-1833.994) [-1825.135] (-1831.319) -- 0:00:42
680000 -- (-1834.032) (-1834.804) (-1830.780) [-1823.136] * [-1820.866] (-1837.441) (-1824.238) (-1828.241) -- 0:00:42
Average standard deviation of split frequencies: 0.009557
680500 -- (-1822.233) (-1821.260) (-1827.474) [-1822.689] * [-1833.156] (-1825.682) (-1824.841) (-1823.970) -- 0:00:42
681000 -- [-1824.510] (-1829.218) (-1827.945) (-1827.237) * [-1831.843] (-1824.954) (-1821.018) (-1828.789) -- 0:00:42
681500 -- (-1826.820) (-1830.598) (-1828.425) [-1825.722] * (-1823.881) (-1821.851) [-1825.484] (-1831.855) -- 0:00:42
682000 -- (-1828.739) (-1845.490) (-1830.651) [-1822.759] * (-1833.982) (-1831.261) [-1821.768] (-1836.549) -- 0:00:42
682500 -- (-1825.611) (-1834.508) (-1827.795) [-1831.656] * (-1824.038) [-1824.036] (-1825.388) (-1831.701) -- 0:00:42
683000 -- (-1842.240) [-1835.443] (-1828.815) (-1827.618) * [-1823.325] (-1829.318) (-1824.317) (-1835.714) -- 0:00:42
683500 -- (-1820.960) (-1829.452) (-1826.532) [-1830.711] * (-1836.487) [-1840.176] (-1824.372) (-1831.248) -- 0:00:42
684000 -- [-1823.171] (-1826.089) (-1827.599) (-1831.601) * (-1828.208) (-1826.786) [-1822.525] (-1823.723) -- 0:00:42
684500 -- (-1834.502) (-1826.509) [-1825.360] (-1827.659) * (-1824.739) (-1826.590) [-1819.506] (-1828.485) -- 0:00:41
685000 -- (-1828.457) (-1825.362) (-1833.046) [-1826.659] * [-1829.463] (-1828.497) (-1824.164) (-1826.756) -- 0:00:41
Average standard deviation of split frequencies: 0.008842
685500 -- (-1824.933) (-1823.519) (-1827.362) [-1823.739] * (-1831.250) (-1825.774) (-1825.575) [-1841.572] -- 0:00:41
686000 -- (-1833.183) (-1829.080) (-1835.799) [-1824.553] * (-1826.554) [-1826.216] (-1833.398) (-1824.900) -- 0:00:41
686500 -- (-1824.063) (-1827.437) (-1831.981) [-1826.246] * (-1830.500) (-1829.956) [-1831.248] (-1829.029) -- 0:00:41
687000 -- (-1825.070) (-1826.302) [-1827.901] (-1825.385) * (-1835.357) [-1832.532] (-1826.465) (-1826.914) -- 0:00:41
687500 -- [-1828.023] (-1827.734) (-1832.774) (-1824.604) * (-1836.962) (-1832.313) (-1832.491) [-1824.195] -- 0:00:41
688000 -- (-1822.217) [-1820.775] (-1825.972) (-1830.734) * (-1830.812) (-1828.002) [-1828.188] (-1822.069) -- 0:00:41
688500 -- [-1828.094] (-1824.444) (-1825.468) (-1826.093) * (-1830.690) (-1834.167) [-1822.643] (-1824.464) -- 0:00:41
689000 -- (-1827.888) [-1819.422] (-1838.246) (-1833.309) * (-1839.228) (-1827.616) (-1833.556) [-1824.378] -- 0:00:41
689500 -- (-1828.049) [-1831.711] (-1830.172) (-1835.204) * (-1829.931) [-1825.176] (-1833.512) (-1825.616) -- 0:00:41
690000 -- [-1826.804] (-1823.421) (-1829.463) (-1829.557) * (-1830.667) (-1836.297) (-1831.102) [-1831.015] -- 0:00:41
Average standard deviation of split frequencies: 0.008736
690500 -- [-1818.040] (-1831.343) (-1824.545) (-1826.093) * (-1828.116) (-1828.690) [-1823.962] (-1830.330) -- 0:00:41
691000 -- (-1821.344) [-1819.872] (-1825.936) (-1836.635) * (-1828.279) (-1833.756) (-1827.293) [-1826.372] -- 0:00:41
691500 -- [-1821.482] (-1830.874) (-1825.466) (-1827.559) * (-1824.609) (-1833.349) (-1829.234) [-1822.182] -- 0:00:41
692000 -- (-1825.487) (-1837.566) [-1822.538] (-1825.968) * (-1828.059) (-1830.764) (-1838.481) [-1819.012] -- 0:00:40
692500 -- (-1828.358) (-1831.181) (-1824.098) [-1821.613] * (-1827.112) (-1832.032) [-1826.081] (-1828.505) -- 0:00:40
693000 -- (-1826.777) [-1830.793] (-1823.663) (-1821.859) * (-1828.229) [-1822.104] (-1823.387) (-1833.041) -- 0:00:40
693500 -- (-1835.678) (-1826.968) (-1828.848) [-1822.079] * [-1827.199] (-1821.392) (-1825.204) (-1830.975) -- 0:00:40
694000 -- (-1826.737) (-1824.133) [-1819.860] (-1826.095) * (-1831.384) [-1819.642] (-1829.969) (-1830.260) -- 0:00:40
694500 -- (-1831.109) [-1823.191] (-1823.405) (-1834.078) * [-1829.697] (-1830.083) (-1827.030) (-1825.336) -- 0:00:40
695000 -- (-1824.819) [-1832.965] (-1819.118) (-1833.592) * (-1826.156) (-1825.314) [-1825.301] (-1837.228) -- 0:00:40
Average standard deviation of split frequencies: 0.008579
695500 -- (-1828.111) (-1827.629) (-1828.244) [-1830.423] * [-1827.006] (-1822.465) (-1824.322) (-1833.750) -- 0:00:40
696000 -- (-1833.807) (-1826.509) (-1827.493) [-1822.264] * (-1826.760) (-1820.936) (-1832.398) [-1825.157] -- 0:00:40
696500 -- (-1827.703) [-1825.533] (-1823.444) (-1833.954) * (-1824.371) [-1827.123] (-1823.597) (-1821.837) -- 0:00:40
697000 -- (-1828.076) (-1822.581) [-1827.284] (-1838.219) * (-1827.596) [-1822.599] (-1827.357) (-1830.684) -- 0:00:40
697500 -- [-1827.145] (-1823.744) (-1825.942) (-1826.525) * (-1828.060) (-1827.075) (-1829.856) [-1821.858] -- 0:00:40
698000 -- [-1824.123] (-1823.461) (-1828.413) (-1832.669) * (-1831.338) [-1821.675] (-1827.453) (-1827.643) -- 0:00:40
698500 -- (-1824.371) [-1824.172] (-1828.254) (-1827.934) * [-1829.063] (-1832.021) (-1834.090) (-1823.592) -- 0:00:40
699000 -- (-1827.055) (-1829.806) [-1828.015] (-1838.739) * (-1830.111) (-1831.141) [-1832.701] (-1828.293) -- 0:00:40
699500 -- (-1821.306) (-1824.683) [-1825.824] (-1824.991) * (-1826.225) (-1823.461) (-1828.179) [-1837.831] -- 0:00:39
700000 -- (-1839.868) (-1824.818) (-1828.200) [-1827.372] * (-1832.658) (-1834.113) [-1824.650] (-1823.861) -- 0:00:39
Average standard deviation of split frequencies: 0.008612
700500 -- (-1832.294) (-1836.613) [-1821.484] (-1827.355) * (-1838.867) (-1841.594) (-1830.745) [-1827.639] -- 0:00:39
701000 -- (-1830.897) (-1819.519) [-1822.799] (-1835.875) * (-1827.726) (-1827.474) (-1836.535) [-1818.143] -- 0:00:39
701500 -- (-1829.185) [-1820.925] (-1829.139) (-1822.163) * (-1828.418) (-1826.004) [-1829.752] (-1833.248) -- 0:00:39
702000 -- (-1821.115) [-1825.809] (-1831.144) (-1822.891) * (-1839.005) (-1827.534) [-1829.120] (-1821.010) -- 0:00:39
702500 -- (-1832.385) (-1822.678) [-1824.666] (-1826.356) * (-1830.567) [-1825.554] (-1825.206) (-1830.288) -- 0:00:39
703000 -- (-1829.726) [-1831.104] (-1829.829) (-1828.732) * (-1830.255) (-1822.852) [-1820.642] (-1822.212) -- 0:00:39
703500 -- (-1825.836) (-1822.135) [-1824.688] (-1827.591) * (-1830.612) (-1830.658) (-1835.470) [-1824.455] -- 0:00:39
704000 -- (-1831.493) (-1831.383) [-1822.285] (-1825.721) * (-1836.563) (-1824.336) (-1834.262) [-1822.872] -- 0:00:39
704500 -- (-1832.361) [-1822.621] (-1826.259) (-1823.493) * (-1828.803) (-1826.169) [-1829.336] (-1828.550) -- 0:00:39
705000 -- [-1819.535] (-1838.232) (-1826.959) (-1824.908) * (-1832.620) (-1824.645) [-1825.867] (-1828.955) -- 0:00:39
Average standard deviation of split frequencies: 0.008947
705500 -- (-1826.813) (-1827.727) [-1823.237] (-1829.306) * (-1835.676) (-1835.274) [-1836.413] (-1825.901) -- 0:00:39
706000 -- (-1834.267) (-1832.414) [-1818.065] (-1831.390) * (-1829.026) [-1830.707] (-1834.131) (-1835.464) -- 0:00:39
706500 -- [-1825.862] (-1826.360) (-1834.490) (-1827.538) * (-1838.896) (-1829.944) (-1829.718) [-1824.149] -- 0:00:39
707000 -- (-1823.318) (-1831.778) (-1839.065) [-1829.042] * (-1828.609) [-1822.503] (-1821.348) (-1826.420) -- 0:00:38
707500 -- (-1828.740) [-1832.065] (-1827.057) (-1828.098) * [-1824.932] (-1828.208) (-1828.284) (-1823.036) -- 0:00:38
708000 -- (-1823.099) [-1826.304] (-1826.696) (-1828.752) * [-1830.125] (-1826.805) (-1835.187) (-1830.416) -- 0:00:38
708500 -- (-1831.369) [-1818.784] (-1831.357) (-1826.986) * [-1825.754] (-1829.809) (-1826.622) (-1833.186) -- 0:00:38
709000 -- (-1819.738) (-1825.635) (-1824.127) [-1836.398] * (-1823.324) (-1837.000) (-1833.910) [-1824.913] -- 0:00:38
709500 -- (-1829.350) [-1822.365] (-1828.950) (-1829.766) * (-1826.723) (-1836.141) (-1831.650) [-1835.311] -- 0:00:38
710000 -- (-1831.514) (-1824.131) [-1821.898] (-1825.527) * (-1824.391) (-1835.974) (-1824.489) [-1823.007] -- 0:00:38
Average standard deviation of split frequencies: 0.009508
710500 -- (-1824.455) (-1827.094) (-1828.162) [-1825.997] * (-1822.470) (-1831.438) [-1824.438] (-1828.590) -- 0:00:38
711000 -- (-1823.268) (-1831.487) (-1833.945) [-1825.150] * (-1830.313) (-1827.576) (-1825.421) [-1821.324] -- 0:00:38
711500 -- (-1825.273) (-1827.320) (-1825.861) [-1826.391] * (-1823.124) (-1832.185) [-1824.117] (-1821.654) -- 0:00:38
712000 -- (-1828.550) (-1823.805) (-1827.485) [-1826.057] * (-1823.688) [-1830.567] (-1828.021) (-1829.849) -- 0:00:38
712500 -- [-1823.661] (-1829.519) (-1824.221) (-1825.686) * (-1826.526) [-1824.336] (-1824.403) (-1830.834) -- 0:00:38
713000 -- (-1822.338) (-1834.589) [-1829.057] (-1821.380) * (-1829.803) (-1824.340) [-1828.515] (-1832.692) -- 0:00:38
713500 -- [-1823.933] (-1828.779) (-1827.091) (-1823.377) * (-1833.984) (-1823.739) [-1825.687] (-1829.931) -- 0:00:38
714000 -- (-1830.526) (-1825.369) [-1823.350] (-1832.467) * (-1839.630) [-1821.024] (-1825.639) (-1828.612) -- 0:00:38
714500 -- (-1826.500) [-1822.168] (-1822.454) (-1833.046) * (-1844.510) (-1829.190) (-1834.430) [-1821.767] -- 0:00:37
715000 -- (-1827.148) (-1829.796) [-1822.181] (-1827.657) * (-1823.995) [-1823.347] (-1837.132) (-1824.469) -- 0:00:37
Average standard deviation of split frequencies: 0.009393
715500 -- [-1823.066] (-1832.220) (-1828.076) (-1836.413) * [-1824.268] (-1830.291) (-1828.626) (-1822.540) -- 0:00:37
716000 -- (-1824.996) (-1827.786) (-1829.985) [-1831.628] * (-1826.488) (-1823.179) (-1829.142) [-1821.791] -- 0:00:37
716500 -- [-1825.295] (-1822.508) (-1830.113) (-1830.837) * (-1827.611) [-1821.012] (-1831.535) (-1823.728) -- 0:00:37
717000 -- [-1820.260] (-1827.750) (-1834.432) (-1821.471) * (-1821.697) [-1823.963] (-1828.038) (-1828.370) -- 0:00:37
717500 -- (-1828.107) (-1829.377) [-1825.704] (-1825.256) * [-1819.513] (-1826.686) (-1828.856) (-1819.722) -- 0:00:37
718000 -- (-1827.582) [-1827.099] (-1822.874) (-1825.731) * (-1823.967) (-1845.098) [-1831.626] (-1826.818) -- 0:00:37
718500 -- (-1819.918) [-1824.910] (-1830.221) (-1832.161) * [-1830.040] (-1832.759) (-1830.185) (-1824.934) -- 0:00:37
719000 -- (-1821.270) (-1824.158) [-1825.342] (-1828.902) * (-1822.008) [-1827.754] (-1827.790) (-1828.031) -- 0:00:37
719500 -- [-1828.213] (-1826.851) (-1828.872) (-1820.615) * (-1819.568) (-1828.194) (-1820.848) [-1823.449] -- 0:00:37
720000 -- (-1824.013) (-1821.225) (-1831.037) [-1827.979] * (-1827.832) (-1826.600) [-1821.288] (-1826.209) -- 0:00:37
Average standard deviation of split frequencies: 0.010117
720500 -- (-1822.302) (-1826.503) [-1825.208] (-1830.349) * (-1826.774) [-1826.239] (-1826.336) (-1827.830) -- 0:00:37
721000 -- (-1825.801) [-1824.199] (-1832.265) (-1831.490) * (-1838.792) (-1823.291) (-1825.946) [-1820.918] -- 0:00:37
721500 -- (-1821.772) (-1820.400) (-1822.978) [-1825.633] * (-1837.725) (-1825.359) [-1827.218] (-1825.029) -- 0:00:37
722000 -- [-1827.489] (-1824.267) (-1827.790) (-1824.350) * (-1823.478) [-1825.379] (-1828.843) (-1826.534) -- 0:00:36
722500 -- (-1822.875) [-1829.329] (-1834.077) (-1829.821) * (-1825.300) (-1830.946) [-1831.008] (-1820.086) -- 0:00:36
723000 -- [-1828.000] (-1822.889) (-1841.016) (-1824.680) * (-1826.472) (-1829.871) [-1823.016] (-1830.136) -- 0:00:36
723500 -- (-1828.728) [-1822.427] (-1831.038) (-1830.231) * (-1827.237) (-1832.284) (-1825.577) [-1819.950] -- 0:00:36
724000 -- (-1822.722) [-1830.300] (-1830.362) (-1824.458) * (-1836.993) (-1830.535) (-1832.713) [-1821.748] -- 0:00:36
724500 -- (-1838.579) [-1830.377] (-1835.216) (-1826.197) * (-1828.904) (-1829.696) [-1823.138] (-1819.152) -- 0:00:36
725000 -- (-1840.008) (-1828.924) (-1834.398) [-1824.678] * (-1825.441) (-1829.656) (-1821.568) [-1821.632] -- 0:00:36
Average standard deviation of split frequencies: 0.010308
725500 -- (-1830.437) [-1826.695] (-1825.976) (-1829.958) * (-1837.463) [-1819.762] (-1820.354) (-1828.915) -- 0:00:36
726000 -- [-1829.394] (-1826.450) (-1829.141) (-1828.359) * (-1823.018) (-1834.478) (-1823.342) [-1825.184] -- 0:00:36
726500 -- (-1829.941) (-1829.370) (-1829.322) [-1830.383] * (-1832.930) (-1826.895) [-1824.126] (-1827.831) -- 0:00:36
727000 -- [-1827.231] (-1824.390) (-1840.866) (-1828.960) * (-1827.918) [-1825.934] (-1828.079) (-1825.066) -- 0:00:36
727500 -- (-1829.158) [-1825.276] (-1831.572) (-1823.013) * (-1829.950) (-1828.777) (-1822.964) [-1828.961] -- 0:00:36
728000 -- [-1834.632] (-1831.362) (-1836.222) (-1826.067) * (-1826.144) [-1827.636] (-1826.521) (-1827.474) -- 0:00:36
728500 -- (-1819.902) (-1825.906) (-1837.602) [-1822.933] * (-1834.526) [-1817.710] (-1819.603) (-1828.592) -- 0:00:36
729000 -- (-1824.267) [-1823.774] (-1827.286) (-1829.808) * (-1827.292) (-1821.658) [-1826.717] (-1824.865) -- 0:00:36
729500 -- (-1825.293) [-1824.972] (-1830.424) (-1834.106) * (-1829.010) [-1821.719] (-1821.820) (-1832.288) -- 0:00:35
730000 -- (-1827.231) (-1836.238) [-1823.176] (-1826.574) * (-1824.511) (-1825.563) (-1822.739) [-1824.213] -- 0:00:35
Average standard deviation of split frequencies: 0.010363
730500 -- (-1823.834) (-1824.063) [-1828.552] (-1828.950) * (-1824.960) [-1820.725] (-1831.108) (-1845.968) -- 0:00:35
731000 -- [-1836.098] (-1835.156) (-1838.884) (-1823.918) * (-1828.145) (-1826.831) [-1829.672] (-1826.270) -- 0:00:35
731500 -- (-1828.583) (-1831.167) [-1825.754] (-1842.895) * (-1826.561) (-1827.065) [-1828.412] (-1823.878) -- 0:00:35
732000 -- (-1826.011) (-1827.107) (-1826.623) [-1824.150] * (-1822.320) (-1829.510) [-1821.287] (-1823.473) -- 0:00:35
732500 -- (-1824.007) [-1823.662] (-1829.790) (-1825.272) * (-1826.651) (-1823.744) [-1831.273] (-1824.994) -- 0:00:35
733000 -- (-1827.420) (-1824.059) (-1823.751) [-1817.380] * (-1823.530) (-1825.402) [-1822.255] (-1832.048) -- 0:00:35
733500 -- (-1831.634) (-1827.658) (-1823.134) [-1821.082] * (-1828.322) (-1834.101) [-1824.471] (-1833.762) -- 0:00:35
734000 -- [-1831.848] (-1838.198) (-1836.630) (-1824.565) * (-1831.202) (-1826.646) [-1825.728] (-1828.245) -- 0:00:35
734500 -- (-1825.781) [-1827.060] (-1818.245) (-1828.289) * (-1838.118) (-1828.621) (-1834.328) [-1829.464] -- 0:00:35
735000 -- (-1831.225) (-1829.873) [-1825.929] (-1830.953) * (-1827.663) (-1836.544) (-1825.708) [-1830.134] -- 0:00:35
Average standard deviation of split frequencies: 0.010328
735500 -- (-1826.595) [-1822.834] (-1823.485) (-1831.967) * (-1822.045) [-1828.377] (-1824.742) (-1829.363) -- 0:00:35
736000 -- [-1822.579] (-1824.373) (-1834.993) (-1830.771) * (-1827.975) (-1827.991) [-1825.531] (-1833.772) -- 0:00:35
736500 -- (-1828.822) (-1829.402) (-1825.505) [-1824.403] * (-1833.269) (-1832.991) (-1825.196) [-1821.322] -- 0:00:35
737000 -- [-1827.162] (-1823.193) (-1835.066) (-1823.843) * (-1831.456) [-1821.786] (-1824.169) (-1835.106) -- 0:00:34
737500 -- [-1823.704] (-1830.508) (-1827.489) (-1822.235) * (-1832.992) (-1825.757) [-1821.953] (-1828.576) -- 0:00:34
738000 -- (-1826.353) [-1831.152] (-1828.466) (-1827.723) * (-1828.992) (-1827.417) (-1836.202) [-1827.192] -- 0:00:34
738500 -- [-1824.624] (-1821.613) (-1830.434) (-1830.691) * (-1821.330) (-1841.231) (-1830.401) [-1821.743] -- 0:00:34
739000 -- (-1827.615) (-1827.924) [-1831.162] (-1821.084) * (-1829.133) (-1829.483) (-1827.151) [-1829.392] -- 0:00:34
739500 -- (-1832.100) (-1828.349) [-1828.480] (-1825.690) * (-1831.202) (-1827.738) (-1824.886) [-1834.175] -- 0:00:34
740000 -- [-1829.007] (-1828.355) (-1826.600) (-1829.596) * [-1829.827] (-1827.012) (-1839.089) (-1825.356) -- 0:00:34
Average standard deviation of split frequencies: 0.010303
740500 -- (-1829.441) (-1827.550) (-1829.746) [-1833.980] * (-1827.715) (-1827.049) (-1832.862) [-1824.768] -- 0:00:34
741000 -- (-1824.455) [-1827.653] (-1829.138) (-1820.568) * [-1819.077] (-1835.608) (-1823.559) (-1826.292) -- 0:00:34
741500 -- (-1821.007) (-1828.896) (-1821.556) [-1822.617] * [-1825.511] (-1822.629) (-1827.240) (-1822.684) -- 0:00:34
742000 -- [-1822.947] (-1824.041) (-1833.354) (-1823.555) * [-1829.128] (-1826.294) (-1826.684) (-1825.611) -- 0:00:34
742500 -- (-1821.905) (-1826.169) [-1825.467] (-1828.592) * (-1826.358) (-1830.592) (-1830.025) [-1827.005] -- 0:00:34
743000 -- (-1825.236) (-1821.438) (-1828.613) [-1834.437] * (-1837.080) (-1822.783) (-1830.510) [-1823.771] -- 0:00:34
743500 -- (-1831.693) (-1827.191) (-1832.351) [-1828.511] * [-1829.214] (-1823.885) (-1824.007) (-1832.333) -- 0:00:34
744000 -- (-1826.837) [-1826.205] (-1827.294) (-1824.553) * (-1829.525) (-1835.228) [-1820.748] (-1821.582) -- 0:00:34
744500 -- (-1829.605) (-1825.348) [-1825.052] (-1819.421) * (-1823.200) (-1830.281) (-1821.277) [-1820.110] -- 0:00:33
745000 -- (-1836.994) (-1822.181) (-1835.571) [-1825.600] * (-1827.113) (-1823.601) (-1825.807) [-1820.493] -- 0:00:33
Average standard deviation of split frequencies: 0.010387
745500 -- (-1830.103) [-1824.581] (-1828.920) (-1831.311) * [-1822.740] (-1832.351) (-1825.192) (-1822.114) -- 0:00:33
746000 -- (-1829.775) [-1826.899] (-1831.077) (-1829.986) * [-1821.642] (-1823.901) (-1833.792) (-1825.464) -- 0:00:33
746500 -- (-1821.670) [-1821.975] (-1825.919) (-1824.708) * [-1830.797] (-1835.272) (-1831.359) (-1827.101) -- 0:00:33
747000 -- [-1834.108] (-1826.558) (-1830.876) (-1829.782) * (-1827.197) [-1825.387] (-1832.740) (-1825.985) -- 0:00:33
747500 -- (-1826.325) [-1823.688] (-1831.726) (-1830.981) * [-1823.861] (-1832.225) (-1825.769) (-1828.969) -- 0:00:33
748000 -- (-1831.243) (-1826.146) (-1833.594) [-1824.984] * (-1825.418) (-1837.365) [-1829.210] (-1827.634) -- 0:00:33
748500 -- [-1822.061] (-1832.945) (-1829.437) (-1823.630) * (-1832.715) (-1825.326) (-1829.875) [-1824.980] -- 0:00:33
749000 -- [-1829.567] (-1825.789) (-1830.875) (-1835.543) * [-1826.352] (-1831.962) (-1822.236) (-1823.004) -- 0:00:33
749500 -- (-1831.541) [-1821.117] (-1822.084) (-1830.299) * (-1833.495) (-1821.966) [-1819.150] (-1833.533) -- 0:00:33
750000 -- (-1825.900) (-1818.817) [-1823.944] (-1827.090) * (-1823.252) (-1825.583) [-1828.527] (-1823.951) -- 0:00:33
Average standard deviation of split frequencies: 0.010322
750500 -- (-1821.093) (-1831.601) [-1825.042] (-1826.344) * (-1822.403) [-1827.477] (-1829.302) (-1823.586) -- 0:00:33
751000 -- (-1831.930) [-1819.824] (-1828.553) (-1827.650) * [-1823.174] (-1837.050) (-1832.655) (-1819.141) -- 0:00:33
751500 -- [-1824.927] (-1830.288) (-1831.635) (-1828.099) * (-1831.001) [-1827.038] (-1821.831) (-1820.655) -- 0:00:33
752000 -- (-1821.876) (-1829.114) (-1828.310) [-1825.861] * (-1829.685) (-1821.631) (-1821.833) [-1822.458] -- 0:00:32
752500 -- (-1827.882) (-1819.897) (-1828.553) [-1830.331] * (-1823.391) [-1828.147] (-1829.256) (-1825.601) -- 0:00:32
753000 -- (-1823.594) (-1826.624) [-1825.202] (-1821.486) * (-1828.081) (-1820.598) [-1829.671] (-1826.907) -- 0:00:32
753500 -- (-1820.533) [-1823.891] (-1821.784) (-1825.914) * (-1829.643) (-1818.542) [-1822.423] (-1827.633) -- 0:00:32
754000 -- (-1828.327) [-1827.405] (-1825.228) (-1828.825) * (-1819.095) (-1830.263) [-1828.809] (-1823.992) -- 0:00:32
754500 -- [-1825.189] (-1828.241) (-1826.390) (-1823.426) * (-1825.496) (-1827.638) (-1825.860) [-1826.300] -- 0:00:32
755000 -- (-1821.887) [-1824.129] (-1827.380) (-1818.107) * (-1830.804) (-1824.789) (-1826.345) [-1823.716] -- 0:00:32
Average standard deviation of split frequencies: 0.010328
755500 -- (-1824.434) [-1828.137] (-1825.750) (-1823.154) * (-1833.137) (-1828.508) [-1828.432] (-1823.456) -- 0:00:32
756000 -- (-1823.684) (-1829.339) (-1826.870) [-1825.168] * (-1823.566) [-1821.784] (-1826.096) (-1832.898) -- 0:00:32
756500 -- [-1825.948] (-1825.799) (-1831.765) (-1824.830) * (-1826.676) (-1827.200) [-1828.123] (-1823.449) -- 0:00:32
757000 -- [-1819.622] (-1829.193) (-1822.936) (-1825.134) * (-1825.308) (-1825.855) (-1829.472) [-1828.054] -- 0:00:32
757500 -- [-1835.683] (-1823.054) (-1829.740) (-1829.061) * (-1826.678) [-1822.869] (-1823.780) (-1820.791) -- 0:00:32
758000 -- (-1829.792) (-1830.147) [-1826.099] (-1828.557) * (-1826.003) (-1820.972) (-1827.097) [-1825.756] -- 0:00:32
758500 -- (-1820.922) (-1837.725) (-1826.629) [-1826.276] * (-1822.163) [-1825.009] (-1832.301) (-1821.985) -- 0:00:32
759000 -- [-1834.556] (-1826.789) (-1830.556) (-1828.402) * (-1824.837) [-1823.980] (-1838.061) (-1825.804) -- 0:00:32
759500 -- (-1830.394) [-1829.260] (-1836.286) (-1827.615) * (-1823.765) [-1830.803] (-1829.760) (-1823.438) -- 0:00:31
760000 -- (-1827.376) (-1825.610) (-1822.926) [-1831.754] * (-1825.160) [-1824.278] (-1830.161) (-1823.735) -- 0:00:31
Average standard deviation of split frequencies: 0.010535
760500 -- [-1829.733] (-1824.275) (-1832.248) (-1834.347) * (-1829.232) [-1827.405] (-1827.540) (-1819.284) -- 0:00:31
761000 -- (-1827.986) [-1826.261] (-1831.595) (-1824.996) * (-1820.840) [-1823.293] (-1825.804) (-1827.524) -- 0:00:31
761500 -- [-1827.214] (-1822.431) (-1837.016) (-1829.646) * [-1823.291] (-1831.856) (-1829.624) (-1825.023) -- 0:00:31
762000 -- (-1834.471) (-1825.354) (-1831.130) [-1820.248] * (-1829.797) (-1819.267) (-1824.891) [-1819.646] -- 0:00:31
762500 -- (-1829.067) (-1821.938) (-1818.408) [-1830.965] * [-1818.737] (-1826.912) (-1827.212) (-1829.643) -- 0:00:31
763000 -- (-1819.317) (-1827.964) [-1823.415] (-1834.402) * [-1825.839] (-1820.969) (-1823.773) (-1830.279) -- 0:00:31
763500 -- (-1837.992) (-1829.878) [-1820.900] (-1832.858) * (-1828.807) [-1821.131] (-1827.426) (-1840.381) -- 0:00:31
764000 -- (-1828.267) [-1829.898] (-1826.125) (-1830.439) * (-1827.559) (-1825.319) [-1823.977] (-1834.663) -- 0:00:31
764500 -- [-1821.065] (-1834.260) (-1828.537) (-1831.804) * [-1823.066] (-1826.066) (-1821.196) (-1833.059) -- 0:00:31
765000 -- (-1831.113) (-1835.331) (-1826.209) [-1828.692] * [-1822.543] (-1828.714) (-1820.661) (-1830.976) -- 0:00:31
Average standard deviation of split frequencies: 0.010693
765500 -- (-1822.475) (-1825.565) [-1826.488] (-1840.840) * (-1825.706) [-1829.435] (-1837.426) (-1831.730) -- 0:00:31
766000 -- (-1827.446) (-1832.007) (-1830.853) [-1831.115] * [-1821.845] (-1838.578) (-1828.465) (-1829.676) -- 0:00:31
766500 -- (-1823.738) (-1829.209) (-1824.818) [-1830.266] * (-1825.371) (-1832.770) [-1826.028] (-1833.059) -- 0:00:31
767000 -- (-1827.584) (-1821.628) (-1828.136) [-1825.706] * (-1824.968) [-1828.680] (-1825.530) (-1830.928) -- 0:00:30
767500 -- (-1821.741) (-1820.981) [-1824.495] (-1828.218) * (-1835.525) (-1829.551) (-1823.886) [-1822.593] -- 0:00:30
768000 -- (-1821.068) (-1833.440) (-1823.889) [-1826.871] * [-1831.759] (-1832.359) (-1823.301) (-1824.580) -- 0:00:30
768500 -- (-1834.038) [-1818.678] (-1835.523) (-1823.370) * (-1827.889) [-1821.705] (-1829.322) (-1825.357) -- 0:00:30
769000 -- [-1825.113] (-1823.478) (-1823.055) (-1830.673) * [-1822.035] (-1824.807) (-1828.686) (-1825.447) -- 0:00:30
769500 -- [-1821.140] (-1819.304) (-1828.448) (-1832.340) * (-1830.954) (-1827.823) (-1825.279) [-1821.010] -- 0:00:30
770000 -- (-1820.994) (-1824.561) (-1830.304) [-1821.187] * (-1831.110) (-1830.231) [-1825.147] (-1829.944) -- 0:00:30
Average standard deviation of split frequencies: 0.010513
770500 -- (-1826.406) (-1820.152) [-1822.501] (-1824.275) * (-1841.964) (-1826.400) [-1826.177] (-1826.167) -- 0:00:30
771000 -- [-1822.774] (-1821.069) (-1826.849) (-1834.873) * (-1835.627) (-1818.418) (-1828.217) [-1820.406] -- 0:00:30
771500 -- (-1829.685) (-1833.694) [-1822.781] (-1829.865) * (-1820.256) (-1829.441) [-1823.531] (-1831.483) -- 0:00:30
772000 -- (-1821.166) (-1832.508) [-1819.690] (-1823.106) * (-1836.013) (-1829.250) [-1824.604] (-1819.714) -- 0:00:30
772500 -- (-1827.988) (-1823.556) [-1833.458] (-1823.273) * (-1830.652) (-1822.494) [-1823.283] (-1821.966) -- 0:00:30
773000 -- (-1825.085) [-1825.114] (-1828.585) (-1825.101) * (-1824.948) (-1825.004) [-1829.261] (-1832.059) -- 0:00:30
773500 -- [-1828.191] (-1823.396) (-1830.040) (-1821.805) * (-1825.712) [-1819.629] (-1826.508) (-1827.013) -- 0:00:30
774000 -- (-1830.756) (-1827.940) (-1828.750) [-1832.605] * (-1824.861) (-1826.370) (-1827.360) [-1827.706] -- 0:00:30
774500 -- (-1819.286) [-1829.674] (-1821.345) (-1832.934) * [-1823.474] (-1836.397) (-1826.136) (-1828.408) -- 0:00:29
775000 -- (-1832.124) [-1824.935] (-1826.040) (-1824.248) * (-1830.620) (-1827.770) [-1826.918] (-1831.574) -- 0:00:29
Average standard deviation of split frequencies: 0.009947
775500 -- (-1835.725) [-1827.764] (-1822.452) (-1829.737) * (-1825.539) [-1830.719] (-1829.007) (-1827.169) -- 0:00:29
776000 -- (-1828.171) (-1825.008) [-1822.423] (-1825.323) * [-1821.692] (-1828.785) (-1827.738) (-1825.624) -- 0:00:29
776500 -- [-1823.311] (-1821.494) (-1816.250) (-1830.376) * [-1823.002] (-1829.266) (-1822.012) (-1822.564) -- 0:00:29
777000 -- (-1830.270) (-1824.041) (-1821.991) [-1822.916] * (-1824.845) (-1827.973) [-1823.076] (-1830.365) -- 0:00:29
777500 -- (-1825.913) [-1823.474] (-1828.104) (-1827.282) * [-1828.721] (-1834.232) (-1827.729) (-1831.948) -- 0:00:29
778000 -- (-1825.024) (-1830.811) (-1833.406) [-1829.573] * (-1824.939) [-1830.697] (-1827.241) (-1829.710) -- 0:00:29
778500 -- (-1830.354) (-1825.615) [-1835.628] (-1822.797) * (-1828.547) (-1825.508) [-1837.337] (-1835.605) -- 0:00:29
779000 -- (-1834.975) (-1828.140) (-1827.410) [-1821.266] * (-1826.705) (-1832.759) (-1832.307) [-1829.288] -- 0:00:29
779500 -- (-1827.271) [-1826.786] (-1839.085) (-1827.375) * (-1828.631) [-1824.094] (-1827.677) (-1825.110) -- 0:00:29
780000 -- (-1828.048) (-1831.759) (-1828.394) [-1826.340] * (-1829.378) (-1830.417) [-1819.797] (-1821.847) -- 0:00:29
Average standard deviation of split frequencies: 0.010336
780500 -- (-1827.387) (-1828.922) [-1822.484] (-1832.415) * (-1825.991) [-1828.097] (-1823.847) (-1827.627) -- 0:00:29
781000 -- (-1833.002) (-1824.809) (-1826.392) [-1827.672] * (-1824.533) [-1824.217] (-1832.419) (-1822.944) -- 0:00:29
781500 -- (-1828.363) [-1827.449] (-1835.909) (-1826.038) * (-1831.408) [-1827.136] (-1827.880) (-1827.755) -- 0:00:29
782000 -- (-1827.369) (-1821.208) (-1833.262) [-1825.318] * (-1828.633) [-1827.445] (-1823.379) (-1821.527) -- 0:00:28
782500 -- (-1831.511) [-1821.940] (-1836.248) (-1827.250) * [-1826.800] (-1825.233) (-1821.556) (-1829.384) -- 0:00:28
783000 -- (-1826.019) [-1825.401] (-1833.104) (-1827.026) * [-1824.676] (-1837.245) (-1828.143) (-1832.228) -- 0:00:28
783500 -- (-1822.388) (-1831.114) [-1831.535] (-1826.866) * (-1832.191) [-1821.396] (-1824.012) (-1826.391) -- 0:00:28
784000 -- (-1826.265) (-1822.563) [-1828.036] (-1819.077) * (-1825.187) [-1822.814] (-1821.891) (-1818.972) -- 0:00:28
784500 -- [-1820.545] (-1828.034) (-1826.584) (-1820.055) * (-1824.090) (-1829.849) [-1819.275] (-1828.188) -- 0:00:28
785000 -- (-1828.812) (-1823.388) (-1827.470) [-1821.061] * (-1830.061) [-1819.921] (-1827.768) (-1833.242) -- 0:00:28
Average standard deviation of split frequencies: 0.010760
785500 -- (-1823.373) (-1831.516) [-1824.489] (-1829.684) * (-1834.552) [-1823.813] (-1822.028) (-1831.558) -- 0:00:28
786000 -- [-1819.341] (-1825.981) (-1829.641) (-1834.208) * (-1824.223) [-1823.615] (-1835.994) (-1828.220) -- 0:00:28
786500 -- (-1830.343) (-1822.752) [-1833.132] (-1830.313) * (-1832.022) (-1822.500) [-1826.765] (-1823.675) -- 0:00:28
787000 -- (-1826.369) (-1822.079) [-1823.895] (-1829.048) * (-1828.295) (-1826.644) (-1836.580) [-1824.763] -- 0:00:28
787500 -- (-1832.121) (-1824.925) [-1831.144] (-1826.896) * (-1829.611) (-1823.951) (-1829.754) [-1819.266] -- 0:00:28
788000 -- (-1823.808) [-1825.474] (-1830.044) (-1826.653) * (-1839.740) (-1830.627) [-1820.743] (-1822.162) -- 0:00:28
788500 -- [-1822.717] (-1831.310) (-1828.024) (-1822.925) * (-1830.325) (-1824.871) (-1827.334) [-1824.758] -- 0:00:28
789000 -- (-1828.067) [-1822.572] (-1821.068) (-1829.991) * (-1827.781) (-1824.894) (-1825.597) [-1820.380] -- 0:00:28
789500 -- (-1825.534) [-1823.703] (-1820.156) (-1827.573) * (-1827.714) (-1822.272) [-1824.282] (-1828.159) -- 0:00:27
790000 -- (-1823.353) [-1827.385] (-1828.947) (-1837.665) * [-1828.415] (-1823.034) (-1830.662) (-1824.419) -- 0:00:27
Average standard deviation of split frequencies: 0.010210
790500 -- (-1821.310) (-1824.592) (-1835.301) [-1832.525] * [-1822.993] (-1829.978) (-1824.587) (-1826.224) -- 0:00:27
791000 -- [-1820.821] (-1826.009) (-1830.166) (-1819.571) * [-1824.182] (-1823.208) (-1825.014) (-1827.561) -- 0:00:27
791500 -- [-1828.278] (-1824.972) (-1825.778) (-1826.508) * [-1819.589] (-1825.864) (-1823.064) (-1829.896) -- 0:00:27
792000 -- (-1826.815) (-1828.445) (-1837.785) [-1821.830] * (-1825.423) (-1828.572) [-1824.008] (-1834.122) -- 0:00:27
792500 -- (-1834.093) [-1825.081] (-1826.584) (-1822.420) * [-1829.315] (-1829.295) (-1820.418) (-1830.316) -- 0:00:27
793000 -- (-1833.112) [-1824.940] (-1830.014) (-1820.981) * [-1825.743] (-1829.383) (-1830.359) (-1827.403) -- 0:00:27
793500 -- (-1832.913) (-1828.795) [-1821.159] (-1837.329) * (-1827.180) (-1830.453) [-1827.883] (-1825.605) -- 0:00:27
794000 -- (-1827.460) (-1823.052) [-1826.826] (-1825.461) * (-1831.760) [-1822.674] (-1825.983) (-1829.451) -- 0:00:27
794500 -- (-1825.601) (-1826.276) [-1821.355] (-1826.059) * (-1834.164) [-1824.717] (-1829.743) (-1828.979) -- 0:00:27
795000 -- (-1829.857) (-1824.990) (-1838.448) [-1828.107] * (-1831.597) [-1825.076] (-1826.853) (-1827.877) -- 0:00:27
Average standard deviation of split frequencies: 0.009712
795500 -- [-1824.148] (-1829.969) (-1829.783) (-1830.081) * (-1827.837) (-1828.446) (-1824.447) [-1827.904] -- 0:00:27
796000 -- [-1824.570] (-1828.672) (-1822.210) (-1834.416) * [-1824.917] (-1822.459) (-1831.730) (-1825.959) -- 0:00:27
796500 -- [-1834.077] (-1822.449) (-1826.050) (-1821.680) * [-1819.894] (-1827.537) (-1823.623) (-1828.444) -- 0:00:27
797000 -- (-1829.788) (-1820.179) (-1823.296) [-1826.921] * (-1822.037) (-1841.279) [-1828.248] (-1827.871) -- 0:00:26
797500 -- [-1827.036] (-1827.568) (-1824.330) (-1826.089) * [-1829.497] (-1830.432) (-1823.249) (-1830.782) -- 0:00:26
798000 -- (-1829.413) (-1827.090) (-1833.184) [-1825.627] * (-1824.024) (-1827.824) (-1831.605) [-1822.388] -- 0:00:26
798500 -- (-1822.440) (-1834.744) [-1824.617] (-1825.122) * (-1828.374) (-1833.279) [-1819.533] (-1825.651) -- 0:00:26
799000 -- [-1829.213] (-1824.659) (-1833.656) (-1821.170) * (-1825.454) (-1822.341) [-1820.878] (-1821.217) -- 0:00:26
799500 -- (-1835.726) (-1823.804) [-1836.652] (-1820.880) * [-1823.652] (-1826.810) (-1840.043) (-1832.083) -- 0:00:26
800000 -- [-1835.583] (-1824.747) (-1830.433) (-1825.530) * (-1835.480) (-1830.580) [-1821.322] (-1821.156) -- 0:00:26
Average standard deviation of split frequencies: 0.009420
800500 -- (-1828.368) (-1822.341) (-1829.317) [-1826.490] * (-1826.234) (-1819.746) (-1823.534) [-1823.392] -- 0:00:26
801000 -- (-1825.102) (-1821.572) (-1827.365) [-1829.083] * (-1829.392) (-1827.913) [-1831.608] (-1826.203) -- 0:00:26
801500 -- (-1817.854) (-1828.318) (-1826.059) [-1819.548] * (-1829.407) (-1836.108) [-1823.081] (-1823.050) -- 0:00:26
802000 -- (-1821.525) (-1824.674) [-1822.724] (-1823.849) * [-1827.929] (-1824.352) (-1834.947) (-1823.615) -- 0:00:26
802500 -- (-1825.570) (-1831.737) (-1826.817) [-1820.385] * (-1828.158) [-1819.703] (-1823.333) (-1824.368) -- 0:00:26
803000 -- (-1826.607) (-1831.050) [-1819.494] (-1828.695) * (-1822.092) (-1828.418) [-1829.294] (-1831.917) -- 0:00:26
803500 -- (-1827.079) [-1824.937] (-1826.116) (-1821.360) * (-1825.926) (-1822.244) (-1828.340) [-1829.765] -- 0:00:26
804000 -- (-1826.934) (-1835.445) (-1828.586) [-1822.479] * (-1824.468) (-1822.831) [-1820.123] (-1826.256) -- 0:00:26
804500 -- (-1830.324) (-1829.129) [-1829.536] (-1820.428) * (-1827.874) [-1833.365] (-1824.480) (-1824.577) -- 0:00:26
805000 -- (-1828.444) (-1825.944) [-1823.793] (-1827.937) * (-1825.545) [-1827.811] (-1824.547) (-1830.440) -- 0:00:25
Average standard deviation of split frequencies: 0.009241
805500 -- (-1826.235) (-1825.481) [-1824.383] (-1820.282) * (-1828.701) [-1828.415] (-1826.682) (-1826.488) -- 0:00:25
806000 -- (-1832.367) [-1828.058] (-1831.454) (-1827.370) * (-1824.501) (-1829.151) [-1830.047] (-1826.826) -- 0:00:25
806500 -- (-1829.846) [-1823.608] (-1826.299) (-1825.351) * (-1821.916) [-1823.893] (-1820.837) (-1823.439) -- 0:00:25
807000 -- (-1832.190) (-1825.469) [-1825.094] (-1828.736) * (-1826.772) [-1829.936] (-1821.807) (-1829.045) -- 0:00:25
807500 -- (-1829.436) (-1823.282) (-1828.512) [-1824.348] * [-1825.739] (-1833.450) (-1820.241) (-1828.437) -- 0:00:25
808000 -- (-1827.398) [-1827.039] (-1832.172) (-1821.931) * [-1830.239] (-1830.324) (-1828.006) (-1824.696) -- 0:00:25
808500 -- (-1828.835) (-1825.999) [-1829.313] (-1834.664) * (-1830.267) (-1827.363) [-1824.588] (-1831.087) -- 0:00:25
809000 -- (-1834.184) (-1833.182) [-1826.034] (-1821.920) * [-1826.373] (-1833.415) (-1824.533) (-1825.251) -- 0:00:25
809500 -- (-1827.751) (-1823.137) (-1826.058) [-1821.953] * (-1825.969) (-1830.882) (-1828.283) [-1824.942] -- 0:00:25
810000 -- (-1822.769) (-1820.500) (-1826.540) [-1823.762] * (-1823.443) (-1829.000) (-1823.138) [-1827.591] -- 0:00:25
Average standard deviation of split frequencies: 0.008994
810500 -- (-1821.668) (-1825.309) (-1830.708) [-1824.775] * (-1831.423) (-1826.634) [-1833.187] (-1822.334) -- 0:00:25
811000 -- [-1828.326] (-1830.186) (-1826.436) (-1822.050) * (-1828.000) [-1823.528] (-1830.985) (-1827.231) -- 0:00:25
811500 -- (-1829.588) (-1822.937) (-1832.986) [-1831.392] * (-1820.618) (-1842.100) [-1825.750] (-1828.369) -- 0:00:25
812000 -- (-1829.787) [-1826.953] (-1819.341) (-1823.830) * (-1828.070) (-1833.000) (-1831.081) [-1821.856] -- 0:00:25
812500 -- (-1829.498) (-1822.977) [-1833.097] (-1829.008) * (-1821.456) (-1832.908) (-1826.410) [-1826.237] -- 0:00:24
813000 -- (-1825.067) (-1833.166) (-1825.327) [-1827.744] * (-1831.327) (-1843.462) [-1826.950] (-1820.698) -- 0:00:24
813500 -- (-1825.191) [-1827.571] (-1832.195) (-1828.380) * (-1822.127) (-1826.265) [-1827.452] (-1830.141) -- 0:00:24
814000 -- (-1827.803) (-1833.893) (-1829.589) [-1821.711] * (-1823.596) (-1832.398) [-1823.988] (-1828.314) -- 0:00:24
814500 -- (-1824.522) (-1829.011) [-1827.474] (-1821.875) * (-1822.517) [-1829.369] (-1829.047) (-1829.477) -- 0:00:24
815000 -- (-1825.033) (-1832.320) [-1825.088] (-1817.060) * [-1826.867] (-1829.784) (-1835.141) (-1828.643) -- 0:00:24
Average standard deviation of split frequencies: 0.008781
815500 -- (-1825.877) (-1826.236) (-1835.730) [-1820.313] * (-1825.406) [-1831.620] (-1824.569) (-1830.684) -- 0:00:24
816000 -- [-1827.219] (-1819.591) (-1837.984) (-1824.354) * (-1821.532) (-1831.747) (-1829.315) [-1826.976] -- 0:00:24
816500 -- [-1825.264] (-1825.597) (-1832.823) (-1833.075) * [-1827.649] (-1828.866) (-1830.105) (-1825.894) -- 0:00:24
817000 -- (-1821.641) (-1825.495) (-1830.207) [-1825.605] * [-1826.088] (-1825.498) (-1838.793) (-1824.545) -- 0:00:24
817500 -- (-1827.431) (-1827.401) [-1822.114] (-1828.171) * (-1826.789) (-1825.370) (-1830.559) [-1823.863] -- 0:00:24
818000 -- [-1821.605] (-1831.234) (-1830.336) (-1833.297) * (-1827.185) (-1826.192) (-1836.268) [-1821.633] -- 0:00:24
818500 -- (-1829.727) [-1823.495] (-1828.352) (-1831.118) * (-1831.203) (-1828.192) (-1834.107) [-1823.114] -- 0:00:24
819000 -- (-1830.283) [-1822.792] (-1829.755) (-1819.768) * (-1832.610) (-1834.515) (-1838.224) [-1822.541] -- 0:00:24
819500 -- (-1823.716) (-1830.066) [-1825.058] (-1828.259) * (-1822.949) (-1827.562) [-1821.504] (-1829.477) -- 0:00:24
820000 -- (-1819.781) [-1824.093] (-1824.174) (-1822.956) * [-1821.863] (-1831.056) (-1822.800) (-1826.973) -- 0:00:23
Average standard deviation of split frequencies: 0.008348
820500 -- (-1828.723) [-1824.450] (-1829.402) (-1823.233) * (-1831.130) [-1831.584] (-1822.314) (-1830.759) -- 0:00:23
821000 -- (-1827.301) [-1830.325] (-1827.568) (-1827.207) * (-1828.818) (-1835.863) (-1822.269) [-1826.677] -- 0:00:23
821500 -- [-1831.929] (-1827.004) (-1827.981) (-1832.023) * [-1823.531] (-1831.585) (-1831.781) (-1825.622) -- 0:00:23
822000 -- (-1829.648) (-1834.467) (-1829.979) [-1826.458] * (-1820.164) (-1824.292) (-1831.228) [-1827.109] -- 0:00:23
822500 -- [-1825.623] (-1825.345) (-1826.348) (-1838.778) * (-1831.958) [-1825.601] (-1829.592) (-1821.278) -- 0:00:23
823000 -- [-1824.118] (-1827.663) (-1824.530) (-1823.380) * (-1827.674) (-1824.301) (-1830.850) [-1819.966] -- 0:00:23
823500 -- [-1832.147] (-1837.378) (-1834.341) (-1831.766) * (-1826.213) (-1829.167) [-1823.328] (-1835.783) -- 0:00:23
824000 -- (-1831.408) [-1824.240] (-1823.107) (-1836.064) * [-1826.189] (-1828.047) (-1826.157) (-1829.693) -- 0:00:23
824500 -- (-1835.827) (-1825.212) (-1828.820) [-1830.549] * [-1826.372] (-1824.771) (-1826.010) (-1833.401) -- 0:00:23
825000 -- (-1823.428) (-1829.130) [-1821.049] (-1823.235) * (-1823.182) [-1824.717] (-1825.941) (-1830.962) -- 0:00:23
Average standard deviation of split frequencies: 0.008370
825500 -- [-1827.529] (-1825.196) (-1830.203) (-1831.755) * (-1831.265) (-1822.795) [-1827.998] (-1831.964) -- 0:00:23
826000 -- [-1832.371] (-1826.281) (-1821.749) (-1828.872) * (-1825.679) [-1826.480] (-1826.213) (-1828.868) -- 0:00:23
826500 -- (-1828.820) [-1835.369] (-1828.041) (-1829.946) * (-1818.682) [-1825.840] (-1828.440) (-1830.838) -- 0:00:23
827000 -- (-1826.166) (-1826.331) (-1822.945) [-1829.872] * (-1824.938) [-1825.649] (-1835.300) (-1832.950) -- 0:00:23
827500 -- (-1820.712) (-1837.243) [-1826.532] (-1824.374) * [-1831.641] (-1827.144) (-1825.381) (-1829.380) -- 0:00:22
828000 -- (-1823.313) (-1825.385) (-1823.857) [-1830.056] * (-1825.285) [-1822.038] (-1825.562) (-1824.707) -- 0:00:22
828500 -- [-1819.581] (-1826.957) (-1831.148) (-1825.571) * [-1825.583] (-1823.049) (-1836.250) (-1825.834) -- 0:00:22
829000 -- (-1825.435) (-1826.423) (-1823.811) [-1826.278] * (-1823.961) [-1822.101] (-1823.798) (-1822.445) -- 0:00:22
829500 -- (-1831.418) (-1826.540) [-1825.378] (-1825.051) * (-1827.492) [-1824.974] (-1829.707) (-1836.981) -- 0:00:22
830000 -- (-1824.797) (-1834.183) [-1827.457] (-1821.618) * (-1833.452) (-1827.011) [-1825.691] (-1819.106) -- 0:00:22
Average standard deviation of split frequencies: 0.007983
830500 -- (-1837.143) (-1834.658) (-1833.688) [-1820.596] * (-1828.899) (-1833.162) [-1822.417] (-1825.009) -- 0:00:22
831000 -- (-1829.067) (-1835.103) (-1821.209) [-1828.542] * [-1827.526] (-1824.239) (-1818.450) (-1829.917) -- 0:00:22
831500 -- [-1828.301] (-1832.910) (-1825.207) (-1828.694) * (-1824.454) (-1830.206) (-1828.247) [-1826.619] -- 0:00:22
832000 -- (-1835.570) (-1827.966) (-1824.231) [-1823.892] * [-1823.542] (-1820.160) (-1834.789) (-1821.058) -- 0:00:22
832500 -- [-1822.663] (-1836.637) (-1835.000) (-1834.813) * (-1826.947) (-1828.549) [-1827.019] (-1825.479) -- 0:00:22
833000 -- (-1830.474) [-1834.186] (-1839.725) (-1822.314) * (-1823.772) [-1822.134] (-1832.055) (-1831.273) -- 0:00:22
833500 -- (-1829.731) [-1831.632] (-1836.915) (-1825.587) * (-1833.754) (-1831.490) (-1831.372) [-1825.287] -- 0:00:22
834000 -- (-1819.923) (-1824.308) [-1831.521] (-1824.261) * (-1823.332) (-1819.852) (-1843.102) [-1822.339] -- 0:00:22
834500 -- [-1828.842] (-1826.035) (-1831.211) (-1821.276) * (-1825.452) [-1818.870] (-1827.819) (-1835.547) -- 0:00:22
835000 -- [-1818.183] (-1830.524) (-1836.890) (-1823.863) * (-1826.551) [-1823.760] (-1829.059) (-1827.402) -- 0:00:21
Average standard deviation of split frequencies: 0.007894
835500 -- (-1824.996) (-1823.928) (-1823.935) [-1823.390] * (-1825.766) (-1822.370) [-1827.128] (-1825.799) -- 0:00:21
836000 -- (-1824.606) [-1833.530] (-1826.396) (-1829.458) * (-1831.564) [-1824.774] (-1826.110) (-1826.281) -- 0:00:21
836500 -- (-1841.142) (-1826.911) [-1835.992] (-1828.093) * (-1832.082) [-1827.091] (-1824.920) (-1825.395) -- 0:00:21
837000 -- [-1826.825] (-1834.438) (-1836.562) (-1824.490) * (-1820.844) [-1819.623] (-1822.318) (-1827.935) -- 0:00:21
837500 -- (-1826.799) (-1820.170) [-1819.846] (-1843.623) * (-1825.023) (-1834.681) [-1827.952] (-1823.350) -- 0:00:21
838000 -- (-1843.282) [-1821.875] (-1829.205) (-1838.754) * (-1827.661) [-1827.888] (-1830.851) (-1825.804) -- 0:00:21
838500 -- (-1828.029) [-1819.703] (-1826.089) (-1830.065) * (-1827.398) (-1824.225) [-1826.579] (-1835.197) -- 0:00:21
839000 -- [-1824.113] (-1829.174) (-1840.378) (-1833.460) * [-1825.326] (-1831.574) (-1827.801) (-1828.363) -- 0:00:21
839500 -- (-1829.730) [-1820.461] (-1826.135) (-1835.592) * (-1828.258) (-1825.790) (-1826.192) [-1825.394] -- 0:00:21
840000 -- [-1825.459] (-1821.293) (-1824.207) (-1838.866) * [-1830.214] (-1828.191) (-1827.686) (-1831.068) -- 0:00:21
Average standard deviation of split frequencies: 0.007776
840500 -- (-1831.271) (-1830.933) (-1825.062) [-1826.979] * (-1827.984) [-1819.714] (-1823.279) (-1830.416) -- 0:00:21
841000 -- (-1822.115) (-1825.192) [-1832.947] (-1826.364) * (-1821.996) (-1824.690) (-1826.946) [-1827.102] -- 0:00:21
841500 -- (-1830.366) [-1828.121] (-1830.807) (-1829.809) * [-1829.237] (-1829.803) (-1836.166) (-1829.554) -- 0:00:21
842000 -- [-1821.129] (-1826.252) (-1829.435) (-1825.768) * (-1821.963) (-1830.971) [-1827.036] (-1822.681) -- 0:00:21
842500 -- [-1826.214] (-1824.778) (-1824.211) (-1826.824) * (-1831.248) (-1825.536) (-1827.284) [-1825.633] -- 0:00:20
843000 -- [-1827.047] (-1832.972) (-1828.124) (-1826.983) * (-1830.293) (-1831.412) [-1820.370] (-1829.317) -- 0:00:20
843500 -- (-1827.799) (-1831.152) (-1829.887) [-1826.325] * (-1831.164) (-1836.640) [-1824.267] (-1824.513) -- 0:00:20
844000 -- [-1825.333] (-1826.946) (-1831.769) (-1825.158) * [-1825.189] (-1826.486) (-1826.914) (-1834.677) -- 0:00:20
844500 -- (-1826.098) (-1829.797) [-1819.752] (-1829.141) * (-1825.147) [-1829.572] (-1834.921) (-1831.244) -- 0:00:20
845000 -- (-1827.657) (-1819.222) [-1824.218] (-1828.108) * (-1821.296) [-1819.475] (-1832.154) (-1827.682) -- 0:00:20
Average standard deviation of split frequencies: 0.007690
845500 -- (-1834.602) (-1823.652) (-1820.668) [-1825.415] * [-1829.373] (-1831.222) (-1838.615) (-1830.314) -- 0:00:20
846000 -- (-1825.359) (-1827.787) [-1823.537] (-1829.412) * [-1821.875] (-1827.347) (-1826.193) (-1828.102) -- 0:00:20
846500 -- (-1831.379) (-1825.741) [-1822.742] (-1826.694) * (-1825.749) (-1826.760) [-1827.599] (-1828.489) -- 0:00:20
847000 -- (-1826.731) (-1824.529) (-1824.114) [-1830.149] * (-1830.775) [-1825.319] (-1827.751) (-1826.097) -- 0:00:20
847500 -- (-1823.052) [-1830.154] (-1826.964) (-1822.290) * [-1824.521] (-1827.724) (-1831.259) (-1828.757) -- 0:00:20
848000 -- (-1840.777) (-1828.115) (-1822.959) [-1827.172] * [-1819.884] (-1826.170) (-1823.959) (-1827.194) -- 0:00:20
848500 -- (-1825.006) (-1831.999) (-1817.330) [-1826.458] * (-1830.369) (-1829.248) [-1823.440] (-1843.673) -- 0:00:20
849000 -- (-1831.438) [-1827.503] (-1833.013) (-1826.668) * [-1831.039] (-1834.258) (-1828.227) (-1833.023) -- 0:00:20
849500 -- [-1825.028] (-1824.605) (-1825.848) (-1823.728) * (-1829.391) (-1827.024) (-1825.913) [-1828.182] -- 0:00:20
850000 -- [-1823.675] (-1828.352) (-1824.322) (-1824.306) * (-1830.723) [-1825.456] (-1829.642) (-1833.223) -- 0:00:19
Average standard deviation of split frequencies: 0.007795
850500 -- (-1825.005) (-1835.642) (-1830.288) [-1828.242] * (-1823.853) [-1828.170] (-1821.161) (-1835.581) -- 0:00:19
851000 -- (-1833.498) (-1821.427) [-1830.153] (-1835.011) * (-1831.873) (-1829.627) (-1826.972) [-1823.442] -- 0:00:19
851500 -- (-1839.210) (-1831.310) [-1829.902] (-1823.905) * (-1822.533) (-1824.941) [-1820.840] (-1827.602) -- 0:00:19
852000 -- (-1823.631) (-1827.721) [-1829.889] (-1830.640) * (-1826.145) (-1832.728) (-1825.050) [-1821.119] -- 0:00:19
852500 -- [-1832.116] (-1824.515) (-1827.120) (-1839.451) * [-1821.539] (-1821.108) (-1825.958) (-1834.073) -- 0:00:19
853000 -- (-1821.428) [-1830.784] (-1824.069) (-1823.784) * (-1825.388) [-1823.698] (-1823.292) (-1823.559) -- 0:00:19
853500 -- [-1827.178] (-1828.126) (-1828.214) (-1827.060) * (-1818.500) (-1825.528) [-1826.830] (-1827.771) -- 0:00:19
854000 -- (-1837.484) (-1830.041) (-1834.283) [-1825.977] * (-1820.568) (-1831.563) (-1825.846) [-1833.425] -- 0:00:19
854500 -- (-1835.646) (-1826.094) (-1832.804) [-1826.164] * (-1828.800) (-1822.555) (-1823.669) [-1822.737] -- 0:00:19
855000 -- (-1829.836) [-1824.128] (-1837.964) (-1823.004) * (-1829.158) [-1826.182] (-1842.475) (-1828.646) -- 0:00:19
Average standard deviation of split frequencies: 0.007820
855500 -- (-1831.765) [-1832.441] (-1834.532) (-1820.636) * (-1831.715) (-1827.018) (-1831.761) [-1824.619] -- 0:00:19
856000 -- (-1831.727) [-1824.505] (-1834.876) (-1823.246) * [-1829.218] (-1824.249) (-1834.048) (-1829.188) -- 0:00:19
856500 -- (-1837.392) [-1823.748] (-1834.138) (-1823.725) * [-1823.845] (-1835.708) (-1825.676) (-1820.488) -- 0:00:19
857000 -- (-1824.497) (-1834.468) [-1823.523] (-1826.374) * [-1816.155] (-1827.561) (-1831.247) (-1824.289) -- 0:00:19
857500 -- (-1833.779) (-1826.679) (-1834.371) [-1825.500] * (-1823.662) (-1826.537) (-1833.601) [-1824.477] -- 0:00:18
858000 -- (-1840.939) (-1825.002) (-1826.132) [-1825.643] * (-1827.016) (-1836.136) (-1825.537) [-1829.646] -- 0:00:18
858500 -- (-1834.558) (-1827.763) (-1836.587) [-1821.508] * [-1824.753] (-1828.925) (-1821.979) (-1823.161) -- 0:00:18
859000 -- [-1834.292] (-1824.740) (-1836.526) (-1824.223) * (-1824.251) (-1826.076) [-1825.649] (-1821.963) -- 0:00:18
859500 -- (-1834.648) (-1822.601) (-1834.561) [-1825.282] * (-1827.153) [-1823.251] (-1830.771) (-1830.312) -- 0:00:18
860000 -- (-1826.120) [-1819.795] (-1830.534) (-1829.215) * [-1833.624] (-1822.037) (-1822.136) (-1823.527) -- 0:00:18
Average standard deviation of split frequencies: 0.008106
860500 -- (-1831.706) (-1829.601) (-1833.943) [-1830.276] * (-1825.796) (-1822.269) [-1828.301] (-1827.246) -- 0:00:18
861000 -- (-1827.279) (-1828.708) (-1830.959) [-1823.353] * (-1829.078) (-1827.786) (-1835.859) [-1820.823] -- 0:00:18
861500 -- (-1839.607) (-1824.454) (-1831.665) [-1825.560] * (-1842.309) [-1827.208] (-1833.852) (-1818.902) -- 0:00:18
862000 -- (-1832.727) [-1826.255] (-1827.820) (-1829.304) * [-1832.655] (-1832.286) (-1829.152) (-1831.529) -- 0:00:18
862500 -- (-1826.691) (-1840.993) [-1830.830] (-1829.032) * (-1832.580) (-1830.875) [-1827.696] (-1825.485) -- 0:00:18
863000 -- (-1826.461) (-1828.659) (-1832.458) [-1825.265] * [-1823.984] (-1826.486) (-1834.414) (-1821.276) -- 0:00:18
863500 -- (-1822.335) [-1822.594] (-1828.437) (-1837.035) * (-1834.655) (-1832.686) (-1824.501) [-1828.021] -- 0:00:18
864000 -- [-1820.583] (-1826.134) (-1825.392) (-1831.153) * (-1825.590) (-1826.360) [-1826.971] (-1826.359) -- 0:00:18
864500 -- (-1827.976) (-1829.865) (-1827.021) [-1824.809] * (-1824.147) (-1830.065) (-1833.541) [-1824.543] -- 0:00:18
865000 -- [-1824.550] (-1825.472) (-1823.232) (-1829.391) * (-1826.746) [-1826.655] (-1823.635) (-1836.554) -- 0:00:17
Average standard deviation of split frequencies: 0.008056
865500 -- [-1823.388] (-1826.931) (-1823.018) (-1821.632) * [-1819.702] (-1825.881) (-1828.525) (-1849.325) -- 0:00:17
866000 -- (-1828.790) (-1831.303) (-1823.858) [-1825.361] * (-1827.712) [-1833.215] (-1837.427) (-1823.962) -- 0:00:17
866500 -- [-1830.651] (-1825.389) (-1825.013) (-1828.563) * (-1822.365) (-1826.390) (-1828.151) [-1831.413] -- 0:00:17
867000 -- (-1840.153) (-1824.829) (-1834.351) [-1822.530] * (-1826.868) (-1841.382) (-1831.195) [-1834.093] -- 0:00:17
867500 -- (-1831.018) (-1829.047) (-1819.482) [-1825.647] * [-1822.079] (-1825.277) (-1829.801) (-1832.077) -- 0:00:17
868000 -- (-1825.575) (-1835.531) [-1829.692] (-1826.780) * (-1824.182) [-1821.732] (-1837.061) (-1825.914) -- 0:00:17
868500 -- (-1824.825) (-1825.740) (-1837.408) [-1828.908] * (-1826.816) [-1819.962] (-1821.265) (-1826.181) -- 0:00:17
869000 -- (-1816.915) [-1834.347] (-1830.203) (-1824.507) * (-1826.874) (-1826.413) [-1823.341] (-1835.036) -- 0:00:17
869500 -- (-1825.915) [-1826.478] (-1834.268) (-1828.074) * (-1826.820) [-1822.352] (-1825.693) (-1837.202) -- 0:00:17
870000 -- (-1832.285) [-1823.568] (-1838.205) (-1824.707) * (-1821.322) (-1826.684) [-1831.629] (-1829.731) -- 0:00:17
Average standard deviation of split frequencies: 0.008013
870500 -- (-1825.770) (-1824.264) [-1827.269] (-1835.972) * (-1825.834) (-1827.551) [-1832.483] (-1829.269) -- 0:00:17
871000 -- (-1822.049) [-1829.078] (-1832.583) (-1824.792) * [-1823.182] (-1826.916) (-1823.158) (-1823.275) -- 0:00:17
871500 -- (-1827.298) (-1831.322) [-1836.747] (-1826.840) * (-1829.210) (-1822.677) [-1835.618] (-1831.572) -- 0:00:17
872000 -- [-1827.522] (-1845.691) (-1827.854) (-1824.181) * [-1824.809] (-1827.623) (-1828.454) (-1826.193) -- 0:00:17
872500 -- [-1826.284] (-1828.721) (-1830.836) (-1824.691) * (-1824.823) (-1821.595) [-1821.515] (-1837.771) -- 0:00:16
873000 -- (-1834.307) (-1819.378) (-1816.862) [-1829.020] * (-1827.525) (-1830.910) [-1822.033] (-1828.008) -- 0:00:16
873500 -- [-1826.932] (-1823.102) (-1830.701) (-1830.234) * [-1818.077] (-1830.442) (-1821.162) (-1820.500) -- 0:00:16
874000 -- [-1826.894] (-1836.600) (-1824.706) (-1830.875) * (-1826.515) (-1831.002) [-1834.783] (-1827.772) -- 0:00:16
874500 -- (-1825.442) (-1840.381) (-1826.156) [-1825.989] * (-1827.964) [-1826.922] (-1822.850) (-1838.287) -- 0:00:16
875000 -- (-1829.165) [-1829.983] (-1823.494) (-1828.364) * [-1822.541] (-1828.410) (-1821.767) (-1831.271) -- 0:00:16
Average standard deviation of split frequencies: 0.008359
875500 -- (-1827.016) [-1827.164] (-1825.443) (-1822.982) * (-1821.413) (-1839.726) (-1824.241) [-1825.555] -- 0:00:16
876000 -- (-1843.040) (-1832.666) [-1825.624] (-1834.411) * [-1820.691] (-1824.389) (-1821.768) (-1827.990) -- 0:00:16
876500 -- [-1834.586] (-1826.194) (-1818.771) (-1829.764) * [-1823.655] (-1827.222) (-1843.786) (-1824.979) -- 0:00:16
877000 -- (-1828.357) [-1821.080] (-1822.904) (-1836.129) * (-1825.301) [-1828.028] (-1833.980) (-1824.719) -- 0:00:16
877500 -- (-1823.941) (-1823.517) (-1829.546) [-1820.733] * [-1827.764] (-1825.111) (-1830.509) (-1821.497) -- 0:00:16
878000 -- (-1824.498) (-1826.941) [-1824.478] (-1827.629) * (-1829.162) [-1825.448] (-1830.721) (-1824.895) -- 0:00:16
878500 -- (-1824.681) [-1832.610] (-1833.039) (-1828.012) * (-1833.562) [-1824.520] (-1825.909) (-1827.758) -- 0:00:16
879000 -- (-1831.443) (-1835.129) (-1829.096) [-1827.714] * [-1826.818] (-1831.261) (-1833.970) (-1821.629) -- 0:00:16
879500 -- (-1830.227) (-1828.713) (-1821.612) [-1820.173] * (-1824.222) (-1822.646) (-1833.552) [-1823.114] -- 0:00:16
880000 -- (-1829.439) (-1825.780) (-1822.663) [-1830.680] * [-1823.374] (-1824.295) (-1824.876) (-1824.713) -- 0:00:15
Average standard deviation of split frequencies: 0.008457
880500 -- (-1829.199) [-1825.520] (-1821.085) (-1830.135) * (-1829.586) (-1820.154) (-1841.725) [-1822.996] -- 0:00:15
881000 -- (-1827.896) (-1830.614) (-1823.300) [-1821.185] * [-1826.079] (-1828.447) (-1838.141) (-1827.407) -- 0:00:15
881500 -- (-1834.071) (-1831.117) (-1829.082) [-1825.575] * (-1825.847) (-1828.686) (-1828.911) [-1825.885] -- 0:00:15
882000 -- (-1824.444) [-1825.681] (-1827.804) (-1829.229) * (-1823.420) [-1821.049] (-1853.102) (-1829.895) -- 0:00:15
882500 -- (-1832.139) (-1826.295) [-1819.433] (-1824.468) * (-1827.675) [-1826.572] (-1841.553) (-1827.442) -- 0:00:15
883000 -- (-1826.303) [-1818.751] (-1831.658) (-1825.636) * (-1836.077) (-1828.172) [-1826.678] (-1837.238) -- 0:00:15
883500 -- [-1829.079] (-1830.456) (-1827.631) (-1824.590) * (-1827.206) [-1821.876] (-1834.531) (-1827.003) -- 0:00:15
884000 -- (-1833.942) (-1823.830) [-1820.865] (-1828.836) * (-1835.363) [-1822.809] (-1828.124) (-1827.682) -- 0:00:15
884500 -- (-1834.028) [-1822.341] (-1823.121) (-1827.276) * (-1844.302) (-1828.753) (-1830.576) [-1824.228] -- 0:00:15
885000 -- (-1830.814) (-1822.394) (-1830.654) [-1826.670] * [-1822.925] (-1824.275) (-1846.587) (-1822.913) -- 0:00:15
Average standard deviation of split frequencies: 0.008548
885500 -- [-1825.876] (-1823.799) (-1825.275) (-1823.534) * [-1829.318] (-1823.124) (-1827.916) (-1837.143) -- 0:00:15
886000 -- (-1833.184) [-1821.618] (-1831.139) (-1827.680) * (-1827.286) (-1833.767) (-1833.465) [-1823.935] -- 0:00:15
886500 -- (-1824.033) (-1828.564) [-1822.247] (-1828.540) * (-1826.897) (-1836.292) (-1828.056) [-1821.972] -- 0:00:15
887000 -- (-1825.743) (-1824.588) [-1824.864] (-1822.835) * (-1826.237) (-1823.870) [-1821.602] (-1827.839) -- 0:00:15
887500 -- (-1829.464) [-1828.809] (-1823.894) (-1823.260) * [-1820.336] (-1830.447) (-1823.235) (-1831.563) -- 0:00:14
888000 -- (-1823.638) (-1822.379) [-1824.692] (-1828.810) * (-1827.253) (-1826.847) (-1832.733) [-1825.364] -- 0:00:14
888500 -- [-1820.799] (-1819.042) (-1826.555) (-1830.579) * [-1827.206] (-1831.953) (-1830.361) (-1823.447) -- 0:00:14
889000 -- (-1836.519) [-1826.207] (-1825.877) (-1825.977) * (-1824.873) (-1830.911) (-1831.861) [-1823.813] -- 0:00:14
889500 -- (-1827.030) [-1823.631] (-1826.787) (-1828.847) * (-1824.135) [-1820.947] (-1832.628) (-1830.727) -- 0:00:14
890000 -- (-1822.827) (-1825.878) [-1825.788] (-1826.448) * [-1824.959] (-1822.665) (-1832.796) (-1825.966) -- 0:00:14
Average standard deviation of split frequencies: 0.008398
890500 -- (-1821.436) (-1826.662) (-1840.250) [-1827.786] * (-1822.680) (-1819.305) [-1823.606] (-1828.906) -- 0:00:14
891000 -- [-1828.515] (-1830.454) (-1837.638) (-1826.641) * (-1825.924) (-1824.183) [-1827.522] (-1826.330) -- 0:00:14
891500 -- (-1823.590) [-1821.956] (-1823.027) (-1825.457) * (-1834.817) (-1827.040) (-1832.503) [-1832.991] -- 0:00:14
892000 -- (-1825.074) (-1828.287) [-1825.884] (-1835.036) * (-1828.319) (-1830.596) (-1828.482) [-1837.159] -- 0:00:14
892500 -- (-1831.362) [-1831.584] (-1829.718) (-1824.552) * (-1830.951) (-1840.464) [-1818.663] (-1824.477) -- 0:00:14
893000 -- (-1834.651) [-1832.365] (-1840.428) (-1826.117) * [-1833.096] (-1829.947) (-1823.840) (-1829.479) -- 0:00:14
893500 -- [-1832.130] (-1825.738) (-1825.592) (-1835.353) * [-1832.021] (-1833.946) (-1832.688) (-1830.502) -- 0:00:14
894000 -- (-1829.867) (-1830.660) [-1826.311] (-1834.919) * (-1828.532) (-1826.012) (-1828.668) [-1824.021] -- 0:00:14
894500 -- (-1829.328) (-1827.595) [-1827.486] (-1837.700) * (-1823.507) [-1820.322] (-1828.900) (-1827.368) -- 0:00:14
895000 -- (-1839.930) (-1835.078) (-1840.631) [-1824.492] * (-1825.283) [-1833.025] (-1826.576) (-1817.255) -- 0:00:13
Average standard deviation of split frequencies: 0.008593
895500 -- (-1829.872) (-1822.055) [-1823.549] (-1834.274) * (-1822.250) (-1832.554) [-1824.216] (-1827.305) -- 0:00:13
896000 -- [-1825.612] (-1821.272) (-1825.818) (-1830.318) * (-1829.298) [-1833.834] (-1825.890) (-1827.621) -- 0:00:13
896500 -- (-1824.680) (-1826.662) (-1827.753) [-1822.048] * (-1828.705) [-1822.821] (-1825.769) (-1835.228) -- 0:00:13
897000 -- (-1824.897) [-1829.360] (-1827.437) (-1825.763) * (-1826.256) [-1825.025] (-1824.804) (-1826.551) -- 0:00:13
897500 -- (-1826.964) (-1828.904) [-1825.392] (-1829.717) * (-1828.765) (-1823.849) (-1836.079) [-1825.733] -- 0:00:13
898000 -- [-1823.087] (-1817.254) (-1826.897) (-1827.795) * (-1830.247) [-1822.675] (-1827.319) (-1826.701) -- 0:00:13
898500 -- (-1828.206) (-1830.694) [-1818.567] (-1830.354) * (-1822.879) (-1830.203) (-1834.119) [-1822.614] -- 0:00:13
899000 -- (-1827.489) (-1828.034) [-1822.065] (-1825.622) * (-1830.576) [-1823.149] (-1824.801) (-1826.601) -- 0:00:13
899500 -- [-1824.760] (-1832.354) (-1825.303) (-1826.783) * (-1831.281) (-1830.181) [-1825.036] (-1838.766) -- 0:00:13
900000 -- [-1831.632] (-1830.995) (-1827.606) (-1822.922) * [-1832.266] (-1827.310) (-1824.202) (-1827.195) -- 0:00:13
Average standard deviation of split frequencies: 0.008793
900500 -- (-1840.967) (-1822.083) [-1826.038] (-1820.529) * (-1824.964) (-1824.776) (-1826.801) [-1828.394] -- 0:00:13
901000 -- (-1824.505) (-1825.318) (-1833.311) [-1825.757] * (-1828.745) [-1818.980] (-1822.944) (-1826.360) -- 0:00:13
901500 -- (-1823.200) [-1823.262] (-1828.387) (-1829.366) * (-1825.884) [-1830.385] (-1825.065) (-1822.995) -- 0:00:13
902000 -- [-1823.002] (-1827.349) (-1826.112) (-1831.528) * (-1827.620) (-1822.644) [-1822.887] (-1829.525) -- 0:00:13
902500 -- (-1828.155) (-1826.551) [-1823.431] (-1828.502) * (-1834.736) (-1839.258) [-1826.221] (-1824.942) -- 0:00:12
903000 -- (-1830.012) (-1832.355) [-1822.250] (-1832.024) * (-1828.087) (-1835.448) (-1823.970) [-1822.545] -- 0:00:12
903500 -- (-1831.091) [-1819.441] (-1835.918) (-1840.291) * [-1824.841] (-1827.103) (-1826.830) (-1831.846) -- 0:00:12
904000 -- [-1822.983] (-1819.730) (-1820.078) (-1823.306) * (-1837.476) (-1826.140) (-1827.946) [-1820.014] -- 0:00:12
904500 -- (-1831.632) (-1831.577) [-1819.737] (-1826.484) * (-1833.072) [-1820.264] (-1821.989) (-1824.963) -- 0:00:12
905000 -- (-1832.397) [-1834.673] (-1828.490) (-1832.759) * (-1832.291) (-1839.775) [-1829.402] (-1827.043) -- 0:00:12
Average standard deviation of split frequencies: 0.008707
905500 -- [-1821.164] (-1837.449) (-1826.293) (-1832.096) * (-1832.315) (-1827.441) (-1830.412) [-1826.637] -- 0:00:12
906000 -- (-1821.564) [-1822.687] (-1825.877) (-1822.376) * (-1825.555) (-1841.110) [-1830.258] (-1828.127) -- 0:00:12
906500 -- (-1821.595) [-1821.544] (-1826.590) (-1824.289) * (-1826.506) (-1818.833) (-1823.626) [-1830.431] -- 0:00:12
907000 -- (-1832.267) [-1821.906] (-1830.989) (-1825.502) * (-1825.125) (-1828.747) (-1827.486) [-1830.433] -- 0:00:12
907500 -- [-1823.816] (-1827.593) (-1825.250) (-1822.993) * (-1827.219) (-1828.824) [-1837.801] (-1835.709) -- 0:00:12
908000 -- (-1823.337) (-1828.223) (-1828.197) [-1822.297] * (-1843.043) (-1835.423) (-1822.519) [-1824.138] -- 0:00:12
908500 -- (-1823.824) (-1831.907) [-1831.988] (-1825.856) * (-1822.202) (-1830.748) (-1822.338) [-1825.850] -- 0:00:12
909000 -- [-1822.760] (-1826.300) (-1827.244) (-1827.440) * [-1819.396] (-1828.354) (-1828.436) (-1836.991) -- 0:00:12
909500 -- (-1825.109) [-1829.539] (-1822.785) (-1822.176) * (-1828.447) [-1825.390] (-1828.152) (-1825.410) -- 0:00:12
910000 -- (-1826.721) (-1828.268) (-1824.196) [-1821.516] * (-1830.489) [-1826.689] (-1834.432) (-1823.021) -- 0:00:11
Average standard deviation of split frequencies: 0.008524
910500 -- (-1831.134) (-1831.905) (-1823.439) [-1835.697] * (-1830.186) (-1829.172) (-1823.023) [-1825.242] -- 0:00:11
911000 -- (-1830.712) (-1825.889) (-1822.743) [-1827.718] * [-1825.615] (-1826.458) (-1829.944) (-1833.618) -- 0:00:11
911500 -- (-1827.110) [-1825.346] (-1823.710) (-1822.377) * (-1837.365) [-1823.287] (-1826.888) (-1829.150) -- 0:00:11
912000 -- (-1832.662) [-1823.115] (-1828.844) (-1827.844) * (-1826.219) [-1832.076] (-1828.376) (-1837.661) -- 0:00:11
912500 -- [-1830.575] (-1825.292) (-1820.968) (-1820.481) * (-1831.943) [-1826.839] (-1838.798) (-1832.702) -- 0:00:11
913000 -- (-1823.906) (-1825.778) [-1823.729] (-1826.108) * [-1820.415] (-1831.327) (-1823.672) (-1828.141) -- 0:00:11
913500 -- (-1824.978) (-1828.745) [-1829.094] (-1835.533) * [-1830.756] (-1826.478) (-1828.252) (-1832.498) -- 0:00:11
914000 -- (-1833.573) [-1826.839] (-1843.190) (-1822.696) * [-1820.327] (-1824.612) (-1836.259) (-1825.855) -- 0:00:11
914500 -- (-1823.845) [-1826.809] (-1828.634) (-1828.000) * (-1832.790) (-1822.309) [-1825.024] (-1820.132) -- 0:00:11
915000 -- (-1831.470) [-1825.048] (-1826.112) (-1829.847) * (-1826.352) [-1822.391] (-1832.814) (-1829.025) -- 0:00:11
Average standard deviation of split frequencies: 0.008268
915500 -- (-1819.863) (-1834.393) [-1831.856] (-1826.900) * (-1833.210) [-1833.817] (-1830.170) (-1823.137) -- 0:00:11
916000 -- (-1838.126) [-1829.779] (-1829.623) (-1826.638) * [-1824.794] (-1823.310) (-1826.022) (-1822.157) -- 0:00:11
916500 -- (-1830.172) (-1841.159) (-1823.773) [-1825.620] * (-1822.384) (-1826.831) (-1826.805) [-1821.363] -- 0:00:11
917000 -- [-1830.125] (-1827.103) (-1821.547) (-1832.666) * [-1824.203] (-1830.306) (-1818.818) (-1824.644) -- 0:00:11
917500 -- (-1830.341) (-1823.021) [-1821.542] (-1821.827) * (-1823.847) [-1820.529] (-1828.002) (-1832.862) -- 0:00:10
918000 -- (-1823.101) [-1819.415] (-1825.650) (-1826.809) * (-1824.906) [-1823.244] (-1830.695) (-1831.510) -- 0:00:10
918500 -- (-1826.979) [-1829.374] (-1826.400) (-1829.738) * [-1829.919] (-1827.164) (-1825.611) (-1821.960) -- 0:00:10
919000 -- (-1830.547) (-1836.608) (-1833.535) [-1824.010] * (-1826.217) (-1825.597) [-1823.936] (-1829.222) -- 0:00:10
919500 -- [-1824.746] (-1822.385) (-1824.792) (-1830.603) * (-1825.424) (-1831.350) (-1826.723) [-1836.903] -- 0:00:10
920000 -- [-1828.856] (-1827.812) (-1829.081) (-1825.438) * (-1825.135) (-1839.982) [-1830.144] (-1828.957) -- 0:00:10
Average standard deviation of split frequencies: 0.008739
920500 -- (-1830.618) [-1830.210] (-1831.127) (-1831.300) * [-1827.118] (-1822.055) (-1826.866) (-1831.590) -- 0:00:10
921000 -- (-1826.520) (-1828.550) [-1834.319] (-1820.862) * (-1825.927) [-1821.827] (-1830.164) (-1830.642) -- 0:00:10
921500 -- (-1824.457) [-1826.521] (-1827.258) (-1824.344) * (-1832.131) (-1824.138) (-1824.263) [-1823.041] -- 0:00:10
922000 -- (-1822.603) [-1817.680] (-1823.214) (-1832.042) * (-1822.021) [-1821.810] (-1830.349) (-1829.949) -- 0:00:10
922500 -- (-1825.624) (-1825.724) [-1821.181] (-1826.887) * (-1828.096) (-1824.455) (-1828.960) [-1818.980] -- 0:00:10
923000 -- [-1827.508] (-1832.842) (-1827.214) (-1827.699) * (-1826.821) (-1819.205) (-1831.507) [-1827.690] -- 0:00:10
923500 -- (-1824.439) (-1827.665) (-1824.661) [-1828.062] * (-1826.576) (-1830.906) (-1823.536) [-1828.226] -- 0:00:10
924000 -- [-1831.230] (-1826.194) (-1829.477) (-1826.734) * [-1826.363] (-1832.372) (-1831.294) (-1830.317) -- 0:00:10
924500 -- (-1825.888) (-1826.538) [-1825.597] (-1829.358) * (-1823.372) [-1831.002] (-1826.279) (-1833.678) -- 0:00:10
925000 -- [-1829.752] (-1828.416) (-1827.280) (-1822.245) * (-1826.878) (-1826.232) [-1823.815] (-1833.246) -- 0:00:09
Average standard deviation of split frequencies: 0.008349
925500 -- (-1828.499) (-1826.258) (-1844.612) [-1824.357] * (-1823.399) (-1827.943) [-1824.118] (-1827.983) -- 0:00:09
926000 -- (-1823.555) (-1822.858) [-1823.498] (-1836.321) * [-1831.181] (-1824.546) (-1825.376) (-1835.215) -- 0:00:09
926500 -- (-1833.761) (-1832.356) (-1826.080) [-1833.574] * [-1830.100] (-1831.879) (-1830.537) (-1836.554) -- 0:00:09
927000 -- [-1823.189] (-1827.197) (-1833.639) (-1823.388) * (-1826.350) (-1823.046) [-1825.860] (-1823.188) -- 0:00:09
927500 -- (-1822.684) (-1826.785) [-1820.399] (-1825.953) * [-1827.381] (-1828.455) (-1832.526) (-1824.813) -- 0:00:09
928000 -- (-1829.518) [-1818.882] (-1830.545) (-1827.747) * [-1828.599] (-1826.603) (-1828.092) (-1828.365) -- 0:00:09
928500 -- (-1829.115) (-1825.521) [-1821.563] (-1823.644) * [-1826.514] (-1821.543) (-1832.908) (-1826.998) -- 0:00:09
929000 -- (-1824.836) (-1830.468) (-1826.343) [-1823.764] * (-1827.396) (-1830.078) [-1819.261] (-1823.307) -- 0:00:09
929500 -- (-1823.306) (-1823.853) (-1827.786) [-1820.812] * (-1825.893) [-1823.831] (-1830.553) (-1821.574) -- 0:00:09
930000 -- (-1822.283) (-1827.104) [-1821.406] (-1827.534) * (-1827.777) (-1831.504) [-1824.367] (-1822.230) -- 0:00:09
Average standard deviation of split frequencies: 0.008273
930500 -- [-1825.212] (-1824.293) (-1834.841) (-1824.829) * (-1826.469) (-1832.025) [-1827.447] (-1828.998) -- 0:00:09
931000 -- (-1831.625) [-1833.783] (-1822.727) (-1826.534) * (-1828.990) [-1830.818] (-1822.217) (-1828.040) -- 0:00:09
931500 -- (-1830.929) [-1821.171] (-1826.262) (-1824.093) * (-1824.935) (-1829.855) (-1823.365) [-1828.211] -- 0:00:09
932000 -- (-1830.398) (-1824.911) [-1824.132] (-1831.869) * (-1825.494) [-1822.938] (-1823.941) (-1821.314) -- 0:00:09
932500 -- (-1832.536) (-1831.980) (-1821.738) [-1825.233] * (-1828.047) [-1829.606] (-1824.013) (-1831.944) -- 0:00:08
933000 -- (-1823.374) [-1826.588] (-1840.321) (-1822.298) * [-1822.252] (-1827.515) (-1821.101) (-1823.733) -- 0:00:08
933500 -- [-1826.743] (-1827.204) (-1825.813) (-1821.413) * (-1823.291) (-1831.284) [-1824.124] (-1832.088) -- 0:00:08
934000 -- [-1822.245] (-1835.856) (-1830.309) (-1825.649) * [-1824.837] (-1835.835) (-1821.927) (-1826.689) -- 0:00:08
934500 -- (-1829.682) (-1828.170) (-1830.691) [-1827.787] * [-1825.529] (-1828.743) (-1828.198) (-1830.027) -- 0:00:08
935000 -- (-1833.544) (-1822.573) (-1825.451) [-1818.285] * (-1827.745) (-1829.631) (-1827.810) [-1823.529] -- 0:00:08
Average standard deviation of split frequencies: 0.008629
935500 -- (-1840.340) [-1827.726] (-1830.476) (-1821.447) * [-1826.216] (-1833.681) (-1828.550) (-1828.650) -- 0:00:08
936000 -- [-1827.189] (-1827.946) (-1824.758) (-1824.820) * (-1832.235) (-1829.290) [-1825.361] (-1827.883) -- 0:00:08
936500 -- (-1822.739) [-1822.949] (-1831.677) (-1828.046) * [-1824.005] (-1831.235) (-1833.336) (-1828.009) -- 0:00:08
937000 -- (-1826.176) (-1832.794) [-1822.247] (-1831.200) * (-1821.306) (-1831.869) (-1829.284) [-1820.336] -- 0:00:08
937500 -- [-1828.232] (-1833.191) (-1825.039) (-1828.191) * [-1825.291] (-1828.300) (-1833.669) (-1823.316) -- 0:00:08
938000 -- (-1830.109) (-1830.975) [-1818.645] (-1829.454) * [-1826.909] (-1821.352) (-1833.193) (-1829.818) -- 0:00:08
938500 -- (-1827.038) (-1825.322) [-1822.913] (-1824.076) * (-1832.619) (-1826.068) (-1824.561) [-1822.987] -- 0:00:08
939000 -- (-1826.005) [-1830.634] (-1828.873) (-1826.865) * (-1847.081) [-1821.089] (-1832.472) (-1833.776) -- 0:00:08
939500 -- [-1820.487] (-1829.531) (-1826.813) (-1827.208) * (-1825.871) [-1822.979] (-1832.113) (-1834.054) -- 0:00:08
940000 -- (-1829.339) [-1830.811] (-1833.311) (-1829.108) * (-1828.118) (-1830.960) [-1828.137] (-1834.183) -- 0:00:07
Average standard deviation of split frequencies: 0.008887
940500 -- (-1823.386) (-1831.427) (-1829.799) [-1826.743] * (-1831.826) [-1828.339] (-1823.433) (-1838.569) -- 0:00:07
941000 -- (-1824.701) [-1826.782] (-1821.721) (-1829.474) * (-1827.650) (-1825.889) [-1832.359] (-1826.857) -- 0:00:07
941500 -- (-1826.764) [-1826.395] (-1826.345) (-1826.632) * [-1825.189] (-1826.362) (-1830.138) (-1828.281) -- 0:00:07
942000 -- (-1834.748) [-1826.496] (-1824.180) (-1828.968) * (-1826.339) (-1827.254) (-1829.198) [-1834.757] -- 0:00:07
942500 -- (-1829.426) (-1826.147) (-1819.807) [-1826.446] * (-1824.546) (-1830.110) [-1822.540] (-1830.140) -- 0:00:07
943000 -- (-1828.005) (-1834.891) [-1821.055] (-1824.914) * [-1828.030] (-1833.118) (-1827.048) (-1833.776) -- 0:00:07
943500 -- (-1836.055) (-1828.715) [-1821.127] (-1829.353) * [-1823.212] (-1826.593) (-1821.564) (-1828.042) -- 0:00:07
944000 -- (-1831.201) (-1839.455) [-1826.263] (-1833.627) * [-1826.282] (-1830.189) (-1831.706) (-1828.016) -- 0:00:07
944500 -- (-1832.446) [-1831.297] (-1823.067) (-1829.850) * (-1823.881) (-1829.369) [-1825.436] (-1830.802) -- 0:00:07
945000 -- (-1825.624) [-1827.066] (-1829.616) (-1826.187) * (-1829.369) (-1826.853) [-1828.013] (-1833.583) -- 0:00:07
Average standard deviation of split frequencies: 0.008970
945500 -- (-1821.330) [-1825.210] (-1829.362) (-1831.250) * (-1831.288) (-1830.391) [-1820.868] (-1825.845) -- 0:00:07
946000 -- [-1829.869] (-1831.591) (-1824.650) (-1828.497) * [-1828.574] (-1828.251) (-1826.811) (-1826.185) -- 0:00:07
946500 -- (-1824.156) (-1838.617) (-1825.231) [-1821.035] * (-1823.173) (-1819.311) (-1827.499) [-1826.625] -- 0:00:07
947000 -- [-1821.298] (-1829.241) (-1828.373) (-1827.895) * (-1823.831) [-1831.474] (-1829.929) (-1820.144) -- 0:00:07
947500 -- (-1831.392) (-1824.796) (-1824.666) [-1823.805] * [-1831.372] (-1826.278) (-1828.861) (-1822.373) -- 0:00:06
948000 -- (-1829.352) [-1825.641] (-1832.349) (-1824.992) * (-1844.127) (-1827.534) [-1824.205] (-1821.938) -- 0:00:06
948500 -- (-1829.011) (-1830.450) [-1826.656] (-1825.455) * (-1825.636) (-1829.988) (-1823.864) [-1835.772] -- 0:00:06
949000 -- [-1828.502] (-1832.409) (-1830.221) (-1819.459) * (-1833.697) (-1826.048) [-1835.836] (-1825.470) -- 0:00:06
949500 -- (-1831.730) (-1823.595) (-1833.929) [-1823.530] * [-1829.695] (-1824.066) (-1830.561) (-1827.840) -- 0:00:06
950000 -- (-1821.638) (-1823.048) (-1828.161) [-1826.657] * (-1825.041) [-1822.355] (-1838.303) (-1819.835) -- 0:00:06
Average standard deviation of split frequencies: 0.008959
950500 -- (-1830.701) [-1822.388] (-1826.877) (-1836.355) * (-1826.433) (-1823.960) (-1831.467) [-1820.877] -- 0:00:06
951000 -- (-1830.204) (-1825.019) (-1822.792) [-1825.084] * (-1821.133) [-1821.247] (-1831.857) (-1826.385) -- 0:00:06
951500 -- (-1826.443) (-1830.729) [-1824.718] (-1825.935) * (-1821.507) (-1827.066) [-1828.923] (-1839.194) -- 0:00:06
952000 -- (-1822.305) (-1830.173) [-1831.448] (-1832.253) * (-1822.461) (-1828.312) [-1831.551] (-1838.516) -- 0:00:06
952500 -- [-1821.287] (-1828.599) (-1824.400) (-1826.921) * [-1832.651] (-1830.040) (-1822.987) (-1827.495) -- 0:00:06
953000 -- (-1823.501) (-1822.718) (-1826.611) [-1830.934] * (-1823.088) (-1821.281) (-1830.508) [-1829.679] -- 0:00:06
953500 -- [-1822.930] (-1827.413) (-1823.149) (-1821.352) * (-1823.725) (-1833.654) (-1823.823) [-1825.696] -- 0:00:06
954000 -- [-1824.626] (-1825.695) (-1829.220) (-1830.246) * (-1824.194) (-1826.379) [-1828.380] (-1823.040) -- 0:00:06
954500 -- (-1826.341) [-1828.639] (-1838.705) (-1831.393) * (-1825.052) (-1833.293) (-1835.316) [-1830.504] -- 0:00:06
955000 -- (-1829.161) (-1825.098) (-1823.130) [-1825.089] * [-1821.563] (-1829.885) (-1831.673) (-1827.345) -- 0:00:05
Average standard deviation of split frequencies: 0.008514
955500 -- (-1825.902) (-1828.998) (-1827.948) [-1824.528] * [-1825.122] (-1822.834) (-1827.707) (-1827.941) -- 0:00:05
956000 -- (-1830.085) (-1825.283) (-1822.758) [-1827.866] * (-1825.253) (-1828.233) [-1825.631] (-1828.925) -- 0:00:05
956500 -- (-1832.774) (-1828.463) (-1827.921) [-1830.117] * (-1834.066) (-1828.998) [-1825.243] (-1832.895) -- 0:00:05
957000 -- (-1836.399) (-1826.374) (-1827.231) [-1824.228] * (-1829.627) (-1827.638) [-1823.924] (-1824.559) -- 0:00:05
957500 -- (-1823.189) [-1824.468] (-1826.679) (-1831.683) * (-1819.754) (-1829.366) [-1822.728] (-1831.247) -- 0:00:05
958000 -- (-1825.264) [-1821.120] (-1828.797) (-1835.296) * (-1827.129) (-1836.691) (-1825.726) [-1822.390] -- 0:00:05
958500 -- [-1822.685] (-1825.413) (-1823.700) (-1829.137) * (-1826.344) [-1825.316] (-1819.361) (-1828.979) -- 0:00:05
959000 -- (-1823.212) (-1828.225) [-1831.062] (-1830.785) * (-1823.421) [-1827.342] (-1827.405) (-1829.729) -- 0:00:05
959500 -- (-1830.810) (-1826.073) (-1829.477) [-1827.579] * (-1832.494) (-1843.002) (-1825.321) [-1819.245] -- 0:00:05
960000 -- (-1827.225) (-1826.463) [-1825.468] (-1821.640) * (-1830.942) (-1830.447) [-1818.471] (-1834.014) -- 0:00:05
Average standard deviation of split frequencies: 0.008800
960500 -- (-1831.978) (-1820.674) [-1826.292] (-1823.541) * (-1835.687) (-1842.064) (-1820.810) [-1821.872] -- 0:00:05
961000 -- (-1822.223) (-1823.598) [-1826.451] (-1832.663) * (-1828.114) [-1824.738] (-1818.729) (-1832.343) -- 0:00:05
961500 -- (-1820.601) [-1822.673] (-1825.693) (-1825.376) * (-1831.519) (-1826.759) (-1820.173) [-1823.453] -- 0:00:05
962000 -- [-1818.933] (-1830.922) (-1829.987) (-1826.906) * (-1830.368) (-1833.987) (-1824.184) [-1825.876] -- 0:00:05
962500 -- [-1825.105] (-1820.906) (-1831.613) (-1826.293) * [-1826.404] (-1830.206) (-1825.093) (-1832.218) -- 0:00:04
963000 -- (-1829.526) [-1822.581] (-1826.116) (-1826.673) * (-1823.880) (-1828.794) [-1826.502] (-1822.551) -- 0:00:04
963500 -- [-1825.241] (-1823.245) (-1828.287) (-1829.135) * (-1831.043) [-1837.077] (-1821.637) (-1834.813) -- 0:00:04
964000 -- (-1820.138) (-1830.071) (-1835.437) [-1829.082] * (-1826.120) (-1834.665) (-1826.919) [-1818.437] -- 0:00:04
964500 -- [-1832.424] (-1830.339) (-1832.341) (-1827.995) * (-1822.244) (-1833.193) [-1829.561] (-1823.267) -- 0:00:04
965000 -- [-1826.370] (-1825.154) (-1828.251) (-1836.177) * (-1831.393) (-1834.181) [-1826.669] (-1836.167) -- 0:00:04
Average standard deviation of split frequencies: 0.008263
965500 -- (-1831.413) [-1829.899] (-1831.179) (-1830.136) * (-1836.411) (-1839.788) [-1829.792] (-1822.866) -- 0:00:04
966000 -- (-1827.439) (-1837.047) [-1820.263] (-1825.127) * (-1833.087) (-1842.624) (-1829.096) [-1822.249] -- 0:00:04
966500 -- (-1828.311) (-1837.918) (-1826.302) [-1826.389] * [-1823.329] (-1834.203) (-1832.078) (-1821.174) -- 0:00:04
967000 -- [-1828.250] (-1828.564) (-1824.986) (-1823.851) * [-1829.863] (-1838.894) (-1827.282) (-1829.112) -- 0:00:04
967500 -- (-1831.592) (-1829.908) [-1822.883] (-1824.635) * (-1831.307) (-1828.494) [-1824.078] (-1827.098) -- 0:00:04
968000 -- (-1827.128) [-1825.942] (-1824.501) (-1825.779) * (-1829.047) [-1830.803] (-1823.478) (-1820.003) -- 0:00:04
968500 -- (-1841.066) [-1830.112] (-1825.219) (-1828.961) * (-1827.886) [-1821.542] (-1829.673) (-1819.773) -- 0:00:04
969000 -- (-1825.977) (-1832.290) [-1820.465] (-1834.989) * (-1823.170) (-1826.327) [-1827.261] (-1827.668) -- 0:00:04
969500 -- [-1827.833] (-1829.043) (-1833.189) (-1826.624) * (-1832.780) (-1821.371) [-1824.399] (-1828.246) -- 0:00:04
970000 -- (-1838.472) (-1823.816) [-1828.221] (-1830.722) * [-1825.138] (-1823.593) (-1832.545) (-1831.434) -- 0:00:03
Average standard deviation of split frequencies: 0.008418
970500 -- (-1827.880) [-1825.156] (-1824.058) (-1826.211) * (-1833.318) (-1821.718) (-1822.470) [-1829.194] -- 0:00:03
971000 -- (-1824.734) (-1829.345) [-1823.553] (-1823.291) * [-1826.596] (-1824.183) (-1828.590) (-1824.812) -- 0:00:03
971500 -- (-1833.488) (-1828.321) (-1825.357) [-1821.244] * (-1828.812) (-1836.093) [-1826.490] (-1822.494) -- 0:00:03
972000 -- [-1832.420] (-1828.516) (-1831.487) (-1827.942) * (-1832.934) [-1833.644] (-1823.340) (-1826.648) -- 0:00:03
972500 -- (-1828.880) (-1833.342) [-1826.799] (-1828.107) * (-1829.926) [-1825.431] (-1835.047) (-1827.836) -- 0:00:03
973000 -- (-1829.838) (-1829.230) (-1829.744) [-1821.439] * (-1826.864) (-1832.836) [-1822.370] (-1832.688) -- 0:00:03
973500 -- (-1823.473) (-1821.640) (-1828.425) [-1824.325] * (-1830.403) (-1829.676) [-1825.874] (-1825.430) -- 0:00:03
974000 -- (-1832.793) [-1827.921] (-1827.193) (-1829.018) * (-1831.235) [-1816.820] (-1823.556) (-1831.070) -- 0:00:03
974500 -- (-1827.231) [-1824.610] (-1823.540) (-1826.220) * (-1832.938) (-1825.502) (-1821.330) [-1821.221] -- 0:00:03
975000 -- [-1829.915] (-1830.468) (-1824.058) (-1831.866) * (-1824.298) (-1822.565) [-1825.519] (-1833.222) -- 0:00:03
Average standard deviation of split frequencies: 0.008340
975500 -- (-1830.760) (-1828.496) (-1824.243) [-1823.068] * [-1826.355] (-1837.084) (-1830.332) (-1826.897) -- 0:00:03
976000 -- (-1831.754) [-1827.014] (-1823.281) (-1836.191) * [-1825.683] (-1832.670) (-1825.418) (-1822.335) -- 0:00:03
976500 -- (-1838.586) (-1833.058) (-1824.416) [-1827.706] * [-1823.525] (-1825.331) (-1832.997) (-1821.417) -- 0:00:03
977000 -- [-1828.238] (-1831.703) (-1824.601) (-1824.804) * (-1828.924) (-1820.161) (-1822.947) [-1826.067] -- 0:00:03
977500 -- (-1824.852) (-1825.676) (-1826.009) [-1827.517] * (-1828.026) [-1825.001] (-1828.764) (-1827.850) -- 0:00:02
978000 -- (-1831.424) [-1828.809] (-1826.105) (-1824.969) * (-1831.492) [-1825.521] (-1831.771) (-1839.496) -- 0:00:02
978500 -- (-1829.264) (-1836.324) [-1824.842] (-1831.914) * (-1831.809) [-1824.419] (-1832.665) (-1824.699) -- 0:00:02
979000 -- (-1827.363) (-1835.623) [-1823.232] (-1819.657) * [-1825.647] (-1823.272) (-1835.525) (-1822.504) -- 0:00:02
979500 -- (-1827.247) (-1825.368) (-1823.346) [-1819.714] * (-1825.092) (-1828.429) [-1821.181] (-1827.152) -- 0:00:02
980000 -- (-1833.400) (-1827.918) (-1828.090) [-1826.041] * (-1824.334) (-1828.607) (-1827.860) [-1823.175] -- 0:00:02
Average standard deviation of split frequencies: 0.008172
980500 -- (-1830.392) [-1830.797] (-1831.594) (-1830.238) * [-1824.623] (-1826.086) (-1825.727) (-1829.086) -- 0:00:02
981000 -- [-1827.734] (-1830.136) (-1822.521) (-1832.456) * (-1827.034) (-1831.243) [-1824.732] (-1830.196) -- 0:00:02
981500 -- (-1827.287) [-1830.196] (-1827.049) (-1828.982) * (-1836.203) (-1823.915) [-1822.712] (-1831.520) -- 0:00:02
982000 -- (-1827.318) (-1830.387) [-1826.593] (-1822.351) * (-1839.825) (-1822.852) (-1828.861) [-1820.854] -- 0:00:02
982500 -- [-1821.231] (-1821.251) (-1827.589) (-1830.419) * (-1822.486) (-1827.086) [-1830.547] (-1820.461) -- 0:00:02
983000 -- (-1826.773) (-1828.046) [-1822.082] (-1825.703) * (-1832.408) (-1831.652) (-1825.065) [-1824.149] -- 0:00:02
983500 -- (-1826.952) (-1831.869) [-1822.519] (-1824.026) * (-1821.903) (-1831.906) [-1829.637] (-1832.241) -- 0:00:02
984000 -- (-1828.631) (-1831.542) [-1821.368] (-1832.982) * (-1829.638) [-1828.016] (-1826.953) (-1826.734) -- 0:00:02
984500 -- (-1828.808) (-1824.570) (-1823.472) [-1829.857] * (-1832.711) (-1825.442) (-1830.043) [-1824.430] -- 0:00:02
985000 -- (-1830.849) [-1832.367] (-1823.967) (-1825.959) * (-1830.504) (-1827.570) (-1828.304) [-1830.433] -- 0:00:01
Average standard deviation of split frequencies: 0.007745
985500 -- (-1823.889) [-1827.170] (-1831.977) (-1834.226) * (-1828.183) (-1825.073) (-1826.350) [-1821.817] -- 0:00:01
986000 -- (-1825.981) (-1828.453) [-1824.889] (-1833.106) * [-1828.924] (-1827.628) (-1831.920) (-1834.647) -- 0:00:01
986500 -- [-1834.221] (-1827.343) (-1835.471) (-1828.022) * (-1829.617) (-1826.508) (-1823.527) [-1822.460] -- 0:00:01
987000 -- [-1824.743] (-1825.352) (-1832.252) (-1831.665) * (-1826.795) [-1826.918] (-1828.048) (-1825.909) -- 0:00:01
987500 -- [-1823.929] (-1822.498) (-1826.639) (-1827.406) * (-1821.025) (-1826.872) (-1833.248) [-1824.728] -- 0:00:01
988000 -- (-1823.604) (-1826.612) [-1826.340] (-1822.028) * (-1833.859) (-1818.428) (-1832.458) [-1831.116] -- 0:00:01
988500 -- (-1819.845) (-1830.087) [-1824.506] (-1823.587) * [-1823.363] (-1827.959) (-1828.720) (-1825.232) -- 0:00:01
989000 -- [-1830.001] (-1828.027) (-1824.740) (-1826.461) * (-1824.299) (-1826.974) [-1829.219] (-1830.568) -- 0:00:01
989500 -- (-1822.157) [-1823.266] (-1831.879) (-1826.682) * [-1826.108] (-1827.063) (-1824.783) (-1825.379) -- 0:00:01
990000 -- (-1830.702) (-1841.469) (-1829.145) [-1825.537] * [-1821.128] (-1830.567) (-1828.806) (-1823.182) -- 0:00:01
Average standard deviation of split frequencies: 0.007899
990500 -- [-1827.852] (-1830.925) (-1826.596) (-1827.875) * (-1827.222) (-1833.535) [-1832.710] (-1822.877) -- 0:00:01
991000 -- (-1827.862) [-1824.223] (-1831.208) (-1831.952) * (-1824.972) (-1829.690) (-1836.337) [-1824.925] -- 0:00:01
991500 -- [-1832.237] (-1825.973) (-1825.100) (-1829.607) * (-1825.704) (-1827.006) [-1829.469] (-1825.808) -- 0:00:01
992000 -- (-1830.699) (-1833.995) (-1826.294) [-1820.312] * (-1825.894) [-1823.277] (-1828.614) (-1832.360) -- 0:00:01
992500 -- (-1828.096) (-1828.212) (-1833.245) [-1827.843] * [-1825.843] (-1830.504) (-1823.831) (-1830.372) -- 0:00:00
993000 -- (-1826.122) (-1822.128) (-1821.361) [-1824.551] * [-1828.591] (-1834.675) (-1829.991) (-1824.937) -- 0:00:00
993500 -- (-1826.101) (-1823.647) [-1823.988] (-1824.739) * (-1819.609) (-1832.651) (-1832.200) [-1824.335] -- 0:00:00
994000 -- [-1820.109] (-1831.756) (-1828.062) (-1823.611) * (-1831.996) (-1825.189) (-1825.491) [-1821.640] -- 0:00:00
994500 -- (-1823.900) (-1825.698) (-1826.551) [-1824.537] * (-1834.741) (-1824.371) [-1820.444] (-1826.710) -- 0:00:00
995000 -- [-1820.153] (-1833.184) (-1825.710) (-1823.077) * (-1838.686) (-1826.140) (-1826.410) [-1832.112] -- 0:00:00
Average standard deviation of split frequencies: 0.007920
995500 -- [-1825.474] (-1838.529) (-1830.399) (-1825.699) * (-1830.347) (-1836.186) [-1832.987] (-1828.270) -- 0:00:00
996000 -- [-1823.118] (-1828.358) (-1828.386) (-1839.313) * [-1827.109] (-1827.726) (-1824.597) (-1828.781) -- 0:00:00
996500 -- (-1829.416) [-1826.356] (-1828.662) (-1837.533) * [-1824.205] (-1831.137) (-1830.387) (-1824.253) -- 0:00:00
997000 -- (-1818.344) (-1827.344) (-1839.063) [-1825.046] * (-1825.135) (-1824.638) (-1818.988) [-1823.062] -- 0:00:00
997500 -- (-1824.821) (-1831.729) (-1835.897) [-1824.114] * [-1825.676] (-1825.525) (-1832.667) (-1821.313) -- 0:00:00
998000 -- (-1827.317) [-1824.700] (-1832.159) (-1827.709) * (-1824.218) (-1821.937) (-1824.182) [-1831.198] -- 0:00:00
998500 -- (-1826.550) (-1841.190) [-1827.478] (-1820.607) * (-1826.091) [-1830.059] (-1833.656) (-1826.115) -- 0:00:00
999000 -- (-1826.911) (-1834.287) (-1827.951) [-1823.091] * (-1825.628) (-1822.582) [-1822.777] (-1826.389) -- 0:00:00
999500 -- [-1827.895] (-1842.860) (-1827.803) (-1830.632) * (-1821.816) (-1824.379) (-1822.288) [-1820.480] -- 0:00:00
1000000 -- (-1821.217) (-1823.918) (-1831.509) [-1823.723] * (-1826.039) (-1830.089) [-1823.399] (-1817.572) -- 0:00:00
Average standard deviation of split frequencies: 0.007914
Analysis completed in 2 mins 13 seconds
Analysis used 132.29 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1815.07
Likelihood of best state for "cold" chain of run 2 was -1814.95
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
70.5 % ( 61 %) Dirichlet(Revmat{all})
85.2 % ( 76 %) Slider(Revmat{all})
24.6 % ( 22 %) Dirichlet(Pi{all})
26.1 % ( 26 %) Slider(Pi{all})
49.7 % ( 18 %) Multiplier(Alpha{1,2})
51.6 % ( 23 %) Multiplier(Alpha{3})
60.0 % ( 37 %) Slider(Pinvar{all})
98.6 % ( 95 %) ExtSPR(Tau{all},V{all})
69.9 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
88.5 % ( 89 %) ParsSPR(Tau{all},V{all})
27.8 % ( 23 %) Multiplier(V{all})
85.4 % ( 82 %) Nodeslider(V{all})
25.9 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
69.7 % ( 67 %) Dirichlet(Revmat{all})
85.4 % ( 75 %) Slider(Revmat{all})
24.5 % ( 22 %) Dirichlet(Pi{all})
26.6 % ( 31 %) Slider(Pi{all})
49.7 % ( 27 %) Multiplier(Alpha{1,2})
51.1 % ( 29 %) Multiplier(Alpha{3})
61.0 % ( 35 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.0 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
88.6 % ( 91 %) ParsSPR(Tau{all},V{all})
27.8 % ( 24 %) Multiplier(V{all})
85.3 % ( 80 %) Nodeslider(V{all})
25.7 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166285 0.82 0.66
3 | 166878 166449 0.83
4 | 166547 166468 167373
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166510 0.82 0.65
3 | 165834 166870 0.83
4 | 166737 167442 166607
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1824.04
| 2 2 |
| 2 2 2 1 |
| 2 1 2 1 2 1 |
| 2 1 1 2 11 2 2 1 1 2 1|
|1 21 2 12 2 1 |
| 1 1 1 1 * 2 11 2 |
| 11 2 2 2 1 1 21 2 2 21 12 2 1 22 |
|2 *1 1 22 1 * 2 1 1 1 1 |
| 1 2 1 1 1 1 2 2 1 2 2 2|
| 12 1 2 1 1 2 2 1 |
| 2 11 * 2 2 |
| 2 2 2 2 1 1 1 |
| 2 2 1 |
| 1 2 2 |
| 12 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1827.73
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1821.45 -1837.26
2 -1821.18 -1834.78
--------------------------------------
TOTAL -1821.31 -1836.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.075611 0.041517 0.728973 1.495927 1.050043 1363.84 1377.83 1.000
r(A<->C){all} 0.220573 0.004737 0.086255 0.352166 0.215889 526.49 593.26 1.000
r(A<->G){all} 0.220120 0.004843 0.086182 0.354644 0.214568 601.67 637.31 1.001
r(A<->T){all} 0.089126 0.004753 0.000048 0.223559 0.073924 290.35 391.34 1.000
r(C<->G){all} 0.073526 0.002235 0.000046 0.163571 0.066036 550.33 654.35 1.000
r(C<->T){all} 0.166220 0.005205 0.035200 0.314279 0.162064 410.67 499.30 1.001
r(G<->T){all} 0.230435 0.006408 0.092269 0.402312 0.225563 374.74 400.40 1.000
pi(A){all} 0.244420 0.000145 0.219929 0.266937 0.244614 985.66 1157.76 1.000
pi(C){all} 0.300127 0.000177 0.274417 0.326478 0.300092 1101.08 1242.17 1.000
pi(G){all} 0.286067 0.000164 0.261366 0.311366 0.285865 1186.07 1313.16 1.000
pi(T){all} 0.169386 0.000114 0.148109 0.189948 0.169017 1300.49 1400.74 1.001
alpha{1,2} 1.133128 0.283218 0.368908 2.176399 1.011069 1363.10 1432.05 1.000
alpha{3} 1.683434 0.486166 0.619892 3.132187 1.569391 1501.00 1501.00 1.000
pinvar{all} 0.062227 0.002937 0.000022 0.169056 0.047610 1386.11 1425.45 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- .**.**
9 -- .***.*
10 -- ..*..*
11 -- .**...
12 -- ...*.*
13 -- .*.***
14 -- ...**.
15 -- ....**
16 -- ..*.*.
17 -- .****.
18 -- .*..*.
19 -- .*.*..
20 -- ..**..
21 -- ..****
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 479 0.159560 0.008951 0.153231 0.165889 2
8 466 0.155230 0.002827 0.153231 0.157229 2
9 453 0.150899 0.002355 0.149234 0.152565 2
10 441 0.146902 0.004240 0.143904 0.149900 2
11 434 0.144570 0.005653 0.140573 0.148568 2
12 430 0.143238 0.007537 0.137908 0.148568 2
13 429 0.142905 0.008951 0.136576 0.149234 2
14 428 0.142572 0.009422 0.135909 0.149234 2
15 425 0.141572 0.000471 0.141239 0.141905 2
16 424 0.141239 0.005653 0.137242 0.145237 2
17 420 0.139907 0.009422 0.133245 0.146569 2
18 419 0.139574 0.020257 0.125250 0.153897 2
19 415 0.138241 0.013662 0.128581 0.147901 2
20 406 0.135243 0.013191 0.125916 0.144570 2
21 397 0.132245 0.006124 0.127915 0.136576 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.000890 0.000001 0.000000 0.002716 0.000608 1.000 2
length{all}[2] 0.000904 0.000001 0.000000 0.002687 0.000623 1.000 2
length{all}[3] 0.000892 0.000001 0.000000 0.002670 0.000618 1.000 2
length{all}[4] 0.000893 0.000001 0.000000 0.002573 0.000630 1.000 2
length{all}[5] 1.068465 0.041535 0.707764 1.474604 1.043191 1.000 2
length{all}[6] 0.000889 0.000001 0.000001 0.002726 0.000599 1.000 2
length{all}[7] 0.000935 0.000001 0.000002 0.002778 0.000641 0.998 2
length{all}[8] 0.000925 0.000001 0.000004 0.002790 0.000684 0.998 2
length{all}[9] 0.000875 0.000001 0.000003 0.002519 0.000674 0.999 2
length{all}[10] 0.000902 0.000001 0.000001 0.002481 0.000649 1.009 2
length{all}[11] 0.000835 0.000001 0.000000 0.002570 0.000572 1.005 2
length{all}[12] 0.000912 0.000001 0.000002 0.002845 0.000604 1.006 2
length{all}[13] 0.000881 0.000001 0.000001 0.002586 0.000637 1.002 2
length{all}[14] 0.000946 0.000001 0.000002 0.002965 0.000652 1.003 2
length{all}[15] 0.000937 0.000001 0.000002 0.002827 0.000674 1.002 2
length{all}[16] 0.000910 0.000001 0.000003 0.002778 0.000631 0.998 2
length{all}[17] 0.000938 0.000001 0.000001 0.002805 0.000714 0.998 2
length{all}[18] 0.000860 0.000001 0.000002 0.002814 0.000554 1.000 2
length{all}[19] 0.000868 0.000001 0.000001 0.002502 0.000610 1.002 2
length{all}[20] 0.000885 0.000001 0.000000 0.003175 0.000571 0.999 2
length{all}[21] 0.000915 0.000001 0.000002 0.002830 0.000631 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007914
Maximum standard deviation of split frequencies = 0.020257
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/ C1 (1)
|
| C2 (2)
|
| C3 (3)
+
| C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\ C6 (6)
|------------| 0.200 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1143
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
36 ambiguity characters in seq. 1
36 ambiguity characters in seq. 2
36 ambiguity characters in seq. 3
36 ambiguity characters in seq. 4
894 ambiguity characters in seq. 5
36 ambiguity characters in seq. 6
310 sites are removed. 16 17 23 24 25 26 27 28 29 45 46 47 48 53 70 71 72 73 74 75 76 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381
Sequences read..
Counting site patterns.. 0:00
Compressing, 68 patterns at 71 / 71 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 68 patterns at 71 / 71 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
66368 bytes for conP
5984 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 53
0.080987 0.107130 0.098370 0.066995 0.107871 0.057219 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -789.356047
Iterating by ming2
Initial: fx= 789.356047
x= 0.08099 0.10713 0.09837 0.06700 0.10787 0.05722 0.30000 1.30000
1 h-m-p 0.0000 0.0008 913.7243 ++++ 592.353942 m 0.0008 15 | 1/8
2 h-m-p 0.0000 0.0001 149.7016 ++ 589.396904 m 0.0001 26 | 2/8
3 h-m-p 0.0000 0.0000 18601.7539 ++ 586.084953 m 0.0000 37 | 3/8
4 h-m-p 0.0000 0.0002 161.0674 ++ 583.366138 m 0.0002 48 | 4/8
5 h-m-p 0.0000 0.0000 4226.6874 ++ 582.636177 m 0.0000 59 | 5/8
6 h-m-p 0.0005 0.2142 6.0220 ++++YYCCCC 579.227586 5 0.1002 82 | 5/8
7 h-m-p 1.6000 8.0000 0.3242 +YCCC 556.080560 3 7.0570 99 | 5/8
8 h-m-p 0.6393 3.1965 0.4465 YCYCYCC 550.956190 6 1.7314 123 | 5/8
9 h-m-p 1.6000 8.0000 0.0833 ++ 542.454835 m 8.0000 137 | 5/8
10 h-m-p 0.4766 2.3831 0.5988 YCYCCCC 538.501292 6 1.1693 161 | 5/8
11 h-m-p 1.5012 8.0000 0.4664 YYCCCCC 536.147778 6 1.4584 185 | 5/8
12 h-m-p 1.6000 8.0000 0.1962 +YCYYCCC 533.916881 6 5.2296 210 | 5/8
13 h-m-p 1.6000 8.0000 0.2639 CYCC 533.345759 3 1.7755 229 | 5/8
14 h-m-p 0.3498 1.7492 1.0750 CYYYYCCCCC 531.979229 9 0.8809 257 | 5/8
15 h-m-p 0.4721 2.3603 0.7022 CCCCC 531.749098 4 0.5599 276 | 5/8
16 h-m-p 1.6000 8.0000 0.2165 -CYC 531.736059 2 0.1382 294 | 5/8
17 h-m-p 1.6000 8.0000 0.0115 YC 531.735899 1 0.8169 309 | 5/8
18 h-m-p 1.6000 8.0000 0.0002 ++ 531.735896 m 8.0000 323 | 5/8
19 h-m-p 0.1084 8.0000 0.0184 ++YC 531.735841 1 3.0673 340 | 5/8
20 h-m-p 0.4650 8.0000 0.1213 CC 531.735780 1 0.5149 356 | 5/8
21 h-m-p 0.5746 8.0000 0.1087 C 531.735658 0 0.5746 370 | 5/8
22 h-m-p 0.3489 8.0000 0.1790 CYC 531.735326 2 0.6075 387 | 5/8
23 h-m-p 1.2048 8.0000 0.0902 CYC 531.733521 2 2.1327 404 | 5/8
24 h-m-p 1.5888 8.0000 0.1211 CCCC 531.725366 3 2.3390 424 | 5/8
25 h-m-p 1.6000 8.0000 0.1084 C 531.724671 0 0.3867 438 | 5/8
26 h-m-p 0.5074 8.0000 0.0826 CC 531.723751 1 0.8218 454 | 5/8
27 h-m-p 1.6000 8.0000 0.0187 C 531.723649 0 1.6531 468 | 5/8
28 h-m-p 1.6000 8.0000 0.0033 Y 531.723646 0 0.8247 482 | 5/8
29 h-m-p 1.6000 8.0000 0.0005 Y 531.723646 0 1.0313 496 | 5/8
30 h-m-p 1.6000 8.0000 0.0000 Y 531.723646 0 0.8879 510 | 5/8
31 h-m-p 1.6000 8.0000 0.0000 C 531.723646 0 1.3077 524 | 5/8
32 h-m-p 1.6000 8.0000 0.0000 ------C 531.723646 0 0.0001 544
Out..
lnL = -531.723646
545 lfun, 545 eigenQcodon, 3270 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 53
0.012138 0.088948 0.044329 0.045957 0.049619 0.060367 1.141203 0.842919 0.426576
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 7.965326
np = 9
lnL0 = -832.443593
Iterating by ming2
Initial: fx= 832.443593
x= 0.01214 0.08895 0.04433 0.04596 0.04962 0.06037 1.14120 0.84292 0.42658
1 h-m-p 0.0000 0.0002 1999.6845 ++ 643.069815 m 0.0002 14 | 1/9
2 h-m-p 0.0001 0.0004 150.1622 ++ 633.333199 m 0.0004 26 | 2/9
3 h-m-p 0.0000 0.0000 561.4675 ++ 632.963152 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 173.5367 ++ 630.964469 m 0.0001 50 | 4/9
5 h-m-p 0.0001 0.0004 67.4069 ++ 628.798193 m 0.0004 62 | 5/9
6 h-m-p 0.0137 6.8528 0.7004 +++++ 616.607317 m 6.8528 77 | 5/9
7 h-m-p -0.0000 -0.0000 3.6361
h-m-p: -4.26650355e-17 -2.13325178e-16 3.63610287e+00 616.607317
.. | 5/9
8 h-m-p 0.0004 0.1851 111.6254 +++YCYCCCC 539.650281 6 0.0434 116 | 5/9
9 h-m-p 0.0137 0.0684 9.2131 +YYCYCYCCC 529.743937 8 0.0585 141 | 5/9
10 h-m-p 0.0022 0.0110 7.7458 YCCC 529.718184 3 0.0012 158 | 5/9
11 h-m-p 0.0069 1.6177 1.3842 +++CYCCCC 528.432085 5 0.6750 182 | 5/9
12 h-m-p 0.3164 1.5818 2.9162 +YYYYYYCCCC 525.023783 10 1.2722 208 | 5/9
13 h-m-p 1.6000 8.0000 0.1240 YCCC 524.958179 3 0.9597 225 | 5/9
14 h-m-p 1.1772 8.0000 0.1011 CC 524.957639 1 0.2586 243 | 5/9
15 h-m-p 1.6000 8.0000 0.0039 YC 524.957402 1 1.2305 260 | 5/9
16 h-m-p 1.1136 8.0000 0.0043 ++ 524.955550 m 8.0000 276 | 5/9
17 h-m-p 0.1642 8.0000 0.2104 +CCC 524.950824 2 0.8734 297 | 5/9
18 h-m-p 1.6000 8.0000 0.0010 Y 524.950819 0 1.0430 313 | 5/9
19 h-m-p 1.6000 8.0000 0.0002 Y 524.950819 0 0.9168 329 | 5/9
20 h-m-p 1.6000 8.0000 0.0000 Y 524.950819 0 1.0536 345 | 5/9
21 h-m-p 1.6000 8.0000 0.0000 ----------N 524.950819 0 0.0000 371
Out..
lnL = -524.950819
372 lfun, 1116 eigenQcodon, 4464 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 53
initial w for M2:NSpselection reset.
0.061074 0.071216 0.025237 0.102397 0.055507 0.019749 0.985753 1.339790 0.480805 0.343768 2.607385
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.971612
np = 11
lnL0 = -816.731602
Iterating by ming2
Initial: fx= 816.731602
x= 0.06107 0.07122 0.02524 0.10240 0.05551 0.01975 0.98575 1.33979 0.48080 0.34377 2.60739
1 h-m-p 0.0000 0.0002 1772.6412 +++ 629.845585 m 0.0002 17 | 1/11
2 h-m-p 0.0000 0.0001 186.6866 ++ 627.819896 m 0.0001 31 | 2/11
3 h-m-p 0.0001 0.0013 96.3573 ++ 618.767802 m 0.0013 45 | 3/11
4 h-m-p 0.0001 0.0003 46.4520 ++ 616.832910 m 0.0003 59 | 4/11
5 h-m-p 0.0018 0.0339 6.0791 +++ 614.053513 m 0.0339 74 | 5/11
6 h-m-p 0.0660 0.3300 2.7144 +CYYCC 607.068215 4 0.2890 95 | 5/11
7 h-m-p 0.0275 0.1377 2.0935 ++ 605.238975 m 0.1377 109 | 5/11
8 h-m-p 0.0641 1.2553 4.4953 ++YCYCCC 597.467363 5 0.6002 133 | 5/11
9 h-m-p 0.5023 2.5115 2.1519 ++ 564.284990 m 2.5115 147 | 5/11
10 h-m-p 0.0000 0.0000 1.6053
h-m-p: 0.00000000e+00 0.00000000e+00 1.60527713e+00 564.284990
.. | 5/11
11 h-m-p 0.0007 0.3363 50.7005 +++YYYYCCC 532.866865 6 0.0475 183 | 5/11
12 h-m-p 0.0484 0.2421 3.5639 +YYYYYCCCCC 528.173515 9 0.1945 211 | 5/11
13 h-m-p 0.0133 0.0663 3.7318 YYCC 528.131318 3 0.0093 229 | 5/11
14 h-m-p 0.0319 1.0975 1.0921 ++YCCC 527.015842 3 0.7006 250 | 5/11
15 h-m-p 0.8088 4.0440 0.5282 CYCCC 526.613515 4 1.2921 271 | 5/11
16 h-m-p 0.3423 8.0000 1.9942 +CYC 525.317135 2 1.4595 295 | 5/11
17 h-m-p 0.4186 2.0929 0.5016 CCCC 525.205126 3 0.5842 315 | 5/11
18 h-m-p 0.4312 8.0000 0.6796 YCCC 525.083500 3 0.9114 340 | 5/11
19 h-m-p 0.8581 8.0000 0.7219 YC 524.972588 1 1.6621 361 | 5/11
20 h-m-p 1.6000 8.0000 0.2680 YCC 524.953962 2 2.5338 384 | 5/11
21 h-m-p 1.6000 8.0000 0.1742 YC 524.950559 1 1.0379 405 | 5/11
22 h-m-p 1.6000 8.0000 0.0659 YC 524.949897 1 0.9820 426 | 5/11
23 h-m-p 1.6000 8.0000 0.0056 Y 524.949846 0 1.2714 446 | 5/11
24 h-m-p 1.6000 8.0000 0.0038 C 524.949845 0 2.5408 466 | 5/11
25 h-m-p 1.6000 8.0000 0.0022 ++ 524.949835 m 8.0000 486 | 5/11
26 h-m-p 0.0351 8.0000 0.4957 ++++ 524.948524 m 8.0000 508 | 5/11
27 h-m-p 1.6000 8.0000 1.0105 YCYC 524.946487 3 0.8237 532 | 5/11
28 h-m-p 0.1268 8.0000 6.5645 CYY 524.931681 2 0.3490 550 | 5/11
29 h-m-p 0.5350 8.0000 4.2823 YCCC 524.930143 3 0.0840 569 | 5/11
30 h-m-p 0.3368 8.0000 1.0681 ++YYCYCCC 523.734341 6 4.6694 594 | 5/11
31 h-m-p 0.3926 2.7285 12.7033 --YC 523.733276 1 0.0031 611 | 5/11
32 h-m-p 0.0284 7.1704 1.3941 ++YCCC 523.527746 3 0.9455 632 | 5/11
33 h-m-p 1.6000 8.0000 0.3588 +CCC 522.522197 2 6.3709 651 | 5/11
34 h-m-p 1.6000 8.0000 0.7679 YCCC 522.345283 3 0.7141 676 | 5/11
35 h-m-p 1.1643 8.0000 0.4709 ++ 521.740149 m 8.0000 696 | 5/11
36 h-m-p 1.6000 8.0000 0.7264 +YCCC 521.463063 3 4.9926 722 | 5/11
37 h-m-p 1.6000 8.0000 2.1167 YCCC 521.130644 3 3.4304 747 | 5/11
38 h-m-p 1.6000 8.0000 2.1756 +YCCC 520.774397 3 4.8732 767 | 5/11
39 h-m-p 1.6000 8.0000 2.8887 YCCC 520.376665 3 2.9810 786 | 5/11
40 h-m-p 1.4834 8.0000 5.8051 YCC 519.899840 2 2.4115 803 | 5/11
41 h-m-p 1.4366 7.1832 7.7486 YCCC 519.720925 3 2.8447 822 | 5/11
42 h-m-p 1.0382 5.1909 6.5774 +YCCC 519.639499 3 2.7535 842 | 5/11
43 h-m-p 0.4113 2.0567 7.6841 ++ 519.610970 m 2.0567 856 | 6/11
44 h-m-p 0.0018 0.0128 7844.6888 YCCC 519.595974 3 0.0009 875 | 6/11
45 h-m-p 1.6000 8.0000 1.7251 CCC 519.590275 2 1.7142 893 | 6/11
46 h-m-p 1.6000 8.0000 0.0304 C 519.590058 0 1.7908 907 | 6/11
47 h-m-p 0.2373 8.0000 0.2293 ----------Y 519.590058 0 0.0000 936 | 6/11
48 h-m-p 0.0160 8.0000 0.0016 +++++ 519.590052 m 8.0000 958 | 6/11
49 h-m-p 0.1861 8.0000 0.0671 ++Y 519.589956 0 2.4203 979 | 6/11
50 h-m-p 1.6000 8.0000 0.0120 YC 519.589831 1 3.2595 999 | 6/11
51 h-m-p 1.6000 8.0000 0.0050 +Y 519.589830 0 4.0384 1019 | 6/11
52 h-m-p 1.6000 8.0000 0.0032 ++ 519.589827 m 8.0000 1038 | 6/11
53 h-m-p 0.1765 8.0000 0.1459 +C 519.589820 0 1.0007 1058 | 6/11
54 h-m-p 1.6000 8.0000 0.0004 Y 519.589820 0 1.0019 1077 | 6/11
55 h-m-p 1.6000 8.0000 0.0000 Y 519.589820 0 1.6000 1096 | 6/11
56 h-m-p 1.5437 8.0000 0.0000 Y 519.589820 0 0.3859 1115 | 6/11
57 h-m-p 1.1891 8.0000 0.0000 C 519.589820 0 0.2973 1134
Out..
lnL = -519.589820
1135 lfun, 4540 eigenQcodon, 20430 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -529.763777 S = -477.203977 -74.767144
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 68 patterns 0:07
did 20 / 68 patterns 0:07
did 30 / 68 patterns 0:07
did 40 / 68 patterns 0:07
did 50 / 68 patterns 0:08
did 60 / 68 patterns 0:08
did 68 / 68 patterns 0:08
Time used: 0:08
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 53
0.059047 0.024692 0.072801 0.020836 0.059438 0.010785 2.320308 1.098981 1.689039
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 6.709533
np = 9
lnL0 = -815.792622
Iterating by ming2
Initial: fx= 815.792622
x= 0.05905 0.02469 0.07280 0.02084 0.05944 0.01078 2.32031 1.09898 1.68904
1 h-m-p 0.0000 0.0001 1661.3063 ++ 666.542781 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 158.3223 ++ 663.382632 m 0.0001 26 | 2/9
3 h-m-p 0.0001 0.0003 64.8924 ++ 662.401139 m 0.0003 38 | 3/9
4 h-m-p 0.0003 0.0013 38.9303 ++ 656.859581 m 0.0013 50 | 4/9
5 h-m-p 0.0032 0.0404 11.3548 ++ 653.664638 m 0.0404 62 | 5/9
6 h-m-p 0.0043 0.0485 105.5058 +YCYCYCCC 646.708214 7 0.0257 86 | 5/9
7 h-m-p 0.5528 8.0000 4.9068 ++ 598.348471 m 8.0000 98 | 5/9
8 h-m-p 0.0500 0.2501 339.5575 ++ 533.259563 m 0.2501 110 | 5/9
9 h-m-p 0.0000 0.0000 0.9435
h-m-p: 0.00000000e+00 0.00000000e+00 9.43480452e-01 533.259563
.. | 5/9
10 h-m-p 0.0017 0.8695 3.2947 +++YCCC 532.185358 3 0.2179 143 | 5/9
11 h-m-p 0.3782 1.8909 0.7755 YYCC 532.099607 3 0.2786 159 | 5/9
12 h-m-p 1.6000 8.0000 0.0360 YC 532.095807 1 1.2859 176 | 5/9
13 h-m-p 1.6000 8.0000 0.0105 ++ 532.094993 m 8.0000 192 | 5/9
14 h-m-p 0.0546 8.0000 1.5345 +++YC 532.077165 1 2.2897 212 | 5/9
15 h-m-p 1.5720 8.0000 2.2351 ++ 531.915825 m 8.0000 224 | 5/9
16 h-m-p 0.0019 0.0093 68.9727 ++ 531.910347 m 0.0093 236 | 6/9
17 h-m-p 0.0046 0.9082 92.6671 +++YYYYYYYYYC 531.693835 10 0.2964 261 | 6/9
18 h-m-p 0.0595 0.2975 190.5489 YYYCCCCCC 531.625063 8 0.0741 286 | 6/9
19 h-m-p 1.6000 8.0000 4.6068 YYCCCCC 531.574427 6 1.9554 308 | 6/9
20 h-m-p 1.6000 8.0000 0.5125 CYC 531.529427 2 0.5049 323 | 6/9
21 h-m-p 0.0420 5.4840 6.1601 ++CYCYC 531.483112 4 1.3128 347 | 6/9
22 h-m-p 1.5846 7.9229 3.2501 YYYYC 531.451407 4 1.4559 363 | 6/9
23 h-m-p 1.5492 7.7460 2.0130 CYC 531.410394 2 0.4900 378 | 6/9
24 h-m-p 0.1128 2.3061 8.7408 +YYYCCCCCC 531.343424 8 0.5413 404 | 6/9
25 h-m-p 0.5897 2.9484 5.2681 YCYC 531.307232 3 0.3821 420 | 6/9
26 h-m-p 1.6000 8.0000 0.8525 YCCCC 531.192680 4 0.7486 439 | 6/9
27 h-m-p 0.2278 4.7707 2.8011 +YYYYCCCCC 531.101218 8 0.9542 467 | 6/9
28 h-m-p 1.1047 5.5233 2.0896 YYYCCCCCC 530.908232 8 1.2484 492 | 6/9
29 h-m-p 0.7543 3.7713 1.3934 YCCC 530.714167 3 0.4684 509 | 6/9
30 h-m-p 0.2736 4.3872 2.3854 +YYYYYYYCCC 530.431607 10 1.1787 534 | 6/9
31 h-m-p 0.9835 4.9174 2.2413 YYYYYY 530.199181 5 0.9835 551 | 6/9
32 h-m-p 1.1436 8.0000 1.9276 CYCC 530.009882 3 0.3802 568 | 6/9
33 h-m-p 0.3236 5.5789 2.2645 +YYYCCCCCC 529.641689 8 1.5568 594 | 6/9
34 h-m-p 1.6000 8.0000 2.1180 YCCCCCC 529.129913 6 2.3466 617 | 6/9
35 h-m-p 0.5956 2.9778 3.5650 YCCC 528.905514 3 0.2651 634 | 6/9
36 h-m-p 0.2477 6.5115 3.8149 +CYCYCCC 528.385470 6 1.8731 657 | 6/9
37 h-m-p 1.2280 6.1402 3.3870 ++ 527.645497 m 6.1402 669 | 7/9
38 h-m-p 0.0511 0.2553 8.5637 CCC 527.601730 2 0.0168 685 | 7/9
39 h-m-p 0.4423 8.0000 0.3245 ----------------.. | 7/9
40 h-m-p 0.0023 1.1410 1.5024 ++YCCC 527.498236 3 0.0880 732 | 7/9
41 h-m-p 0.1472 2.0007 0.8984 +YYC 527.324810 2 0.4941 747 | 7/9
42 h-m-p 1.6000 8.0000 0.0155 YC 527.323298 1 0.8675 762 | 7/9
43 h-m-p 1.6000 8.0000 0.0024 Y 527.323295 0 0.7326 776 | 6/9
44 h-m-p 0.1345 8.0000 0.0129 +++ 527.321976 m 8.0000 791 | 6/9
45 h-m-p 0.0103 5.1707 19.1257 +++CYCCC 527.142237 4 1.2567 816 | 6/9
46 h-m-p 1.0648 5.3241 14.0609 YCYCYC 526.722330 5 2.9695 836 | 6/9
47 h-m-p 0.0845 0.4223 78.4027 YCYCCC 526.484650 5 0.2088 856 | 6/9
48 h-m-p 0.1973 0.9866 16.9746 YYYCCCC 526.221273 6 0.2029 877 | 6/9
49 h-m-p 0.9345 8.0000 3.6854 CYC 526.188362 2 1.2423 892 | 6/9
50 h-m-p 1.6000 8.0000 1.6726 CCC 526.172761 2 1.3614 908 | 6/9
51 h-m-p 1.6000 8.0000 0.9825 YYC 526.167325 2 1.3026 922 | 6/9
52 h-m-p 1.6000 8.0000 0.0242 YC 526.167227 1 1.2678 938 | 6/9
53 h-m-p 0.7475 8.0000 0.0410 C 526.167226 0 0.8313 953 | 6/9
54 h-m-p 1.6000 8.0000 0.0002 Y 526.167226 0 0.9948 968 | 6/9
55 h-m-p 1.6000 8.0000 0.0000 Y 526.167226 0 1.6000 983 | 6/9
56 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 6/9
57 h-m-p 0.0160 8.0000 0.0000 ------------- | 6/9
58 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -526.167226
1065 lfun, 11715 eigenQcodon, 63900 P(t)
Time used: 0:23
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 53
initial w for M8:NSbetaw>1 reset.
0.035903 0.086750 0.046053 0.085231 0.109155 0.066949 1.729650 0.900000 0.261207 1.503705 2.426603
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.023287
np = 11
lnL0 = -760.134304
Iterating by ming2
Initial: fx= 760.134304
x= 0.03590 0.08675 0.04605 0.08523 0.10916 0.06695 1.72965 0.90000 0.26121 1.50371 2.42660
1 h-m-p 0.0000 0.0003 886.2321 +++ 644.134052 m 0.0003 28 | 1/11
2 h-m-p 0.0000 0.0001 304.7207 ++ 638.376801 m 0.0001 53 | 2/11
3 h-m-p 0.0000 0.0000 1795.8009 ++ 628.916322 m 0.0000 77 | 3/11
4 h-m-p 0.0000 0.0002 127.0786 ++ 623.661111 m 0.0002 100 | 4/11
5 h-m-p 0.0000 0.0000 2698.4092 ++ 623.449904 m 0.0000 122 | 5/11
6 h-m-p 0.0008 0.3826 4.6726 ++++YYCCC 619.202706 4 0.1591 153 | 5/11
7 h-m-p 0.2613 1.3063 1.2292 +CCCCC 600.363575 4 1.0698 182 | 5/11
8 h-m-p 0.0543 0.2716 12.4190 +CYCCC 574.089120 4 0.2337 210 | 5/11
9 h-m-p 0.5188 5.0414 5.5958 ++ 538.384293 m 5.0414 230 | 5/11
10 h-m-p -0.0000 -0.0000 3.9643
h-m-p: -1.52372803e-16 -7.61864013e-16 3.96433165e+00 538.384293
.. | 5/11
11 h-m-p 0.0000 0.0235 43.1339 ++++YYC 530.142988 2 0.0100 273 | 5/11
12 h-m-p 0.0585 0.6732 7.3363 +YYCCCC 524.723104 5 0.3192 302 | 5/11
13 h-m-p 1.4284 7.1421 0.9863 YYCC 524.473996 3 0.5264 326 | 5/11
14 h-m-p 0.8060 8.0000 0.6442 +YC 523.750525 1 2.0487 348 | 5/11
15 h-m-p 1.6000 8.0000 0.7736 +YCCC 522.848739 3 4.4217 374 | 5/11
16 h-m-p 1.4237 8.0000 2.4025 YCCCC 521.750782 4 3.2948 401 | 5/11
17 h-m-p 1.6000 8.0000 1.5142 YC 521.403318 1 2.8813 422 | 5/11
18 h-m-p 1.3487 8.0000 3.2350 YCCC 521.066292 3 2.4786 447 | 5/11
19 h-m-p 1.6000 8.0000 1.6294 CC 520.997563 1 1.9596 469 | 5/11
20 h-m-p 1.6000 8.0000 1.1061 ++ 520.805464 m 8.0000 489 | 5/11
21 h-m-p 1.6000 8.0000 4.9972 +CCCC 520.424545 3 6.1907 516 | 5/11
22 h-m-p 1.6000 8.0000 1.4698 +CCC 520.093270 2 5.6686 541 | 5/11
23 h-m-p 1.3670 6.8349 2.5567 CCCCC 519.810660 4 2.0481 569 | 5/11
24 h-m-p 0.4220 3.6238 12.4083 YCCC 519.736989 3 0.8430 594 | 5/11
25 h-m-p 1.4960 7.4799 5.7386 +CCCC 519.638048 3 5.0511 621 | 5/11
26 h-m-p 0.4866 2.4331 5.1623 +CC 519.622393 1 1.7000 644 | 5/11
27 h-m-p 0.1685 0.8425 4.4465 ++ 519.616509 m 0.8425 664 | 6/11
28 h-m-p 0.0167 0.4951 205.4057 CCC 519.609513 2 0.0236 688 | 6/11
29 h-m-p 1.6000 8.0000 1.3444 YC 519.598929 1 2.8917 708 | 6/11
30 h-m-p 1.6000 8.0000 0.6778 CCC 519.596430 2 1.8769 731 | 6/11
31 h-m-p 1.6000 8.0000 0.4924 CC 519.595628 1 2.0957 752 | 6/11
32 h-m-p 1.6000 8.0000 0.1167 YC 519.595593 1 1.0076 772 | 6/11
33 h-m-p 1.6000 8.0000 0.0041 Y 519.595593 0 1.1145 791 | 6/11
34 h-m-p 1.6000 8.0000 0.0005 ++ 519.595593 m 8.0000 810 | 6/11
35 h-m-p 0.0925 8.0000 0.0463 ++C 519.595590 0 2.2597 831 | 6/11
36 h-m-p 1.6000 8.0000 0.0286 ++ 519.595565 m 8.0000 850 | 6/11
37 h-m-p 0.0087 2.2179 26.2226 ++++ 519.592576 m 2.2179 871 | 7/11
38 h-m-p 1.0006 5.0030 9.8056 --Y 519.592572 0 0.0097 892 | 7/11
39 h-m-p 0.3660 8.0000 0.2596 +Y 519.592554 0 0.9716 911 | 7/11
40 h-m-p 1.6000 8.0000 0.0013 Y 519.592554 0 1.0029 929 | 7/11
41 h-m-p 1.6000 8.0000 0.0000 C 519.592554 0 0.3529 947 | 7/11
42 h-m-p 1.6000 8.0000 0.0000 ---------------Y 519.592554 0 0.0000 980
Out..
lnL = -519.592554
981 lfun, 11772 eigenQcodon, 64746 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -528.986816 S = -477.239447 -67.241862
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 68 patterns 0:40
did 20 / 68 patterns 0:40
did 30 / 68 patterns 0:41
did 40 / 68 patterns 0:41
did 50 / 68 patterns 0:41
did 60 / 68 patterns 0:41
did 68 / 68 patterns 0:41
Time used: 0:41
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=381
NC_011896_1_WP_010907708_1_2879_MLBR_RS13715 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
NC_002677_1_NP_302718_1_1590_ML2692 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840 MSEHNPAGAPGASTD--SAFTGNPERPRSASDVMSEIVTGLSEFSLLSKN
NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
**************: *:.* ..: *.:* *:. : :*
NC_011896_1_WP_010907708_1_2879_MLBR_RS13715 AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NC_002677_1_NP_302718_1_1590_ML2692 AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930 AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645 AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840 AEQDASNVSAAITQRVNAD-------TAAGGIRTRRWNQNIAoooooooo
NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165 AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
*: *:*.*.. : *... .** .: ::: . :::
NC_011896_1_WP_010907708_1_2879_MLBR_RS13715 NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
NC_002677_1_NP_302718_1_1590_ML2692 NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930 NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645 NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840 oooooooooooooooooooooooooooooooooooooooooooooooooo
NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165 NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
NC_011896_1_WP_010907708_1_2879_MLBR_RS13715 TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
NC_002677_1_NP_302718_1_1590_ML2692 TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930 TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645 TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840 oooooooooooooooooooooooooooooooooooooooooooooooooo
NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165 TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
NC_011896_1_WP_010907708_1_2879_MLBR_RS13715 ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
NC_002677_1_NP_302718_1_1590_ML2692 ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930 ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645 ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840 oooooooooooooooooooooooooooooooooooooooooooooooooo
NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165 ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
NC_011896_1_WP_010907708_1_2879_MLBR_RS13715 MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
NC_002677_1_NP_302718_1_1590_ML2692 MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930 MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645 MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840 oooooooooooooooooooooooooooooooooooooooooooooooooo
NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165 MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
NC_011896_1_WP_010907708_1_2879_MLBR_RS13715 RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
NC_002677_1_NP_302718_1_1590_ML2692 RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930 RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645 RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840 oooooooooooooooooooooooooooooooooooooooooooooooooo
NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165 RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
NC_011896_1_WP_010907708_1_2879_MLBR_RS13715 PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
NC_002677_1_NP_302718_1_1590_ML2692 PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930 PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645 PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840 oooooooooooooooooooooooooooo---
NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165 PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
>NC_011896_1_WP_010907708_1_2879_MLBR_RS13715 ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA >NC_002677_1_NP_302718_1_1590_ML2692 ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA >NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930 ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA >NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645 ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA >NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840 ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAT----- -TCCGCATTCACCGGCAACCCTGAGCGCCCGAGGAGCGCCAGCGACGTGA TGTCAGAAATCGTGACCGGCCTGTCTGAGTTCTCACTGTTATCCAAGAAT GCTGAGCAAGACGCCAGTAATGTATCTGCTGCCATCACACAACGAGTCAA CGCGGAC---------------------ACGGCCGCCGGTGGAATCAGAA CCCGCCGGTGGAATCAGAACATTGCA------------------------ -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------------- >NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165 ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
>NC_011896_1_WP_010907708_1_2879_MLBR_RS13715 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI PASSYLMKSPPQQLPDEIARAQLEEFIIDTK >NC_002677_1_NP_302718_1_1590_ML2692 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI PASSYLMKSPPQQLPDEIARAQLEEFIIDTK >NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI PASSYLMKSPPQQLPDEIARAQLEEFIIDTK >NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI PASSYLMKSPPQQLPDEIARAQLEEFIIDTK >NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840 MSEHNPAGAPGASTD--SAFTGNPERPRSASDVMSEIVTGLSEFSLLSKN AEQDASNVSAAITQRVNAD-------TAAGGIRTRRWNQNIA-------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------- >NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165 MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
#NEXUS
[ID: 9748799519]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907708_1_2879_MLBR_RS13715
NC_002677_1_NP_302718_1_1590_ML2692
NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930
NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645
NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840
NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907708_1_2879_MLBR_RS13715,
2 NC_002677_1_NP_302718_1_1590_ML2692,
3 NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930,
4 NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645,
5 NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840,
6 NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:6.08075E-4,2:6.225419E-4,3:6.181134E-4,4:6.296374E-4,5:1.043191,6:5.989657E-4);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:6.08075E-4,2:6.225419E-4,3:6.181134E-4,4:6.296374E-4,5:1.043191,6:5.989657E-4);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1821.45 -1837.26
2 -1821.18 -1834.78
--------------------------------------
TOTAL -1821.31 -1836.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.075611 0.041517 0.728973 1.495927 1.050043 1363.84 1377.83 1.000
r(A<->C){all} 0.220573 0.004737 0.086255 0.352166 0.215889 526.49 593.26 1.000
r(A<->G){all} 0.220120 0.004843 0.086182 0.354644 0.214568 601.67 637.31 1.001
r(A<->T){all} 0.089126 0.004753 0.000048 0.223559 0.073924 290.35 391.34 1.000
r(C<->G){all} 0.073526 0.002235 0.000046 0.163571 0.066036 550.33 654.35 1.000
r(C<->T){all} 0.166220 0.005205 0.035200 0.314279 0.162064 410.67 499.30 1.001
r(G<->T){all} 0.230435 0.006408 0.092269 0.402312 0.225563 374.74 400.40 1.000
pi(A){all} 0.244420 0.000145 0.219929 0.266937 0.244614 985.66 1157.76 1.000
pi(C){all} 0.300127 0.000177 0.274417 0.326478 0.300092 1101.08 1242.17 1.000
pi(G){all} 0.286067 0.000164 0.261366 0.311366 0.285865 1186.07 1313.16 1.000
pi(T){all} 0.169386 0.000114 0.148109 0.189948 0.169017 1300.49 1400.74 1.001
alpha{1,2} 1.133128 0.283218 0.368908 2.176399 1.011069 1363.10 1432.05 1.000
alpha{3} 1.683434 0.486166 0.619892 3.132187 1.569391 1501.00 1501.00 1.000
pinvar{all} 0.062227 0.002937 0.000022 0.169056 0.047610 1386.11 1425.45 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/ML2692/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 71
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 2 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 1 1 1 1 1 1 | TAC 3 3 3 3 0 3 | TGC 1 1 1 1 0 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 1 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 0 1 | TCG 4 4 4 4 1 4 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 1 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 0 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 0 0 0 0 0 0 | CCC 2 2 2 2 0 2 | CAC 2 2 2 2 1 2 | CGC 0 0 0 0 1 0
CTA 1 1 1 1 0 1 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 1 0
CTG 0 0 0 0 1 0 | CCG 0 0 0 0 0 0 | CAG 1 1 1 1 1 1 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 3 0 | Ser AGT 1 1 1 1 2 1
ATC 1 1 1 1 3 1 | ACC 0 0 0 0 3 0 | AAC 3 3 3 3 3 3 | AGC 0 0 0 0 1 0
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 1 2 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 1 0
Met ATG 2 2 2 2 2 2 | ACG 0 0 0 0 1 0 | AAG 2 2 2 2 1 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 0 1 | Ala GCT 1 1 1 1 2 1 | Asp GAT 0 0 0 0 1 0 | Gly GGT 2 2 2 2 1 2
GTC 2 2 2 2 1 2 | GCC 3 3 3 3 5 3 | GAC 5 5 5 5 3 5 | GGC 3 3 3 3 2 3
GTA 3 3 3 3 1 3 | GCA 1 1 1 1 3 1 | Glu GAA 0 0 0 0 1 0 | GGA 1 1 1 1 1 1
GTG 4 4 4 4 2 4 | GCG 4 4 4 4 3 4 | GAG 3 3 3 3 3 3 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715
position 1: T:0.16901 C:0.15493 A:0.18310 G:0.49296
position 2: T:0.26761 C:0.29577 A:0.28169 G:0.15493
position 3: T:0.11268 C:0.39437 A:0.15493 G:0.33803
Average T:0.18310 C:0.28169 A:0.20657 G:0.32864
#2: NC_002677_1_NP_302718_1_1590_ML2692
position 1: T:0.16901 C:0.15493 A:0.18310 G:0.49296
position 2: T:0.26761 C:0.29577 A:0.28169 G:0.15493
position 3: T:0.11268 C:0.39437 A:0.15493 G:0.33803
Average T:0.18310 C:0.28169 A:0.20657 G:0.32864
#3: NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930
position 1: T:0.16901 C:0.15493 A:0.18310 G:0.49296
position 2: T:0.26761 C:0.29577 A:0.28169 G:0.15493
position 3: T:0.11268 C:0.39437 A:0.15493 G:0.33803
Average T:0.18310 C:0.28169 A:0.20657 G:0.32864
#4: NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645
position 1: T:0.16901 C:0.15493 A:0.18310 G:0.49296
position 2: T:0.26761 C:0.29577 A:0.28169 G:0.15493
position 3: T:0.11268 C:0.39437 A:0.15493 G:0.33803
Average T:0.18310 C:0.28169 A:0.20657 G:0.32864
#5: NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840
position 1: T:0.11268 C:0.12676 A:0.32394 G:0.43662
position 2: T:0.18310 C:0.36620 A:0.25352 G:0.19718
position 3: T:0.18310 C:0.36620 A:0.18310 G:0.26761
Average T:0.15962 C:0.28638 A:0.25352 G:0.30047
#6: NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165
position 1: T:0.16901 C:0.15493 A:0.18310 G:0.49296
position 2: T:0.26761 C:0.29577 A:0.28169 G:0.15493
position 3: T:0.11268 C:0.39437 A:0.15493 G:0.33803
Average T:0.18310 C:0.28169 A:0.20657 G:0.32864
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 2 | Tyr Y TAT 0 | Cys C TGT 0
TTC 12 | TCC 6 | TAC 15 | TGC 5
Leu L TTA 0 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 5 | TCG 21 | TAG 0 | Trp W TGG 1
------------------------------------------------------------------------------
Leu L CTT 5 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 0
CTC 0 | CCC 10 | CAC 11 | CGC 1
CTA 5 | CCA 12 | Gln Q CAA 6 | CGA 1
CTG 1 | CCG 0 | CAG 6 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 3 | Ser S AGT 7
ATC 8 | ACC 3 | AAC 18 | AGC 1
ATA 0 | ACA 11 | Lys K AAA 0 | Arg R AGA 1
Met M ATG 12 | ACG 1 | AAG 11 | AGG 0
------------------------------------------------------------------------------
Val V GTT 5 | Ala A GCT 7 | Asp D GAT 1 | Gly G GGT 11
GTC 11 | GCC 20 | GAC 28 | GGC 17
GTA 16 | GCA 8 | Glu E GAA 1 | GGA 6
GTG 22 | GCG 23 | GAG 18 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15962 C:0.15023 A:0.20657 G:0.48357
position 2: T:0.25352 C:0.30751 A:0.27700 G:0.16197
position 3: T:0.12441 C:0.38967 A:0.15962 G:0.32629
Average T:0.17919 C:0.28247 A:0.21440 G:0.32394
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 53
lnL(ntime: 6 np: 8): -531.723646 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 4.125830 0.000004 1.141203 0.245596
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 4.125850
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 4.125830, 6: 0.000004);
(NC_011896_1_WP_010907708_1_2879_MLBR_RS13715: 0.000004, NC_002677_1_NP_302718_1_1590_ML2692: 0.000004, NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930: 0.000004, NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645: 0.000004, NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840: 4.125830, NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.14120
omega (dN/dS) = 0.24560
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 159.5 53.5 0.2456 0.0000 0.0000 0.0 0.0
7..2 0.000 159.5 53.5 0.2456 0.0000 0.0000 0.0 0.0
7..3 0.000 159.5 53.5 0.2456 0.0000 0.0000 0.0 0.0
7..4 0.000 159.5 53.5 0.2456 0.0000 0.0000 0.0 0.0
7..5 4.126 159.5 53.5 0.2456 0.7763 3.1610 123.8 169.1
7..6 0.000 159.5 53.5 0.2456 0.0000 0.0000 0.0 0.0
tree length for dN: 0.7763
tree length for dS: 3.1610
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 53
lnL(ntime: 6 np: 9): -524.950819 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 5.267166 0.000004 0.985753 0.426299 0.061101
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 5.267186
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 5.267166, 6: 0.000004);
(NC_011896_1_WP_010907708_1_2879_MLBR_RS13715: 0.000004, NC_002677_1_NP_302718_1_1590_ML2692: 0.000004, NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930: 0.000004, NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645: 0.000004, NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840: 5.267166, NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.98575
MLEs of dN/dS (w) for site classes (K=2)
p: 0.42630 0.57370
w: 0.06110 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 159.9 53.1 0.5997 0.0000 0.0000 0.0 0.0
7..2 0.000 159.9 53.1 0.5997 0.0000 0.0000 0.0 0.0
7..3 0.000 159.9 53.1 0.5997 0.0000 0.0000 0.0 0.0
7..4 0.000 159.9 53.1 0.5997 0.0000 0.0000 0.0 0.0
7..5 5.267 159.9 53.1 0.5997 1.5052 2.5097 240.7 133.3
7..6 0.000 159.9 53.1 0.5997 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 53
lnL(ntime: 6 np: 11): -519.589820 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 50.000000 0.000004 2.320308 0.443706 0.000000 0.329829 88.328816
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 50.000020
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 50.000000, 6: 0.000004);
(NC_011896_1_WP_010907708_1_2879_MLBR_RS13715: 0.000004, NC_002677_1_NP_302718_1_1590_ML2692: 0.000004, NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930: 0.000004, NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645: 0.000004, NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840: 50.000000, NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 2.32031
MLEs of dN/dS (w) for site classes (K=3)
p: 0.44371 0.00000 0.55629
w: 0.32983 1.00000 88.32882
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 157.5 55.5 49.2831 0.0000 0.0000 0.0 0.0
7..2 0.000 157.5 55.5 49.2831 0.0000 0.0000 0.0 0.0
7..3 0.000 157.5 55.5 49.2831 0.0000 0.0000 0.0 0.0
7..4 0.000 157.5 55.5 49.2831 0.0000 0.0000 0.0 0.0
7..5 50.000 157.5 55.5 49.2831 22.3806 0.4541 3524.8 25.2
7..6 0.000 157.5 55.5 49.2831 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)
Pr(w>1) post mean +- SE for w
15 E 0.519 46.045
16 V 0.986* 87.111
18 I 0.872 77.083
19 V 0.820 72.511
21 V 0.739 65.340
24 C 0.996** 87.959
25 A 0.845 74.677
27 S 0.992** 87.582
28 L 0.942 83.262
30 Q 0.999** 88.236
32 I 0.948 83.716
33 E 0.997** 88.096
34 Y 0.960* 84.843
35 Y 0.507 44.957
36 Q 0.503 44.589
39 D 0.546 48.339
41 T 0.818 72.301
42 S 0.999** 88.271
43 T 0.968* 85.494
45 P 0.766 67.721
46 G 0.637 56.385
47 L 0.988* 87.237
48 M 0.521 46.145
49 H 0.998** 88.149
50 V 0.994** 87.774
52 F 0.569 50.423
53 G 0.984* 86.898
54 P 0.877 77.476
55 Y 0.539 47.786
56 V 0.841 74.368
59 F 0.993** 87.670
60 D 0.843 74.545
61 V 0.799 70.623
62 D 0.994** 87.788
64 K 0.997** 88.094
65 K 0.918 81.142
66 V 0.997** 88.026
67 G 0.966* 85.337
68 V 0.991** 87.536
70 L 0.976* 86.248
71 S 0.818 72.343
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)
Pr(w>1) post mean +- SE for w
16 V 0.924 9.027 +- 2.542
18 I 0.726 7.243 +- 4.087
19 V 0.719 7.198 +- 4.074
21 V 0.622 6.301 +- 4.440
24 C 0.973* 9.451 +- 1.772
25 A 0.744 7.420 +- 3.961
27 S 0.952* 9.267 +- 2.150
28 L 0.817 8.065 +- 3.583
30 Q 0.988* 9.585 +- 1.420
32 I 0.848 8.348 +- 3.333
33 E 0.977* 9.487 +- 1.686
34 Y 0.869 8.537 +- 3.137
35 Y 0.519 5.369 +- 4.533
41 T 0.664 6.683 +- 4.326
42 S 0.992** 9.623 +- 1.303
43 T 0.907 8.873 +- 2.758
45 P 0.576 5.888 +- 4.489
46 G 0.739 7.356 +- 4.015
47 L 0.920 8.989 +- 2.594
49 H 0.981* 9.529 +- 1.579
50 V 0.959* 9.330 +- 2.031
52 F 0.579 5.910 +- 4.495
53 G 0.922 9.006 +- 2.566
54 P 0.759 7.539 +- 3.944
55 Y 0.538 5.535 +- 4.535
56 V 0.750 7.468 +- 3.935
59 F 0.950 9.253 +- 2.175
60 D 0.728 7.266 +- 4.069
61 V 0.662 6.666 +- 4.331
62 D 0.956* 9.308 +- 2.068
64 K 0.977* 9.491 +- 1.673
65 K 0.869 8.528 +- 3.145
66 V 0.976* 9.480 +- 1.704
67 G 0.869 8.534 +- 3.138
68 V 0.948 9.234 +- 2.208
70 L 0.904 8.849 +- 2.779
71 S 0.688 6.896 +- 4.235
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.143 0.175 0.178 0.155 0.120 0.086 0.059 0.039 0.027 0.019
w2: 0.000 0.000 0.000 0.001 0.005 0.019 0.055 0.132 0.275 0.514
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.003 0.001 0.000 0.000 0.000 0.000 0.000
0.008 0.005 0.004 0.001 0.000 0.000 0.000 0.000 0.000
0.008 0.012 0.017 0.009 0.005 0.001 0.000 0.000 0.000 0.000 0.000
0.003 0.010 0.025 0.027 0.026 0.010 0.005 0.001 0.000 0.000 0.000 0.000 0.000
0.000 0.003 0.015 0.032 0.050 0.039 0.029 0.010 0.004 0.001 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.004 0.016 0.042 0.061 0.068 0.043 0.028 0.009 0.004 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.004 0.016 0.042 0.069 0.079 0.074 0.042 0.026 0.008 0.003 0.000 0.000 0.000 0.000 0.000 0.000
sum of density on p0-p1 = 1.000000
Time used: 0:08
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 53
check convergence..
lnL(ntime: 6 np: 9): -526.167226 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 50.000000 0.000004 1.729650 0.496862 14.266854
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 50.000020
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 50.000000, 6: 0.000004);
(NC_011896_1_WP_010907708_1_2879_MLBR_RS13715: 0.000004, NC_002677_1_NP_302718_1_1590_ML2692: 0.000004, NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930: 0.000004, NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645: 0.000004, NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840: 50.000000, NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.72965
Parameters in M7 (beta):
p = 0.49686 q = 14.26685
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00013 0.00124 0.00354 0.00720 0.01250 0.01993 0.03040 0.04577 0.07085 0.12754
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 158.3 54.7 0.0319 0.0000 0.0000 0.0 0.0
7..2 0.000 158.3 54.7 0.0319 0.0000 0.0000 0.0 0.0
7..3 0.000 158.3 54.7 0.0319 0.0000 0.0000 0.0 0.0
7..4 0.000 158.3 54.7 0.0319 0.0000 0.0000 0.0 0.0
7..5 50.000 158.3 54.7 0.0319 1.8972 59.4514 300.4 3249.6
7..6 0.000 158.3 54.7 0.0319 0.0000 0.0000 0.0 0.0
Time used: 0:23
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 53
lnL(ntime: 6 np: 11): -519.592554 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 50.000000 0.000004 2.325225 0.443790 49.112018 99.000000 88.458482
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 50.000020
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 50.000000, 6: 0.000004);
(NC_011896_1_WP_010907708_1_2879_MLBR_RS13715: 0.000004, NC_002677_1_NP_302718_1_1590_ML2692: 0.000004, NZ_LVXE01000090_1_WP_010907708_1_2893_A3216_RS13930: 0.000004, NZ_LYPH01000093_1_WP_010907708_1_2829_A8144_RS13645: 0.000004, NZ_CP029543_1_WP_111481123_1_2917_DIJ64_RS14840: 50.000000, NZ_AP014567_1_WP_010907708_1_2982_JK2ML_RS15165: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 2.32523
Parameters in M8 (beta&w>1):
p0 = 0.44379 p = 49.11202 q = 99.00000
(p1 = 0.55621) w = 88.45848
MLEs of dN/dS (w) for site classes (K=11)
p: 0.04438 0.04438 0.04438 0.04438 0.04438 0.04438 0.04438 0.04438 0.04438 0.04438 0.55621
w: 0.26947 0.29158 0.30508 0.31602 0.32597 0.33570 0.34586 0.35727 0.37171 0.39630 88.45848
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 157.5 55.5 49.3486 0.0000 0.0000 0.0 0.0
7..2 0.000 157.5 55.5 49.3486 0.0000 0.0000 0.0 0.0
7..3 0.000 157.5 55.5 49.3486 0.0000 0.0000 0.0 0.0
7..4 0.000 157.5 55.5 49.3486 0.0000 0.0000 0.0 0.0
7..5 50.000 157.5 55.5 49.3486 22.3816 0.4535 3524.8 25.2
7..6 0.000 157.5 55.5 49.3486 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)
Pr(w>1) post mean +- SE for w
15 E 0.520 46.146
16 V 0.986* 87.225
18 I 0.872 77.193
19 V 0.818 72.464
21 V 0.739 65.464
24 C 0.996** 88.083
25 A 0.843 74.638
27 S 0.991** 87.700
28 L 0.942 83.390
30 Q 0.999** 88.363
32 I 0.947 83.830
33 E 0.997** 88.222
34 Y 0.960* 84.936
35 Y 0.507 45.031
36 Q 0.503 44.654
39 D 0.546 48.463
41 T 0.818 72.419
42 S 0.999** 88.399
43 T 0.968* 85.613
45 P 0.765 67.787
46 G 0.637 56.427
47 L 0.987* 87.351
48 M 0.521 46.261
49 H 0.998** 88.276
50 V 0.994** 87.895
52 F 0.569 50.513
53 G 0.983* 87.002
54 P 0.877 77.614
55 Y 0.540 47.878
56 V 0.840 74.322
59 F 0.992** 87.790
60 D 0.843 74.639
61 V 0.799 70.743
62 D 0.994** 87.903
64 K 0.997** 88.218
65 K 0.918 81.226
66 V 0.997** 88.151
67 G 0.966* 85.423
68 V 0.991** 87.654
70 L 0.976* 86.351
71 S 0.818 72.446
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)
Pr(w>1) post mean +- SE for w
15 E 0.548 5.559 +- 4.591
16 V 0.956* 9.287 +- 2.114
18 I 0.797 7.848 +- 3.761
19 V 0.807 7.938 +- 3.669
21 V 0.697 6.932 +- 4.275
24 C 0.985* 9.551 +- 1.505
25 A 0.828 8.131 +- 3.518
27 S 0.973* 9.441 +- 1.787
28 L 0.871 8.520 +- 3.192
30 Q 0.994** 9.630 +- 1.256
32 I 0.899 8.775 +- 2.896
33 E 0.988* 9.572 +- 1.444
34 Y 0.919 8.956 +- 2.649
35 Y 0.611 6.132 +- 4.496
36 Q 0.588 5.929 +- 4.530
39 D 0.570 5.757 +- 4.582
41 T 0.739 7.314 +- 4.095
42 S 0.996** 9.648 +- 1.192
43 T 0.941 9.156 +- 2.350
45 P 0.666 6.645 +- 4.358
46 G 0.812 7.978 +- 3.654
47 L 0.953* 9.266 +- 2.150
48 M 0.505 5.174 +- 4.619
49 H 0.990** 9.597 +- 1.368
50 V 0.977* 9.478 +- 1.699
52 F 0.664 6.620 +- 4.373
53 G 0.956* 9.287 +- 2.108
54 P 0.820 8.057 +- 3.616
55 Y 0.625 6.260 +- 4.475
56 V 0.833 8.172 +- 3.484
59 F 0.972* 9.434 +- 1.803
60 D 0.802 7.889 +- 3.727
61 V 0.737 7.293 +- 4.105
62 D 0.977* 9.480 +- 1.691
63 A 0.548 5.549 +- 4.593
64 K 0.989* 9.582 +- 1.413
65 K 0.917 8.930 +- 2.685
66 V 0.987* 9.568 +- 1.456
67 G 0.919 8.955 +- 2.649
68 V 0.971* 9.422 +- 1.832
70 L 0.944 9.180 +- 2.302
71 S 0.765 7.549 +- 3.952
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.001 0.056 0.312 0.422 0.183 0.025 0.001 0.000 0.000
p : 0.096 0.119 0.125 0.122 0.114 0.104 0.093 0.084 0.075 0.068
q : 0.032 0.058 0.078 0.093 0.105 0.115 0.122 0.128 0.132 0.135
ws: 0.000 0.000 0.000 0.001 0.005 0.020 0.056 0.132 0.275 0.511
Time used: 0:41
Model 1: NearlyNeutral -524.950819
Model 2: PositiveSelection -519.58982
Model 0: one-ratio -531.723646
Model 7: beta -526.167226
Model 8: beta&w>1 -519.592554
Model 0 vs 1 13.545654000000013
Model 2 vs 1 10.721997999999985
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)
Pr(w>1) post mean +- SE for w
15 E 0.519 46.045
16 V 0.986* 87.111
18 I 0.872 77.083
19 V 0.820 72.511
21 V 0.739 65.340
24 C 0.996** 87.959
25 A 0.845 74.677
27 S 0.992** 87.582
28 L 0.942 83.262
30 Q 0.999** 88.236
32 I 0.948 83.716
33 E 0.997** 88.096
34 Y 0.960* 84.843
35 Y 0.507 44.957
36 Q 0.503 44.589
39 D 0.546 48.339
41 T 0.818 72.301
42 S 0.999** 88.271
43 T 0.968* 85.494
45 P 0.766 67.721
46 G 0.637 56.385
47 L 0.988* 87.237
48 M 0.521 46.145
49 H 0.998** 88.149
50 V 0.994** 87.774
52 F 0.569 50.423
53 G 0.984* 86.898
54 P 0.877 77.476
55 Y 0.539 47.786
56 V 0.841 74.368
59 F 0.993** 87.670
60 D 0.843 74.545
61 V 0.799 70.623
62 D 0.994** 87.788
64 K 0.997** 88.094
65 K 0.918 81.142
66 V 0.997** 88.026
67 G 0.966* 85.337
68 V 0.991** 87.536
70 L 0.976* 86.248
71 S 0.818 72.343
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)
Pr(w>1) post mean +- SE for w
16 V 0.924 9.027 +- 2.542
18 I 0.726 7.243 +- 4.087
19 V 0.719 7.198 +- 4.074
21 V 0.622 6.301 +- 4.440
24 C 0.973* 9.451 +- 1.772
25 A 0.744 7.420 +- 3.961
27 S 0.952* 9.267 +- 2.150
28 L 0.817 8.065 +- 3.583
30 Q 0.988* 9.585 +- 1.420
32 I 0.848 8.348 +- 3.333
33 E 0.977* 9.487 +- 1.686
34 Y 0.869 8.537 +- 3.137
35 Y 0.519 5.369 +- 4.533
41 T 0.664 6.683 +- 4.326
42 S 0.992** 9.623 +- 1.303
43 T 0.907 8.873 +- 2.758
45 P 0.576 5.888 +- 4.489
46 G 0.739 7.356 +- 4.015
47 L 0.920 8.989 +- 2.594
49 H 0.981* 9.529 +- 1.579
50 V 0.959* 9.330 +- 2.031
52 F 0.579 5.910 +- 4.495
53 G 0.922 9.006 +- 2.566
54 P 0.759 7.539 +- 3.944
55 Y 0.538 5.535 +- 4.535
56 V 0.750 7.468 +- 3.935
59 F 0.950 9.253 +- 2.175
60 D 0.728 7.266 +- 4.069
61 V 0.662 6.666 +- 4.331
62 D 0.956* 9.308 +- 2.068
64 K 0.977* 9.491 +- 1.673
65 K 0.869 8.528 +- 3.145
66 V 0.976* 9.480 +- 1.704
67 G 0.869 8.534 +- 3.138
68 V 0.948 9.234 +- 2.208
70 L 0.904 8.849 +- 2.779
71 S 0.688 6.896 +- 4.235
Model 8 vs 7 13.149344000000156
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)
Pr(w>1) post mean +- SE for w
15 E 0.520 46.146
16 V 0.986* 87.225
18 I 0.872 77.193
19 V 0.818 72.464
21 V 0.739 65.464
24 C 0.996** 88.083
25 A 0.843 74.638
27 S 0.991** 87.700
28 L 0.942 83.390
30 Q 0.999** 88.363
32 I 0.947 83.830
33 E 0.997** 88.222
34 Y 0.960* 84.936
35 Y 0.507 45.031
36 Q 0.503 44.654
39 D 0.546 48.463
41 T 0.818 72.419
42 S 0.999** 88.399
43 T 0.968* 85.613
45 P 0.765 67.787
46 G 0.637 56.427
47 L 0.987* 87.351
48 M 0.521 46.261
49 H 0.998** 88.276
50 V 0.994** 87.895
52 F 0.569 50.513
53 G 0.983* 87.002
54 P 0.877 77.614
55 Y 0.540 47.878
56 V 0.840 74.322
59 F 0.992** 87.790
60 D 0.843 74.639
61 V 0.799 70.743
62 D 0.994** 87.903
64 K 0.997** 88.218
65 K 0.918 81.226
66 V 0.997** 88.151
67 G 0.966* 85.423
68 V 0.991** 87.654
70 L 0.976* 86.351
71 S 0.818 72.446
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)
Pr(w>1) post mean +- SE for w
15 E 0.548 5.559 +- 4.591
16 V 0.956* 9.287 +- 2.114
18 I 0.797 7.848 +- 3.761
19 V 0.807 7.938 +- 3.669
21 V 0.697 6.932 +- 4.275
24 C 0.985* 9.551 +- 1.505
25 A 0.828 8.131 +- 3.518
27 S 0.973* 9.441 +- 1.787
28 L 0.871 8.520 +- 3.192
30 Q 0.994** 9.630 +- 1.256
32 I 0.899 8.775 +- 2.896
33 E 0.988* 9.572 +- 1.444
34 Y 0.919 8.956 +- 2.649
35 Y 0.611 6.132 +- 4.496
36 Q 0.588 5.929 +- 4.530
39 D 0.570 5.757 +- 4.582
41 T 0.739 7.314 +- 4.095
42 S 0.996** 9.648 +- 1.192
43 T 0.941 9.156 +- 2.350
45 P 0.666 6.645 +- 4.358
46 G 0.812 7.978 +- 3.654
47 L 0.953* 9.266 +- 2.150
48 M 0.505 5.174 +- 4.619
49 H 0.990** 9.597 +- 1.368
50 V 0.977* 9.478 +- 1.699
52 F 0.664 6.620 +- 4.373
53 G 0.956* 9.287 +- 2.108
54 P 0.820 8.057 +- 3.616
55 Y 0.625 6.260 +- 4.475
56 V 0.833 8.172 +- 3.484
59 F 0.972* 9.434 +- 1.803
60 D 0.802 7.889 +- 3.727
61 V 0.737 7.293 +- 4.105
62 D 0.977* 9.480 +- 1.691
63 A 0.548 5.549 +- 4.593
64 K 0.989* 9.582 +- 1.413
65 K 0.917 8.930 +- 2.685
66 V 0.987* 9.568 +- 1.456
67 G 0.919 8.955 +- 2.649
68 V 0.971* 9.422 +- 1.832
70 L 0.944 9.180 +- 2.302
71 S 0.765 7.549 +- 3.952
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
