--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 12:30:45 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/ML2692/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1821.45         -1837.26
2      -1821.18         -1834.78
--------------------------------------
TOTAL    -1821.31         -1836.65
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         1.075611    0.041517    0.728973    1.495927    1.050043   1363.84   1377.83    1.000
r(A<->C){all}   0.220573    0.004737    0.086255    0.352166    0.215889    526.49    593.26    1.000
r(A<->G){all}   0.220120    0.004843    0.086182    0.354644    0.214568    601.67    637.31    1.001
r(A<->T){all}   0.089126    0.004753    0.000048    0.223559    0.073924    290.35    391.34    1.000
r(C<->G){all}   0.073526    0.002235    0.000046    0.163571    0.066036    550.33    654.35    1.000
r(C<->T){all}   0.166220    0.005205    0.035200    0.314279    0.162064    410.67    499.30    1.001
r(G<->T){all}   0.230435    0.006408    0.092269    0.402312    0.225563    374.74    400.40    1.000
pi(A){all}      0.244420    0.000145    0.219929    0.266937    0.244614    985.66   1157.76    1.000
pi(C){all}      0.300127    0.000177    0.274417    0.326478    0.300092   1101.08   1242.17    1.000
pi(G){all}      0.286067    0.000164    0.261366    0.311366    0.285865   1186.07   1313.16    1.000
pi(T){all}      0.169386    0.000114    0.148109    0.189948    0.169017   1300.49   1400.74    1.001
alpha{1,2}      1.133128    0.283218    0.368908    2.176399    1.011069   1363.10   1432.05    1.000
alpha{3}        1.683434    0.486166    0.619892    3.132187    1.569391   1501.00   1501.00    1.000
pinvar{all}     0.062227    0.002937    0.000022    0.169056    0.047610   1386.11   1425.45    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-524.950819
Model 2: PositiveSelection	-519.58982
Model 0: one-ratio	-531.723646
Model 7: beta	-526.167226
Model 8: beta&w>1	-519.592554


Model 0 vs 1	13.545654000000013

Model 2 vs 1	10.721997999999985

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)

            Pr(w>1)     post mean +- SE for w

    15 E      0.519         46.045
    16 V      0.986*        87.111
    18 I      0.872         77.083
    19 V      0.820         72.511
    21 V      0.739         65.340
    24 C      0.996**       87.959
    25 A      0.845         74.677
    27 S      0.992**       87.582
    28 L      0.942         83.262
    30 Q      0.999**       88.236
    32 I      0.948         83.716
    33 E      0.997**       88.096
    34 Y      0.960*        84.843
    35 Y      0.507         44.957
    36 Q      0.503         44.589
    39 D      0.546         48.339
    41 T      0.818         72.301
    42 S      0.999**       88.271
    43 T      0.968*        85.494
    45 P      0.766         67.721
    46 G      0.637         56.385
    47 L      0.988*        87.237
    48 M      0.521         46.145
    49 H      0.998**       88.149
    50 V      0.994**       87.774
    52 F      0.569         50.423
    53 G      0.984*        86.898
    54 P      0.877         77.476
    55 Y      0.539         47.786
    56 V      0.841         74.368
    59 F      0.993**       87.670
    60 D      0.843         74.545
    61 V      0.799         70.623
    62 D      0.994**       87.788
    64 K      0.997**       88.094
    65 K      0.918         81.142
    66 V      0.997**       88.026
    67 G      0.966*        85.337
    68 V      0.991**       87.536
    70 L      0.976*        86.248
    71 S      0.818         72.343

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)

            Pr(w>1)     post mean +- SE for w

    16 V      0.924         9.027 +- 2.542
    18 I      0.726         7.243 +- 4.087
    19 V      0.719         7.198 +- 4.074
    21 V      0.622         6.301 +- 4.440
    24 C      0.973*        9.451 +- 1.772
    25 A      0.744         7.420 +- 3.961
    27 S      0.952*        9.267 +- 2.150
    28 L      0.817         8.065 +- 3.583
    30 Q      0.988*        9.585 +- 1.420
    32 I      0.848         8.348 +- 3.333
    33 E      0.977*        9.487 +- 1.686
    34 Y      0.869         8.537 +- 3.137
    35 Y      0.519         5.369 +- 4.533
    41 T      0.664         6.683 +- 4.326
    42 S      0.992**       9.623 +- 1.303
    43 T      0.907         8.873 +- 2.758
    45 P      0.576         5.888 +- 4.489
    46 G      0.739         7.356 +- 4.015
    47 L      0.920         8.989 +- 2.594
    49 H      0.981*        9.529 +- 1.579
    50 V      0.959*        9.330 +- 2.031
    52 F      0.579         5.910 +- 4.495
    53 G      0.922         9.006 +- 2.566
    54 P      0.759         7.539 +- 3.944
    55 Y      0.538         5.535 +- 4.535
    56 V      0.750         7.468 +- 3.935
    59 F      0.950         9.253 +- 2.175
    60 D      0.728         7.266 +- 4.069
    61 V      0.662         6.666 +- 4.331
    62 D      0.956*        9.308 +- 2.068
    64 K      0.977*        9.491 +- 1.673
    65 K      0.869         8.528 +- 3.145
    66 V      0.976*        9.480 +- 1.704
    67 G      0.869         8.534 +- 3.138
    68 V      0.948         9.234 +- 2.208
    70 L      0.904         8.849 +- 2.779
    71 S      0.688         6.896 +- 4.235


Model 8 vs 7	13.149344000000156

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)

            Pr(w>1)     post mean +- SE for w

    15 E      0.520         46.146
    16 V      0.986*        87.225
    18 I      0.872         77.193
    19 V      0.818         72.464
    21 V      0.739         65.464
    24 C      0.996**       88.083
    25 A      0.843         74.638
    27 S      0.991**       87.700
    28 L      0.942         83.390
    30 Q      0.999**       88.363
    32 I      0.947         83.830
    33 E      0.997**       88.222
    34 Y      0.960*        84.936
    35 Y      0.507         45.031
    36 Q      0.503         44.654
    39 D      0.546         48.463
    41 T      0.818         72.419
    42 S      0.999**       88.399
    43 T      0.968*        85.613
    45 P      0.765         67.787
    46 G      0.637         56.427
    47 L      0.987*        87.351
    48 M      0.521         46.261
    49 H      0.998**       88.276
    50 V      0.994**       87.895
    52 F      0.569         50.513
    53 G      0.983*        87.002
    54 P      0.877         77.614
    55 Y      0.540         47.878
    56 V      0.840         74.322
    59 F      0.992**       87.790
    60 D      0.843         74.639
    61 V      0.799         70.743
    62 D      0.994**       87.903
    64 K      0.997**       88.218
    65 K      0.918         81.226
    66 V      0.997**       88.151
    67 G      0.966*        85.423
    68 V      0.991**       87.654
    70 L      0.976*        86.351
    71 S      0.818         72.446

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907708_1_2879_MLBR_RS13715)

            Pr(w>1)     post mean +- SE for w

    15 E      0.548         5.559 +- 4.591
    16 V      0.956*        9.287 +- 2.114
    18 I      0.797         7.848 +- 3.761
    19 V      0.807         7.938 +- 3.669
    21 V      0.697         6.932 +- 4.275
    24 C      0.985*        9.551 +- 1.505
    25 A      0.828         8.131 +- 3.518
    27 S      0.973*        9.441 +- 1.787
    28 L      0.871         8.520 +- 3.192
    30 Q      0.994**       9.630 +- 1.256
    32 I      0.899         8.775 +- 2.896
    33 E      0.988*        9.572 +- 1.444
    34 Y      0.919         8.956 +- 2.649
    35 Y      0.611         6.132 +- 4.496
    36 Q      0.588         5.929 +- 4.530
    39 D      0.570         5.757 +- 4.582
    41 T      0.739         7.314 +- 4.095
    42 S      0.996**       9.648 +- 1.192
    43 T      0.941         9.156 +- 2.350
    45 P      0.666         6.645 +- 4.358
    46 G      0.812         7.978 +- 3.654
    47 L      0.953*        9.266 +- 2.150
    48 M      0.505         5.174 +- 4.619
    49 H      0.990**       9.597 +- 1.368
    50 V      0.977*        9.478 +- 1.699
    52 F      0.664         6.620 +- 4.373
    53 G      0.956*        9.287 +- 2.108
    54 P      0.820         8.057 +- 3.616
    55 Y      0.625         6.260 +- 4.475
    56 V      0.833         8.172 +- 3.484
    59 F      0.972*        9.434 +- 1.803
    60 D      0.802         7.889 +- 3.727
    61 V      0.737         7.293 +- 4.105
    62 D      0.977*        9.480 +- 1.691
    63 A      0.548         5.549 +- 4.593
    64 K      0.989*        9.582 +- 1.413
    65 K      0.917         8.930 +- 2.685
    66 V      0.987*        9.568 +- 1.456
    67 G      0.919         8.955 +- 2.649
    68 V      0.971*        9.422 +- 1.832
    70 L      0.944         9.180 +- 2.302
    71 S      0.765         7.549 +- 3.952

>C1
MSEHNPAGAPGASTEVRVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLM
HVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTN
VVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGS
EEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKS
QVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKI
SKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPL
NLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQ
QLPDEIARAQLEEFIIDTK
>C2
MSEHNPAGAPGASTEVRVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLM
HVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTN
VVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGS
EEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKS
QVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKI
SKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPL
NLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQ
QLPDEIARAQLEEFIIDTK
>C3
MSEHNPAGAPGASTEVRVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLM
HVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTN
VVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGS
EEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKS
QVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKI
SKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPL
NLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQ
QLPDEIARAQLEEFIIDTK
>C4
MSEHNPAGAPGASTEVRVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLM
HVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTN
VVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGS
EEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKS
QVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKI
SKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPL
NLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQ
QLPDEIARAQLEEFIIDTK
>C5
MSEHNPAGAPGASTDSAFTGNPERPRSASDVMSEIVTGLSEFSLLSKNAE
QDASNVSAAITQRVNADTAAGGIRTRRWNQNIAooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooo
>C6
MSEHNPAGAPGASTEVRVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLM
HVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTN
VVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGS
EEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKS
QVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKI
SKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPL
NLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQ
QLPDEIARAQLEEFIIDTK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=381 

C1              MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
C2              MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
C3              MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
C4              MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
C5              MSEHNPAGAPGASTD--SAFTGNPERPRSASDVMSEIVTGLSEFSLLSKN
C6              MSEHNPAGAPGASTEVRVAIVG-------VGNCASSLVQGIEYY----QN
                **************:   *:.*       ..:  *.:* *:. :    :*

C1              AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
C2              AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
C3              AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
C4              AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
C5              AEQDASNVSAAITQRVNAD-------TAAGGIRTRRWNQNIAoooooooo
C6              AD-DTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
                *: *:*.*.. :  *...        .** .: ::: . :::        

C1              NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
C2              NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
C3              NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
C4              NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
C5              oooooooooooooooooooooooooooooooooooooooooooooooooo
C6              NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
                                                                  

C1              TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
C2              TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
C3              TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
C4              TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
C5              oooooooooooooooooooooooooooooooooooooooooooooooooo
C6              TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
                                                                  

C1              ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
C2              ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
C3              ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
C4              ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
C5              oooooooooooooooooooooooooooooooooooooooooooooooooo
C6              ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
                                                                  

C1              MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
C2              MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
C3              MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
C4              MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
C5              oooooooooooooooooooooooooooooooooooooooooooooooooo
C6              MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
                                                                  

C1              RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
C2              RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
C3              RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
C4              RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
C5              oooooooooooooooooooooooooooooooooooooooooooooooooo
C6              RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
                                                                  

C1              PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
C2              PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
C3              PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
C4              PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
C5              oooooooooooooooooooooooooooo---
C6              PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
                                               




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  369 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  369 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [22140]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [22140]--->[22138]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.528 Mb, Max= 31.156 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSEHNPAGAPGASTEVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLMHV
C2              MSEHNPAGAPGASTEVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLMHV
C3              MSEHNPAGAPGASTEVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLMHV
C4              MSEHNPAGAPGASTEVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLMHV
C5              MSEHNPAGAPGASTDSAFTGASDVMSEIVTGLSEFKNAEDASNVSAAITQ
C6              MSEHNPAGAPGASTEVAIVGVGNCASSLVQGIEYYQNADDTSTVPGLMHV
                **************: *:.*..:  *.:* *:. ::**:*:*.*.. :  

C1              RFGPYVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTNVVVQRGPTL
C2              RFGPYVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTNVVVQRGPTL
C3              RFGPYVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTNVVVQRGPTL
C4              RFGPYVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTNVVVQRGPTL
C5              RVNADTAAGGIRTRRWNQNIAooooooooooooooooooooooooooooo
C6              RFGPYVAAFDVDAKKVGVDLSDAIFTSENNTIKIADVPPTNVVVQRGPTL
                *... .** .: ::: . :::                             

C1              DGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGSEEADKFYAQ
C2              DGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGSEEADKFYAQ
C3              DGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGSEEADKFYAQ
C4              DGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGSEEADKFYAQ
C5              oooooooooooooooooooooooooooooooooooooooooooooooooo
C6              DGIGKYYTDTIELSDVPPVDVVQALTEAKTDVLVSYLPVGSEEADKFYAQ
                                                                  

C1              CAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKSQVGATITHR
C2              CAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKSQVGATITHR
C3              CAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKSQVGATITHR
C4              CAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKSQVGATITHR
C5              oooooooooooooooooooooooooooooooooooooooooooooooooo
C6              CAINARVAFVNALPVFIASDPVWAKKFADARVPIVGDDIKSQVGATITHR
                                                                  

C1              VMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKISKTQAVTSN
C2              VMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKISKTQAVTSN
C3              VMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKISKTQAVTSN
C4              VMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKISKTQAVTSN
C5              oooooooooooooooooooooooooooooooooooooooooooooooooo
C6              VMAKLFEDRGVQLDRTMQLNVGGNMDFLNMLERERVQSKKISKTQAVTSN
                                                                  

C1              VHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPLNLEYKLEVW
C2              VHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPLNLEYKLEVW
C3              VHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPLNLEYKLEVW
C4              VHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPLNLEYKLEVW
C5              oooooooooooooooooooooooooooooooooooooooooooooooooo
C6              VHREFNTKDIHIGPSDHVGWLDDRKWAYVRLEGRGFGDVPLNLEYKLEVW
                                                                  

C1              DSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQQLPDEIARA
C2              DSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQQLPDEIARA
C3              DSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQQLPDEIARA
C4              DSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQQLPDEIARA
C5              oooooooooooooooooooooooooooooooooooooooooooooooooo
C6              DSPNSAGVIIDAVRAAKIAKDRGIGGPVIPASSYLMKSPPQQLPDEIARA
                                                                  

C1              QLEEFII
C2              QLEEFII
C3              QLEEFII
C4              QLEEFII
C5              ooooooo
C6              QLEEFII
                       




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:75 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	  7.56 C1	 C5	  7.56
TOP	    4    0	  7.56 C5	 C1	  7.56
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	  7.56 C2	 C5	  7.56
TOP	    4    1	  7.56 C5	 C2	  7.56
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	  7.56 C3	 C5	  7.56
TOP	    4    2	  7.56 C5	 C3	  7.56
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	  7.56 C4	 C5	  7.56
TOP	    4    3	  7.56 C5	 C4	  7.56
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	  7.56 C5	 C6	  7.56
TOP	    5    4	  7.56 C6	 C5	  7.56
AVG	 0	 C1	  *	 81.51
AVG	 1	 C2	  *	 81.51
AVG	 2	 C3	  *	 81.51
AVG	 3	 C4	  *	 81.51
AVG	 4	 C5	  *	  7.56
AVG	 5	 C6	  *	 81.51
TOT	 TOT	  *	 69.19
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
C2              ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
C3              ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
C4              ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
C5              ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAT-----
C6              ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
                ********************************************      

C1              AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
C2              AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
C3              AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
C4              AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
C5              -TCCGCATTCACCGGCAACCCTGAGCGCCCGAGGAGCGCCAGCGACGTGA
C6              AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
                   .**.:* . ****                     *  .**.**   .

C1              CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
C2              CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
C3              CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
C4              CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
C5              TGTCAGAAATCGTGACCGGCCTGTCTGAGTTCTCACTGTTATCCAAGAAT
C6              CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
                 ***. ...*.** ...** .*  .  * *:*            .**** 

C1              GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
C2              GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
C3              GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
C4              GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
C5              GCTGAGCAAGACGCCAGTAATGTATCTGCTGCCATCACACAACGAGTCAA
C6              GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
                *****    ***.*.:  *.:**. * * *   ** ... :.**. **..

C1              ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
C2              ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
C3              ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
C4              ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
C5              CGCGGAC---------------------ACGGCCGCCGGTGGAATCAGAA
C6              ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
                . *  **                     . *** ***   *...*.....

C1              CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
C2              CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
C3              CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
C4              CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
C5              CCCGCCGGTGGAATCAGAACATTGCA------------------------
C6              CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
                **.. ..*   ..  :..**:*  *.                        

C1              AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
C2              AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
C3              AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
C4              AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
C5              --------------------------------------------------
C6              AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
                                                                  

C1              CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
C2              CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
C3              CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
C4              CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
C5              --------------------------------------------------
C6              CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
                                                                  

C1              TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
C2              TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
C3              TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
C4              TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
C5              --------------------------------------------------
C6              TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
                                                                  

C1              ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
C2              ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
C3              ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
C4              ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
C5              --------------------------------------------------
C6              ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
                                                                  

C1              GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
C2              GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
C3              GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
C4              GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
C5              --------------------------------------------------
C6              GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
                                                                  

C1              TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
C2              TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
C3              TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
C4              TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
C5              --------------------------------------------------
C6              TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
                                                                  

C1              GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
C2              GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
C3              GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
C4              GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
C5              --------------------------------------------------
C6              GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
                                                                  

C1              CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
C2              CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
C3              CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
C4              CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
C5              --------------------------------------------------
C6              CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
                                                                  

C1              TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
C2              TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
C3              TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
C4              TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
C5              --------------------------------------------------
C6              TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
                                                                  

C1              ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
C2              ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
C3              ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
C4              ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
C5              --------------------------------------------------
C6              ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
                                                                  

C1              CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
C2              CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
C3              CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
C4              CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
C5              --------------------------------------------------
C6              CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
                                                                  

C1              GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
C2              GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
C3              GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
C4              GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
C5              --------------------------------------------------
C6              GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
                                                                  

C1              CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
C2              CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
C3              CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
C4              CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
C5              --------------------------------------------------
C6              CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
                                                                  

C1              GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
C2              GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
C3              GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
C4              GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
C5              --------------------------------------------------
C6              GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
                                                                  

C1              TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
C2              TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
C3              TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
C4              TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
C5              --------------------------------------------------
C6              TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
                                                                  

C1              CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
C2              CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
C3              CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
C4              CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
C5              --------------------------------------------------
C6              CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
                                                                  

C1              GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
C2              GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
C3              GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
C4              GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
C5              -------------------------------------------
C6              GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
                                                           



>C1
ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
>C2
ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
>C3
ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
>C4
ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
>C5
ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAT-----
-TCCGCATTCACCGGCAACCCTGAGCGCCCGAGGAGCGCCAGCGACGTGA
TGTCAGAAATCGTGACCGGCCTGTCTGAGTTCTCACTGTTATCCAAGAAT
GCTGAGCAAGACGCCAGTAATGTATCTGCTGCCATCACACAACGAGTCAA
CGCGGAC---------------------ACGGCCGCCGGTGGAATCAGAA
CCCGCCGGTGGAATCAGAACATTGCA------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
-------------------------------------------
>C6
ATGAGTGAGCACAACCCAGCAGGGGCGCCAGGGGCGTCGACTGAGGTAAG
AGTAGCCATTGTCGGC---------------------GTGGGCAACTGCG
CGTCCTCGCTAGTTCAAGGTATCGAGTACTAC------------CAGAAC
GCTGAC---GACACATCGACAGTGCCCGGTCTTATGCACGTGCGGTTCGG
ACCCTACCATGTGCGTGATGTTAAATTCGTGGCGGCCTTCGACGTAGACG
CCAAGAAGGTCGGCGTAGACTTGTCGGACGCGATCTTCACCTCAGAGAAC
AACACCATCAAGATCGCCGACGTGCCACCCACCAATGTGGTGGTGCAGCG
CGGCCCAACACTGGACGGCATCGGCAAGTACTACACCGACACCATTGAGC
TGTCAGACGTTCCACCCGTCGACGTAGTCCAGGCACTAACAGAAGCCAAG
ACAGACGTGCTGGTGTCCTACCTGCCGGTGGGTTCCGAAGAAGCCGACAA
GTTCTATGCCCAGTGCGCCATCAACGCCCGCGTAGCGTTCGTGAACGCGC
TGCCGGTGTTCATCGCCTCCGACCCAGTGTGGGCCAAAAAATTCGCCGAC
GCCAGGGTACCGATCGTAGGTGATGACATTAAGAGCCAGGTCGGCGCAAC
CATCACTCACCGGGTGATGGCCAAGCTGTTTGAGGACCGCGGGGTGCAGC
TGGACCGCACCATGCAACTCAACGTGGGCGGCAACATGGACTTCCTGAAT
ATGCTCGAGCGCGAACGGGTGCAATCCAAGAAGATCTCCAAGACCCAGGC
CGTAACGTCGAACGTGCATCGGGAATTCAATACCAAAGACATCCACATCG
GTCCGTCAGACCACGTCGGCTGGCTCGATGACCGCAAATGGGCCTACGTC
CGACTGGAAGGCCGTGGTTTCGGCGATGTGCCGCTGAACCTCGAATACAA
GCTCGAGGTATGGGACTCACCGAACTCAGCGGGCGTCATCATCGACGCGG
TACGGGCAGCAAAGATAGCCAAGGACCGAGGGATCGGTGGACCAGTGATC
CCGGCTTCATCCTACCTGATGAAAAGCCCGCCGCAACAGCTACCCGACGA
GATCGCGCGTGCCCAGCTCGAAGAGTTCATCATCGACACCAAA
>C1
MSEHNPAGAPGASTEVRVAIVGoooooooVGNCASSLVQGIEYYooooQN
ADoDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
>C2
MSEHNPAGAPGASTEVRVAIVGoooooooVGNCASSLVQGIEYYooooQN
ADoDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
>C3
MSEHNPAGAPGASTEVRVAIVGoooooooVGNCASSLVQGIEYYooooQN
ADoDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
>C4
MSEHNPAGAPGASTEVRVAIVGoooooooVGNCASSLVQGIEYYooooQN
ADoDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
PASSYLMKSPPQQLPDEIARAQLEEFIIDTK
>C5
MSEHNPAGAPGASTDooSAFTGNPERPRSASDVMSEIVTGLSEFSLLSKN
AEQDASNVSAAITQRVNADoooooooTAAGGIRTRRWNQNIAoooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooo
>C6
MSEHNPAGAPGASTEVRVAIVGoooooooVGNCASSLVQGIEYYooooQN
ADoDTSTVPGLMHVRFGPYHVRDVKFVAAFDVDAKKVGVDLSDAIFTSEN
NTIKIADVPPTNVVVQRGPTLDGIGKYYTDTIELSDVPPVDVVQALTEAK
TDVLVSYLPVGSEEADKFYAQCAINARVAFVNALPVFIASDPVWAKKFAD
ARVPIVGDDIKSQVGATITHRVMAKLFEDRGVQLDRTMQLNVGGNMDFLN
MLERERVQSKKISKTQAVTSNVHREFNTKDIHIGPSDHVGWLDDRKWAYV
RLEGRGFGDVPLNLEYKLEVWDSPNSAGVIIDAVRAAKIAKDRGIGGPVI
PASSYLMKSPPQQLPDEIARAQLEEFIIDTK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1143 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579782469
      Setting output file names to "/data/10res/ML2692/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1908736119
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9748799519
      Seed = 1630401915
      Swapseed = 1579782469
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 23 unique site patterns
      Division 2 has 24 unique site patterns
      Division 3 has 23 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2789.445281 -- -24.965149
         Chain 2 -- -2789.445281 -- -24.965149
         Chain 3 -- -2789.445344 -- -24.965149
         Chain 4 -- -2789.445344 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2789.445243 -- -24.965149
         Chain 2 -- -2789.433124 -- -24.965149
         Chain 3 -- -2789.161589 -- -24.965149
         Chain 4 -- -2789.161589 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2789.445] (-2789.445) (-2789.445) (-2789.445) * [-2789.445] (-2789.433) (-2789.162) (-2789.162) 
        500 -- (-1868.917) (-1866.705) (-1861.510) [-1830.914] * [-1836.108] (-1842.719) (-1847.209) (-1837.484) -- 0:00:00
       1000 -- (-1841.211) [-1825.951] (-1832.096) (-1832.487) * (-1824.576) [-1830.594] (-1829.551) (-1829.814) -- 0:00:00
       1500 -- (-1830.373) (-1828.537) [-1832.029] (-1824.847) * (-1828.639) [-1823.934] (-1833.378) (-1828.061) -- 0:00:00
       2000 -- (-1822.152) [-1825.393] (-1827.161) (-1830.961) * (-1822.370) (-1831.503) [-1828.747] (-1838.236) -- 0:00:00
       2500 -- (-1823.232) [-1835.286] (-1839.098) (-1827.872) * (-1824.569) (-1824.646) (-1827.527) [-1830.458] -- 0:00:00
       3000 -- (-1822.741) (-1827.722) [-1826.994] (-1824.331) * (-1829.938) [-1828.440] (-1825.129) (-1829.269) -- 0:00:00
       3500 -- (-1829.929) (-1834.604) (-1832.920) [-1823.958] * [-1828.630] (-1834.582) (-1827.685) (-1829.725) -- 0:00:00
       4000 -- [-1824.858] (-1826.322) (-1819.475) (-1819.537) * (-1829.340) (-1831.101) [-1825.002] (-1831.756) -- 0:00:00
       4500 -- (-1826.871) (-1829.130) [-1821.238] (-1829.383) * (-1832.099) (-1831.284) [-1829.010] (-1837.144) -- 0:00:00
       5000 -- (-1830.343) (-1824.683) [-1822.890] (-1823.776) * (-1827.815) (-1824.648) (-1830.204) [-1829.976] -- 0:00:00

      Average standard deviation of split frequencies: 0.114280

       5500 -- (-1819.124) [-1821.574] (-1828.662) (-1830.579) * (-1825.093) (-1822.210) [-1830.676] (-1826.956) -- 0:00:00
       6000 -- [-1826.918] (-1823.664) (-1823.322) (-1827.975) * (-1824.855) (-1825.622) (-1830.628) [-1824.194] -- 0:00:00
       6500 -- (-1824.981) (-1828.558) [-1826.531] (-1830.483) * [-1828.241] (-1827.993) (-1822.667) (-1832.831) -- 0:02:32
       7000 -- (-1836.001) [-1817.984] (-1825.876) (-1826.735) * (-1838.721) (-1820.199) (-1821.791) [-1826.571] -- 0:02:21
       7500 -- (-1831.432) [-1822.928] (-1830.278) (-1834.656) * (-1837.129) (-1829.217) (-1822.764) [-1825.862] -- 0:02:12
       8000 -- (-1838.737) (-1824.907) [-1825.895] (-1829.304) * (-1824.742) (-1837.006) [-1823.628] (-1830.814) -- 0:02:04
       8500 -- (-1820.628) (-1831.546) [-1828.545] (-1824.955) * [-1823.785] (-1826.761) (-1822.702) (-1828.615) -- 0:01:56
       9000 -- [-1828.428] (-1831.422) (-1830.160) (-1832.692) * (-1826.213) (-1827.946) (-1825.264) [-1825.965] -- 0:01:50
       9500 -- (-1827.710) [-1818.494] (-1824.641) (-1831.335) * (-1837.274) (-1833.156) [-1822.113] (-1829.558) -- 0:01:44
      10000 -- (-1837.188) [-1822.175] (-1826.214) (-1831.824) * [-1827.645] (-1830.390) (-1826.721) (-1831.881) -- 0:01:39

      Average standard deviation of split frequencies: 0.082075

      10500 -- (-1825.972) [-1831.545] (-1823.184) (-1834.725) * (-1833.505) [-1823.014] (-1831.966) (-1838.365) -- 0:01:34
      11000 -- (-1840.619) (-1827.422) [-1835.190] (-1831.754) * (-1837.487) (-1823.379) (-1825.858) [-1824.929] -- 0:01:29
      11500 -- (-1832.751) [-1827.538] (-1823.632) (-1828.796) * (-1825.135) [-1821.677] (-1823.720) (-1819.281) -- 0:01:25
      12000 -- (-1824.747) (-1827.627) [-1830.501] (-1828.307) * (-1832.883) (-1821.100) (-1826.457) [-1821.591] -- 0:01:22
      12500 -- (-1834.875) (-1829.980) (-1831.000) [-1837.589] * (-1822.998) (-1822.426) [-1823.127] (-1820.942) -- 0:01:19
      13000 -- (-1826.538) [-1826.025] (-1829.427) (-1824.443) * (-1824.408) (-1825.281) [-1830.948] (-1825.982) -- 0:01:15
      13500 -- [-1828.137] (-1831.066) (-1827.144) (-1827.112) * [-1829.976] (-1826.002) (-1828.670) (-1827.177) -- 0:01:13
      14000 -- (-1827.368) [-1824.903] (-1824.960) (-1836.745) * (-1824.200) [-1823.662] (-1832.671) (-1823.751) -- 0:02:20
      14500 -- (-1826.243) (-1824.099) [-1823.117] (-1832.804) * (-1827.254) (-1828.014) (-1830.807) [-1826.827] -- 0:02:15
      15000 -- (-1831.577) (-1825.737) [-1824.700] (-1828.577) * (-1829.472) (-1821.834) [-1819.886] (-1823.494) -- 0:02:11

      Average standard deviation of split frequencies: 0.057452

      15500 -- (-1823.667) [-1823.803] (-1831.144) (-1832.324) * (-1834.445) (-1832.255) [-1821.486] (-1821.618) -- 0:02:07
      16000 -- (-1829.037) (-1833.575) (-1831.334) [-1830.210] * (-1824.793) (-1832.356) [-1821.847] (-1823.386) -- 0:02:03
      16500 -- (-1829.811) [-1819.710] (-1820.140) (-1829.600) * (-1830.332) [-1830.390] (-1831.524) (-1820.871) -- 0:01:59
      17000 -- (-1826.902) [-1823.414] (-1824.409) (-1829.047) * (-1826.120) [-1823.069] (-1821.005) (-1821.809) -- 0:01:55
      17500 -- (-1826.517) (-1831.103) [-1822.388] (-1829.150) * (-1824.575) [-1837.445] (-1825.658) (-1829.514) -- 0:01:52
      18000 -- (-1832.394) [-1828.366] (-1824.010) (-1832.010) * (-1825.484) (-1822.309) (-1823.645) [-1829.545] -- 0:01:49
      18500 -- (-1830.109) [-1823.305] (-1829.454) (-1833.618) * (-1825.121) (-1829.810) (-1829.896) [-1820.848] -- 0:01:46
      19000 -- [-1821.575] (-1830.034) (-1831.025) (-1831.468) * (-1827.943) (-1834.801) (-1824.527) [-1833.062] -- 0:01:43
      19500 -- (-1823.352) (-1827.495) (-1823.436) [-1823.779] * [-1829.952] (-1826.606) (-1828.384) (-1828.743) -- 0:01:40
      20000 -- (-1829.845) (-1824.397) [-1831.097] (-1822.842) * (-1826.140) (-1827.275) (-1830.117) [-1829.679] -- 0:01:38

      Average standard deviation of split frequencies: 0.053223

      20500 -- (-1823.549) (-1823.222) (-1831.800) [-1826.797] * (-1830.175) (-1832.241) [-1828.095] (-1822.150) -- 0:01:35
      21000 -- (-1828.127) [-1827.662] (-1827.237) (-1841.849) * (-1830.066) [-1823.949] (-1831.670) (-1827.280) -- 0:01:33
      21500 -- (-1821.758) (-1825.670) [-1822.357] (-1825.833) * (-1836.255) (-1828.013) [-1828.517] (-1834.315) -- 0:02:16
      22000 -- (-1824.409) (-1828.389) [-1819.360] (-1829.824) * (-1827.445) [-1831.651] (-1826.508) (-1823.532) -- 0:02:13
      22500 -- (-1827.596) [-1831.214] (-1824.590) (-1837.349) * (-1829.898) (-1835.432) (-1833.786) [-1821.439] -- 0:02:10
      23000 -- (-1826.216) [-1824.191] (-1827.364) (-1829.086) * (-1827.454) (-1826.906) (-1830.667) [-1822.188] -- 0:02:07
      23500 -- (-1831.199) (-1826.542) [-1824.989] (-1827.353) * (-1824.776) (-1820.471) (-1823.511) [-1816.139] -- 0:02:04
      24000 -- (-1825.735) (-1837.524) [-1822.610] (-1835.211) * (-1824.463) (-1823.626) [-1827.434] (-1824.649) -- 0:02:02
      24500 -- [-1831.521] (-1829.113) (-1836.489) (-1827.933) * (-1822.612) (-1825.850) (-1821.551) [-1826.434] -- 0:01:59
      25000 -- (-1826.272) (-1834.558) [-1827.706] (-1829.946) * (-1831.020) (-1822.326) [-1828.282] (-1831.266) -- 0:01:57

      Average standard deviation of split frequencies: 0.046510

      25500 -- [-1824.424] (-1831.136) (-1835.011) (-1829.850) * (-1831.440) (-1826.601) (-1825.748) [-1826.163] -- 0:01:54
      26000 -- (-1824.846) [-1825.238] (-1828.633) (-1828.927) * (-1826.481) [-1821.663] (-1824.468) (-1825.654) -- 0:01:52
      26500 -- [-1827.507] (-1832.323) (-1825.143) (-1827.399) * (-1829.381) [-1832.642] (-1828.946) (-1821.174) -- 0:01:50
      27000 -- (-1827.843) (-1829.577) (-1821.192) [-1823.867] * (-1825.780) (-1830.952) [-1821.892] (-1841.893) -- 0:01:48
      27500 -- (-1828.277) (-1826.930) [-1818.157] (-1828.433) * (-1822.598) [-1822.628] (-1830.075) (-1829.532) -- 0:01:46
      28000 -- (-1827.925) [-1834.736] (-1825.291) (-1824.050) * (-1823.217) (-1826.461) (-1825.991) [-1832.858] -- 0:01:44
      28500 -- [-1830.840] (-1826.547) (-1837.309) (-1823.717) * (-1830.295) [-1820.007] (-1825.499) (-1836.065) -- 0:01:42
      29000 -- (-1824.100) (-1832.009) (-1829.074) [-1822.495] * (-1825.557) (-1826.924) [-1826.135] (-1836.174) -- 0:02:13
      29500 -- (-1825.239) (-1827.078) (-1830.593) [-1821.504] * (-1819.861) [-1820.389] (-1827.628) (-1821.820) -- 0:02:11
      30000 -- (-1828.470) (-1828.305) [-1822.459] (-1825.764) * [-1823.135] (-1826.146) (-1832.127) (-1831.228) -- 0:02:09

      Average standard deviation of split frequencies: 0.053802

      30500 -- (-1822.680) (-1834.039) (-1827.569) [-1825.819] * (-1824.843) [-1827.188] (-1825.532) (-1832.560) -- 0:02:07
      31000 -- (-1832.547) (-1829.341) [-1825.715] (-1822.998) * (-1831.628) (-1831.865) [-1826.020] (-1828.981) -- 0:02:05
      31500 -- (-1826.375) (-1824.155) [-1828.022] (-1822.526) * (-1823.486) [-1820.653] (-1828.156) (-1828.953) -- 0:02:02
      32000 -- (-1828.782) (-1824.271) [-1829.391] (-1820.237) * (-1825.174) (-1827.911) [-1826.972] (-1830.162) -- 0:02:01
      32500 -- (-1823.800) (-1828.944) (-1828.735) [-1830.151] * [-1827.957] (-1826.900) (-1829.263) (-1824.191) -- 0:01:59
      33000 -- (-1828.690) (-1835.992) (-1833.673) [-1825.600] * (-1826.224) [-1827.099] (-1823.109) (-1820.343) -- 0:01:57
      33500 -- [-1828.395] (-1835.814) (-1824.919) (-1824.866) * [-1827.258] (-1830.611) (-1817.561) (-1829.938) -- 0:01:55
      34000 -- [-1830.082] (-1827.729) (-1829.213) (-1836.739) * (-1821.567) (-1827.772) [-1820.848] (-1832.012) -- 0:01:53
      34500 -- (-1827.480) (-1841.515) [-1826.826] (-1829.694) * (-1820.634) [-1819.861] (-1820.312) (-1829.921) -- 0:01:51
      35000 -- (-1829.592) [-1826.340] (-1829.085) (-1833.631) * [-1821.014] (-1825.325) (-1826.458) (-1834.340) -- 0:01:50

      Average standard deviation of split frequencies: 0.045236

      35500 -- (-1820.941) [-1827.020] (-1831.597) (-1837.147) * (-1822.147) [-1823.084] (-1823.947) (-1828.748) -- 0:01:48
      36000 -- (-1835.724) [-1827.469] (-1828.108) (-1822.311) * (-1836.557) [-1823.136] (-1823.464) (-1827.920) -- 0:01:47
      36500 -- (-1828.242) (-1832.578) [-1822.798] (-1831.905) * (-1823.709) (-1830.482) [-1828.720] (-1829.875) -- 0:02:11
      37000 -- (-1824.814) (-1829.208) [-1819.299] (-1834.471) * (-1833.760) (-1829.480) [-1825.703] (-1831.886) -- 0:02:10
      37500 -- (-1835.280) [-1826.550] (-1827.920) (-1828.659) * (-1831.414) (-1821.171) [-1822.013] (-1830.081) -- 0:02:08
      38000 -- (-1829.214) (-1831.927) [-1820.342] (-1828.316) * (-1833.072) (-1825.389) (-1825.367) [-1820.452] -- 0:02:06
      38500 -- (-1828.749) (-1842.938) (-1832.292) [-1826.836] * (-1836.714) (-1830.219) (-1835.663) [-1824.375] -- 0:02:04
      39000 -- (-1825.856) (-1828.506) (-1833.411) [-1835.855] * (-1831.057) (-1824.944) (-1831.710) [-1820.688] -- 0:02:03
      39500 -- [-1823.342] (-1839.117) (-1826.453) (-1823.576) * (-1827.036) (-1820.634) [-1824.135] (-1825.423) -- 0:02:01
      40000 -- [-1836.989] (-1834.212) (-1826.650) (-1822.879) * (-1828.651) [-1820.494] (-1822.393) (-1822.708) -- 0:02:00

      Average standard deviation of split frequencies: 0.043056

      40500 -- (-1819.598) (-1839.675) (-1828.989) [-1820.213] * (-1830.193) (-1828.788) [-1826.441] (-1829.849) -- 0:01:58
      41000 -- [-1830.196] (-1839.172) (-1830.207) (-1835.884) * (-1836.072) [-1822.960] (-1824.972) (-1830.594) -- 0:01:56
      41500 -- (-1826.547) (-1833.377) [-1823.229] (-1827.340) * (-1837.509) (-1821.582) [-1822.169] (-1825.437) -- 0:01:55
      42000 -- (-1821.834) [-1832.971] (-1821.909) (-1827.581) * (-1834.463) (-1820.704) (-1822.604) [-1828.485] -- 0:01:54
      42500 -- [-1824.878] (-1822.606) (-1825.826) (-1829.697) * (-1824.876) [-1821.787] (-1831.212) (-1823.234) -- 0:01:52
      43000 -- (-1822.441) (-1824.309) [-1826.373] (-1830.309) * (-1822.311) [-1823.058] (-1827.476) (-1824.175) -- 0:01:51
      43500 -- (-1823.530) (-1829.412) [-1823.272] (-1822.037) * (-1830.567) (-1822.379) (-1836.039) [-1826.735] -- 0:01:49
      44000 -- (-1823.272) (-1831.788) [-1829.973] (-1824.276) * (-1827.695) (-1825.644) (-1829.289) [-1824.974] -- 0:02:10
      44500 -- (-1826.962) (-1833.228) (-1822.750) [-1823.719] * (-1825.201) (-1829.982) (-1831.584) [-1821.046] -- 0:02:08
      45000 -- (-1824.521) (-1828.972) [-1827.184] (-1826.277) * (-1824.079) (-1832.718) [-1829.395] (-1824.925) -- 0:02:07

      Average standard deviation of split frequencies: 0.040992

      45500 -- (-1826.200) [-1823.464] (-1824.759) (-1821.653) * [-1825.170] (-1829.850) (-1828.011) (-1843.224) -- 0:02:05
      46000 -- (-1824.893) (-1827.491) (-1821.181) [-1825.083] * (-1824.372) (-1824.227) (-1829.308) [-1823.664] -- 0:02:04
      46500 -- (-1842.740) (-1820.463) [-1823.001] (-1823.867) * (-1834.223) (-1831.494) (-1829.407) [-1825.059] -- 0:02:03
      47000 -- (-1823.482) (-1818.182) [-1825.035] (-1827.390) * (-1827.030) (-1830.272) (-1828.745) [-1824.021] -- 0:02:01
      47500 -- (-1833.397) (-1825.652) [-1827.166] (-1826.685) * (-1833.249) (-1831.976) [-1822.331] (-1834.081) -- 0:02:00
      48000 -- [-1823.693] (-1824.176) (-1828.085) (-1821.332) * (-1830.725) (-1829.653) (-1829.036) [-1826.979] -- 0:01:59
      48500 -- [-1818.290] (-1827.480) (-1825.697) (-1836.795) * (-1823.232) [-1821.997] (-1826.508) (-1823.616) -- 0:01:57
      49000 -- (-1833.699) [-1822.908] (-1824.934) (-1823.315) * [-1824.099] (-1831.636) (-1823.022) (-1828.858) -- 0:01:56
      49500 -- (-1836.968) (-1828.894) (-1825.283) [-1822.527] * (-1832.686) (-1825.470) [-1828.164] (-1831.328) -- 0:01:55
      50000 -- [-1830.795] (-1823.348) (-1826.059) (-1824.780) * [-1831.248] (-1826.274) (-1829.190) (-1823.043) -- 0:01:54

      Average standard deviation of split frequencies: 0.036812

      50500 -- [-1828.352] (-1829.559) (-1826.170) (-1835.362) * (-1821.006) [-1824.122] (-1834.987) (-1834.496) -- 0:01:52
      51000 -- (-1827.440) [-1820.585] (-1831.004) (-1826.704) * (-1831.140) (-1831.473) [-1829.733] (-1838.507) -- 0:01:51
      51500 -- [-1822.151] (-1827.173) (-1822.378) (-1824.390) * [-1826.319] (-1828.081) (-1830.438) (-1822.958) -- 0:02:08
      52000 -- [-1828.429] (-1821.191) (-1826.819) (-1834.420) * (-1824.702) (-1828.259) (-1826.827) [-1824.972] -- 0:02:07
      52500 -- (-1829.126) (-1825.657) (-1825.650) [-1827.360] * [-1830.431] (-1832.302) (-1830.681) (-1825.445) -- 0:02:06
      53000 -- (-1831.927) [-1824.485] (-1827.840) (-1821.814) * (-1829.564) (-1827.089) (-1837.282) [-1826.260] -- 0:02:05
      53500 -- (-1827.206) (-1823.271) (-1822.478) [-1830.614] * (-1828.213) [-1829.448] (-1831.364) (-1826.928) -- 0:02:03
      54000 -- [-1831.966] (-1826.911) (-1829.636) (-1828.007) * (-1828.198) (-1828.590) [-1824.204] (-1826.342) -- 0:02:02
      54500 -- (-1830.947) (-1825.440) (-1828.017) [-1826.258] * [-1828.292] (-1825.792) (-1829.789) (-1828.014) -- 0:02:01
      55000 -- (-1829.126) [-1825.281] (-1831.610) (-1825.238) * (-1828.744) [-1829.183] (-1828.231) (-1836.221) -- 0:02:00

      Average standard deviation of split frequencies: 0.037115

      55500 -- (-1845.530) (-1834.511) (-1823.348) [-1817.827] * (-1829.935) (-1823.980) (-1834.463) [-1832.021] -- 0:01:59
      56000 -- (-1827.544) (-1830.351) [-1825.535] (-1825.351) * (-1826.757) (-1825.592) [-1830.841] (-1824.537) -- 0:01:58
      56500 -- [-1827.093] (-1841.181) (-1830.905) (-1828.330) * (-1823.349) [-1829.930] (-1831.897) (-1835.442) -- 0:01:56
      57000 -- [-1822.111] (-1824.525) (-1829.777) (-1820.762) * (-1834.860) (-1819.394) (-1823.524) [-1825.397] -- 0:01:55
      57500 -- (-1825.010) (-1824.485) [-1821.391] (-1824.218) * (-1826.591) [-1829.880] (-1840.429) (-1829.897) -- 0:01:54
      58000 -- [-1827.164] (-1824.167) (-1831.422) (-1826.452) * (-1835.570) (-1829.978) (-1831.855) [-1828.009] -- 0:01:53
      58500 -- [-1822.537] (-1821.822) (-1830.987) (-1831.533) * (-1819.272) [-1822.129] (-1826.582) (-1834.368) -- 0:01:52
      59000 -- (-1822.603) (-1828.540) (-1845.461) [-1823.614] * (-1830.239) (-1828.827) (-1835.957) [-1830.701] -- 0:02:07
      59500 -- (-1830.929) (-1821.580) (-1830.307) [-1820.122] * (-1837.031) (-1827.014) (-1828.453) [-1823.530] -- 0:02:06
      60000 -- (-1824.439) (-1822.531) (-1825.769) [-1823.901] * (-1832.037) [-1819.993] (-1821.866) (-1832.164) -- 0:02:05

      Average standard deviation of split frequencies: 0.034967

      60500 -- (-1831.642) (-1824.134) (-1828.199) [-1822.497] * (-1824.422) (-1820.699) [-1828.008] (-1828.975) -- 0:02:04
      61000 -- (-1830.007) [-1822.764] (-1842.837) (-1830.252) * [-1827.221] (-1825.337) (-1821.666) (-1831.010) -- 0:02:03
      61500 -- (-1828.561) [-1823.964] (-1834.925) (-1825.897) * (-1822.130) (-1823.061) [-1826.496] (-1825.251) -- 0:02:02
      62000 -- (-1832.518) (-1825.283) [-1823.040] (-1831.420) * (-1820.642) (-1825.373) (-1825.589) [-1833.087] -- 0:02:01
      62500 -- (-1831.615) (-1832.250) (-1828.270) [-1830.951] * (-1823.099) (-1831.592) (-1834.511) [-1827.327] -- 0:02:00
      63000 -- [-1820.860] (-1831.478) (-1830.495) (-1826.449) * (-1824.423) [-1823.011] (-1826.271) (-1830.728) -- 0:01:58
      63500 -- [-1826.666] (-1824.393) (-1828.804) (-1825.345) * (-1830.534) (-1824.761) (-1832.719) [-1833.193] -- 0:01:57
      64000 -- [-1821.612] (-1822.606) (-1827.779) (-1822.146) * (-1824.485) [-1824.765] (-1821.197) (-1831.009) -- 0:01:57
      64500 -- (-1829.169) (-1826.113) (-1829.735) [-1829.089] * (-1829.295) (-1831.185) [-1824.603] (-1830.119) -- 0:01:56
      65000 -- [-1825.496] (-1824.685) (-1827.590) (-1833.790) * (-1823.373) (-1823.932) [-1822.894] (-1827.613) -- 0:01:55

      Average standard deviation of split frequencies: 0.030744

      65500 -- (-1825.733) (-1827.029) [-1824.558] (-1822.057) * [-1822.890] (-1828.165) (-1821.795) (-1831.073) -- 0:01:54
      66000 -- [-1824.393] (-1826.805) (-1830.118) (-1824.157) * (-1828.070) [-1828.419] (-1825.682) (-1833.185) -- 0:01:53
      66500 -- [-1825.960] (-1833.878) (-1830.768) (-1828.999) * [-1828.883] (-1826.822) (-1818.683) (-1822.921) -- 0:02:06
      67000 -- [-1822.460] (-1833.251) (-1825.017) (-1838.076) * (-1828.669) (-1830.149) [-1821.395] (-1829.759) -- 0:02:05
      67500 -- (-1839.747) [-1827.858] (-1838.304) (-1833.365) * (-1829.614) (-1831.349) (-1823.644) [-1827.426] -- 0:02:04
      68000 -- (-1819.891) [-1833.268] (-1827.425) (-1825.116) * [-1827.955] (-1836.634) (-1834.418) (-1832.068) -- 0:02:03
      68500 -- (-1822.321) (-1823.744) [-1827.619] (-1823.523) * (-1821.327) [-1829.878] (-1827.028) (-1832.524) -- 0:02:02
      69000 -- (-1827.033) (-1823.328) (-1830.152) [-1831.603] * (-1829.868) (-1825.638) (-1822.409) [-1824.818] -- 0:02:01
      69500 -- (-1821.795) [-1833.675] (-1831.338) (-1830.502) * (-1830.795) [-1823.279] (-1826.555) (-1827.987) -- 0:02:00
      70000 -- (-1829.502) [-1823.600] (-1832.665) (-1830.156) * (-1836.581) (-1821.481) [-1826.444] (-1830.704) -- 0:01:59

      Average standard deviation of split frequencies: 0.023507

      70500 -- (-1824.043) (-1826.177) (-1826.678) [-1829.739] * (-1827.829) (-1827.119) (-1829.802) [-1819.547] -- 0:01:58
      71000 -- (-1824.462) (-1834.862) (-1822.375) [-1824.576] * (-1830.464) (-1826.380) (-1824.012) [-1820.338] -- 0:01:57
      71500 -- [-1819.273] (-1824.345) (-1826.594) (-1826.029) * (-1824.901) [-1821.447] (-1829.311) (-1822.433) -- 0:01:56
      72000 -- (-1823.064) (-1827.724) (-1820.281) [-1824.423] * (-1831.415) (-1827.854) (-1825.162) [-1821.449] -- 0:01:56
      72500 -- (-1827.958) (-1826.691) [-1825.186] (-1826.623) * (-1832.720) [-1827.231] (-1828.179) (-1840.535) -- 0:01:55
      73000 -- (-1824.953) (-1822.038) [-1830.246] (-1826.567) * [-1827.012] (-1829.772) (-1825.334) (-1833.548) -- 0:01:54
      73500 -- [-1831.720] (-1829.422) (-1832.140) (-1828.331) * (-1822.852) [-1818.987] (-1828.970) (-1831.537) -- 0:01:53
      74000 -- (-1824.337) (-1826.501) (-1831.681) [-1825.838] * (-1830.520) [-1822.865] (-1829.699) (-1829.896) -- 0:02:05
      74500 -- (-1833.851) (-1830.752) (-1825.985) [-1828.562] * (-1831.784) (-1824.433) [-1822.252] (-1831.625) -- 0:02:04
      75000 -- [-1821.200] (-1835.071) (-1837.219) (-1834.009) * (-1829.069) [-1820.770] (-1825.402) (-1828.119) -- 0:02:03

      Average standard deviation of split frequencies: 0.025939

      75500 -- (-1832.385) (-1821.882) [-1832.213] (-1827.536) * (-1823.998) (-1821.823) [-1828.428] (-1820.732) -- 0:02:02
      76000 -- [-1827.218] (-1838.101) (-1825.531) (-1828.109) * (-1826.208) (-1829.375) (-1828.618) [-1826.549] -- 0:02:01
      76500 -- [-1822.772] (-1832.938) (-1827.148) (-1828.431) * (-1839.156) [-1824.442] (-1826.034) (-1829.026) -- 0:02:00
      77000 -- [-1825.892] (-1823.848) (-1832.691) (-1830.943) * (-1837.887) [-1824.072] (-1827.714) (-1828.858) -- 0:01:59
      77500 -- (-1828.757) (-1828.812) [-1824.828] (-1827.788) * (-1828.065) (-1824.789) (-1829.880) [-1821.405] -- 0:01:59
      78000 -- (-1831.732) [-1826.044] (-1826.313) (-1831.143) * (-1831.439) [-1824.039] (-1825.123) (-1826.698) -- 0:01:58
      78500 -- (-1826.970) (-1828.896) (-1831.607) [-1823.569] * (-1828.423) (-1829.924) (-1828.347) [-1827.207] -- 0:01:57
      79000 -- (-1829.705) (-1841.658) [-1824.513] (-1833.983) * [-1835.319] (-1818.769) (-1839.300) (-1826.401) -- 0:01:56
      79500 -- (-1820.610) (-1829.453) [-1825.397] (-1831.615) * (-1831.559) (-1825.432) [-1825.993] (-1826.230) -- 0:01:55
      80000 -- [-1822.757] (-1827.729) (-1824.574) (-1830.971) * (-1827.320) (-1825.939) [-1822.702] (-1835.046) -- 0:01:55

      Average standard deviation of split frequencies: 0.022791

      80500 -- (-1832.415) (-1823.468) (-1822.243) [-1828.587] * (-1823.964) (-1819.671) [-1825.360] (-1826.043) -- 0:01:54
      81000 -- (-1831.046) [-1836.044] (-1825.848) (-1833.237) * (-1828.038) (-1822.876) [-1824.273] (-1827.313) -- 0:01:53
      81500 -- (-1830.595) [-1826.292] (-1831.731) (-1825.046) * [-1826.655] (-1826.048) (-1823.889) (-1831.685) -- 0:02:03
      82000 -- (-1826.908) (-1826.867) (-1829.698) [-1825.134] * (-1835.420) [-1820.460] (-1822.023) (-1821.315) -- 0:02:03
      82500 -- (-1832.134) (-1824.578) (-1825.346) [-1824.610] * (-1821.006) (-1824.931) [-1826.067] (-1831.978) -- 0:02:02
      83000 -- (-1829.678) [-1824.009] (-1823.913) (-1825.497) * (-1823.309) [-1823.241] (-1831.202) (-1825.178) -- 0:02:01
      83500 -- (-1827.269) (-1824.577) [-1826.403] (-1833.552) * (-1824.068) [-1824.564] (-1820.999) (-1832.965) -- 0:02:00
      84000 -- (-1831.749) [-1827.167] (-1821.793) (-1827.766) * (-1825.137) (-1823.661) [-1821.624] (-1834.761) -- 0:01:59
      84500 -- (-1824.466) [-1822.054] (-1833.684) (-1831.531) * (-1825.178) (-1835.265) (-1826.105) [-1827.407] -- 0:01:59
      85000 -- (-1824.521) (-1827.873) [-1822.284] (-1837.681) * [-1827.006] (-1832.114) (-1819.765) (-1825.839) -- 0:01:58

      Average standard deviation of split frequencies: 0.023117

      85500 -- (-1821.066) (-1827.975) (-1822.819) [-1819.234] * (-1826.281) (-1830.025) [-1818.268] (-1828.638) -- 0:01:57
      86000 -- (-1824.189) (-1839.896) (-1834.817) [-1821.588] * (-1830.990) [-1826.083] (-1830.019) (-1828.765) -- 0:01:56
      86500 -- (-1831.890) (-1823.884) (-1831.265) [-1824.764] * (-1823.580) (-1835.299) (-1826.203) [-1827.820] -- 0:01:56
      87000 -- (-1830.110) (-1825.848) [-1830.851] (-1825.276) * (-1822.318) (-1825.541) (-1826.937) [-1831.015] -- 0:01:55
      87500 -- [-1823.497] (-1823.440) (-1824.222) (-1819.965) * (-1836.522) (-1830.981) [-1820.227] (-1820.827) -- 0:01:54
      88000 -- (-1826.650) (-1824.396) [-1824.791] (-1825.950) * (-1821.150) (-1823.317) [-1825.482] (-1826.985) -- 0:01:54
      88500 -- [-1820.955] (-1829.756) (-1822.806) (-1824.837) * (-1836.550) (-1833.113) [-1823.217] (-1825.259) -- 0:01:53
      89000 -- (-1820.954) (-1823.626) [-1823.730] (-1836.413) * (-1827.634) (-1822.713) (-1829.937) [-1830.569] -- 0:02:02
      89500 -- [-1820.173] (-1823.640) (-1835.004) (-1827.666) * (-1820.594) [-1829.993] (-1825.836) (-1823.260) -- 0:02:02
      90000 -- [-1831.512] (-1823.351) (-1824.670) (-1824.315) * (-1830.616) [-1828.155] (-1832.840) (-1824.516) -- 0:02:01

      Average standard deviation of split frequencies: 0.020550

      90500 -- (-1829.992) (-1827.513) [-1828.705] (-1826.452) * (-1821.622) [-1829.167] (-1823.322) (-1823.180) -- 0:02:00
      91000 -- [-1827.182] (-1827.099) (-1822.899) (-1830.839) * (-1825.539) (-1822.626) (-1820.690) [-1822.494] -- 0:01:59
      91500 -- [-1823.596] (-1826.085) (-1836.233) (-1827.982) * [-1829.056] (-1824.087) (-1831.383) (-1825.107) -- 0:01:59
      92000 -- (-1829.293) (-1823.434) [-1827.201] (-1831.998) * (-1832.263) (-1828.866) [-1816.938] (-1836.337) -- 0:01:58
      92500 -- (-1824.801) (-1832.223) (-1827.109) [-1822.605] * [-1837.456] (-1831.887) (-1821.891) (-1829.005) -- 0:01:57
      93000 -- (-1824.683) (-1821.592) (-1827.518) [-1830.847] * (-1831.056) (-1831.342) [-1823.229] (-1829.012) -- 0:01:57
      93500 -- (-1821.406) (-1838.680) [-1828.307] (-1835.323) * (-1824.917) [-1822.595] (-1825.353) (-1824.130) -- 0:01:56
      94000 -- (-1824.012) (-1829.650) (-1829.312) [-1830.651] * (-1833.750) [-1827.665] (-1826.827) (-1829.658) -- 0:01:55
      94500 -- (-1826.517) [-1829.654] (-1834.158) (-1831.127) * (-1832.286) [-1822.284] (-1825.632) (-1828.806) -- 0:01:54
      95000 -- [-1824.572] (-1833.187) (-1822.109) (-1829.622) * (-1824.623) (-1825.214) (-1824.047) [-1824.501] -- 0:01:54

      Average standard deviation of split frequencies: 0.019419

      95500 -- (-1833.260) (-1831.720) [-1832.278] (-1822.001) * (-1827.613) (-1827.318) (-1831.679) [-1826.368] -- 0:01:53
      96000 -- (-1836.401) (-1822.880) (-1833.726) [-1825.084] * (-1829.392) [-1824.116] (-1829.405) (-1823.537) -- 0:01:53
      96500 -- (-1829.918) [-1824.018] (-1836.385) (-1821.956) * (-1824.155) (-1830.448) [-1823.530] (-1825.542) -- 0:02:01
      97000 -- (-1833.433) (-1829.924) [-1829.472] (-1827.303) * (-1829.334) (-1831.685) (-1842.028) [-1832.154] -- 0:02:01
      97500 -- (-1833.229) (-1827.728) [-1828.223] (-1825.356) * (-1820.824) (-1830.205) [-1826.224] (-1823.706) -- 0:02:00
      98000 -- (-1824.252) [-1822.712] (-1825.841) (-1823.929) * (-1829.751) [-1822.069] (-1827.783) (-1828.064) -- 0:01:59
      98500 -- (-1823.705) (-1828.779) [-1823.113] (-1828.564) * [-1827.504] (-1828.728) (-1832.218) (-1830.092) -- 0:01:58
      99000 -- (-1822.928) [-1822.990] (-1834.036) (-1838.593) * (-1834.065) [-1824.731] (-1826.427) (-1826.218) -- 0:01:58
      99500 -- (-1853.669) (-1824.280) [-1829.416] (-1829.632) * (-1834.251) (-1827.604) (-1827.022) [-1828.750] -- 0:01:57
      100000 -- (-1824.331) (-1827.984) [-1831.017] (-1828.228) * (-1834.058) (-1819.520) [-1823.683] (-1822.251) -- 0:01:56

      Average standard deviation of split frequencies: 0.024117

      100500 -- (-1829.792) (-1829.149) (-1838.482) [-1818.614] * (-1824.106) [-1823.256] (-1827.051) (-1822.617) -- 0:01:56
      101000 -- (-1829.070) (-1826.472) (-1826.418) [-1832.105] * (-1825.847) (-1828.340) (-1827.554) [-1830.229] -- 0:01:55
      101500 -- (-1829.088) (-1826.135) [-1828.650] (-1829.014) * (-1833.197) (-1833.934) (-1830.469) [-1818.498] -- 0:01:55
      102000 -- (-1827.236) (-1834.563) (-1832.062) [-1827.436] * (-1829.296) [-1823.390] (-1829.212) (-1827.971) -- 0:01:54
      102500 -- (-1821.335) [-1827.468] (-1827.018) (-1819.797) * (-1831.676) (-1823.300) [-1831.778] (-1823.770) -- 0:01:53
      103000 -- (-1824.568) (-1823.747) [-1823.040] (-1827.850) * (-1831.049) (-1822.942) (-1827.712) [-1828.722] -- 0:01:53
      103500 -- (-1836.961) [-1821.958] (-1830.506) (-1830.399) * [-1826.519] (-1822.888) (-1821.093) (-1826.900) -- 0:01:52
      104000 -- (-1822.956) (-1822.802) (-1832.109) [-1822.387] * [-1835.383] (-1823.017) (-1821.468) (-1826.708) -- 0:02:00
      104500 -- (-1833.566) (-1833.582) [-1820.469] (-1835.321) * (-1824.236) [-1825.402] (-1832.857) (-1822.783) -- 0:01:59
      105000 -- [-1831.566] (-1827.928) (-1829.624) (-1830.987) * (-1825.662) [-1822.287] (-1832.720) (-1826.068) -- 0:01:59

      Average standard deviation of split frequencies: 0.022640

      105500 -- (-1828.839) [-1832.866] (-1841.916) (-1835.663) * (-1834.986) (-1827.812) (-1836.804) [-1825.122] -- 0:01:58
      106000 -- (-1826.104) [-1823.268] (-1835.512) (-1833.585) * (-1829.527) (-1832.276) [-1823.419] (-1827.405) -- 0:01:58
      106500 -- (-1830.722) (-1829.147) [-1821.897] (-1828.015) * (-1824.433) [-1834.386] (-1835.513) (-1822.423) -- 0:01:57
      107000 -- (-1828.597) (-1821.776) [-1830.775] (-1824.253) * (-1824.933) [-1822.678] (-1829.928) (-1824.597) -- 0:01:56
      107500 -- (-1823.779) (-1822.362) [-1822.281] (-1830.400) * [-1827.950] (-1825.368) (-1828.493) (-1834.991) -- 0:01:56
      108000 -- (-1821.478) (-1823.513) [-1820.555] (-1827.946) * [-1824.960] (-1842.297) (-1827.269) (-1829.710) -- 0:01:55
      108500 -- (-1824.222) (-1829.555) (-1828.356) [-1825.541] * (-1823.627) (-1818.897) (-1831.143) [-1826.561] -- 0:01:55
      109000 -- (-1831.146) [-1828.951] (-1828.480) (-1823.182) * (-1832.540) [-1824.508] (-1827.827) (-1826.091) -- 0:01:54
      109500 -- (-1831.953) [-1820.467] (-1832.433) (-1824.259) * (-1831.534) (-1820.883) (-1828.349) [-1832.167] -- 0:01:53
      110000 -- (-1827.046) (-1822.410) [-1834.655] (-1827.501) * (-1825.688) [-1823.502] (-1827.448) (-1825.313) -- 0:01:53

      Average standard deviation of split frequencies: 0.020718

      110500 -- (-1828.229) (-1831.846) [-1832.910] (-1829.126) * (-1833.178) [-1823.505] (-1820.927) (-1828.719) -- 0:01:52
      111000 -- (-1828.096) [-1823.773] (-1823.005) (-1829.742) * (-1831.885) (-1823.352) (-1829.234) [-1832.792] -- 0:02:00
      111500 -- (-1831.336) (-1828.576) [-1824.030] (-1824.767) * [-1824.664] (-1824.971) (-1823.771) (-1835.313) -- 0:01:59
      112000 -- (-1835.479) (-1830.771) (-1825.507) [-1829.393] * [-1819.497] (-1820.869) (-1842.262) (-1822.875) -- 0:01:58
      112500 -- (-1824.859) (-1828.236) (-1828.088) [-1831.615] * [-1817.649] (-1827.460) (-1842.543) (-1840.335) -- 0:01:58
      113000 -- (-1828.489) (-1827.182) [-1821.944] (-1828.439) * (-1831.800) [-1820.976] (-1832.166) (-1835.903) -- 0:01:57
      113500 -- (-1828.843) (-1828.565) [-1827.916] (-1833.398) * [-1821.429] (-1834.195) (-1837.920) (-1827.024) -- 0:01:57
      114000 -- (-1833.864) (-1828.540) [-1838.043] (-1831.805) * (-1819.362) (-1825.976) [-1829.078] (-1829.642) -- 0:01:56
      114500 -- (-1835.483) (-1826.012) (-1828.935) [-1826.838] * (-1826.664) (-1825.203) (-1838.082) [-1821.234] -- 0:01:56
      115000 -- (-1833.526) (-1831.471) [-1825.542] (-1829.518) * (-1823.917) (-1825.067) (-1829.376) [-1828.753] -- 0:01:55

      Average standard deviation of split frequencies: 0.021058

      115500 -- (-1837.280) (-1830.673) (-1820.264) [-1828.266] * (-1826.030) (-1822.008) [-1836.062] (-1826.179) -- 0:01:54
      116000 -- (-1834.090) (-1826.341) (-1826.445) [-1824.101] * (-1823.816) [-1826.261] (-1841.701) (-1827.442) -- 0:01:54
      116500 -- (-1832.631) (-1820.431) [-1822.463] (-1821.491) * (-1822.408) (-1831.185) [-1828.349] (-1833.956) -- 0:01:53
      117000 -- (-1824.957) [-1830.443] (-1822.540) (-1834.184) * (-1821.214) [-1828.525] (-1822.760) (-1831.821) -- 0:01:53
      117500 -- (-1834.743) (-1825.135) (-1824.530) [-1825.260] * (-1824.309) (-1827.563) [-1825.608] (-1830.315) -- 0:01:52
      118000 -- (-1841.613) (-1828.098) [-1822.433] (-1830.328) * (-1829.424) (-1828.000) [-1829.119] (-1819.659) -- 0:01:52
      118500 -- (-1824.869) (-1822.329) [-1815.581] (-1842.482) * (-1830.790) (-1829.322) (-1829.495) [-1823.693] -- 0:01:59
      119000 -- (-1820.565) [-1826.489] (-1826.622) (-1823.846) * (-1825.231) [-1831.953] (-1831.481) (-1826.782) -- 0:01:58
      119500 -- (-1827.064) (-1825.823) [-1829.716] (-1826.160) * (-1822.212) (-1829.953) (-1827.581) [-1822.084] -- 0:01:57
      120000 -- (-1823.010) [-1827.967] (-1827.971) (-1822.517) * (-1828.257) (-1829.687) (-1836.174) [-1820.776] -- 0:01:57

      Average standard deviation of split frequencies: 0.022138

      120500 -- (-1825.422) (-1827.314) (-1827.306) [-1823.482] * [-1823.893] (-1826.161) (-1839.871) (-1820.665) -- 0:01:56
      121000 -- (-1824.884) (-1831.016) (-1832.929) [-1827.231] * (-1830.330) (-1833.685) [-1826.897] (-1827.829) -- 0:01:56
      121500 -- [-1823.113] (-1827.074) (-1831.978) (-1826.847) * (-1826.928) (-1829.137) [-1824.496] (-1833.844) -- 0:01:55
      122000 -- (-1821.899) (-1822.139) [-1828.467] (-1829.766) * (-1825.813) (-1832.773) (-1834.507) [-1823.918] -- 0:01:55
      122500 -- [-1826.793] (-1823.767) (-1823.991) (-1819.818) * (-1823.359) (-1820.243) [-1820.992] (-1827.567) -- 0:01:54
      123000 -- (-1834.183) (-1830.090) (-1826.614) [-1820.562] * (-1825.432) (-1824.609) [-1828.087] (-1826.190) -- 0:01:54
      123500 -- (-1819.826) (-1829.286) (-1827.317) [-1824.734] * (-1828.401) (-1829.891) (-1826.690) [-1827.420] -- 0:01:53
      124000 -- (-1832.152) [-1828.650] (-1824.756) (-1824.890) * (-1820.504) (-1826.961) (-1830.465) [-1826.633] -- 0:01:53
      124500 -- (-1829.597) [-1832.687] (-1822.451) (-1822.403) * (-1832.191) (-1835.714) (-1824.790) [-1821.533] -- 0:01:52
      125000 -- (-1831.018) (-1820.215) [-1827.062] (-1829.620) * (-1829.837) [-1831.403] (-1828.123) (-1832.589) -- 0:01:52

      Average standard deviation of split frequencies: 0.021379

      125500 -- (-1823.162) [-1826.343] (-1827.068) (-1833.867) * (-1827.436) (-1821.258) [-1826.548] (-1823.536) -- 0:01:51
      126000 -- (-1828.929) (-1834.333) (-1827.385) [-1826.804] * (-1819.684) [-1822.221] (-1829.471) (-1830.720) -- 0:01:57
      126500 -- (-1825.824) (-1831.246) [-1827.620] (-1833.640) * (-1827.104) (-1841.919) (-1829.623) [-1827.892] -- 0:01:57
      127000 -- (-1822.025) (-1829.606) [-1830.221] (-1827.435) * [-1823.482] (-1825.592) (-1832.012) (-1822.424) -- 0:01:56
      127500 -- (-1825.215) (-1824.552) [-1822.591] (-1824.915) * (-1832.975) [-1819.059] (-1820.599) (-1827.930) -- 0:01:56
      128000 -- (-1827.823) [-1823.901] (-1826.186) (-1825.161) * (-1824.349) [-1819.892] (-1832.862) (-1824.231) -- 0:01:55
      128500 -- (-1824.135) [-1822.382] (-1828.993) (-1826.381) * (-1834.576) (-1826.335) [-1827.996] (-1823.640) -- 0:01:55
      129000 -- (-1824.310) (-1829.529) [-1822.244] (-1822.325) * (-1827.951) [-1827.696] (-1829.441) (-1825.218) -- 0:01:54
      129500 -- (-1830.170) (-1821.605) [-1821.577] (-1827.134) * (-1824.286) (-1827.983) (-1826.251) [-1826.128] -- 0:01:54
      130000 -- (-1829.140) (-1822.215) (-1824.353) [-1822.795] * (-1834.934) [-1820.779] (-1826.712) (-1824.983) -- 0:01:53

      Average standard deviation of split frequencies: 0.021474

      130500 -- [-1823.738] (-1825.167) (-1825.508) (-1823.027) * (-1828.197) [-1826.094] (-1825.051) (-1835.761) -- 0:01:53
      131000 -- (-1824.379) [-1820.030] (-1828.831) (-1826.251) * (-1820.063) [-1825.481] (-1831.331) (-1828.168) -- 0:01:52
      131500 -- [-1824.317] (-1819.262) (-1828.788) (-1829.172) * (-1832.665) [-1823.013] (-1823.895) (-1834.886) -- 0:01:52
      132000 -- (-1822.782) (-1828.069) (-1826.112) [-1829.881] * (-1840.420) (-1828.142) [-1831.720] (-1824.598) -- 0:01:51
      132500 -- [-1825.975] (-1821.589) (-1831.810) (-1825.477) * [-1827.953] (-1833.654) (-1825.248) (-1823.538) -- 0:01:51
      133000 -- (-1829.785) (-1826.936) (-1837.442) [-1828.991] * (-1829.593) (-1828.677) [-1823.929] (-1825.546) -- 0:01:50
      133500 -- (-1828.496) [-1827.674] (-1829.995) (-1822.537) * (-1826.417) [-1827.557] (-1831.359) (-1827.120) -- 0:01:56
      134000 -- (-1828.132) [-1825.349] (-1827.595) (-1826.951) * [-1823.650] (-1832.290) (-1831.127) (-1829.181) -- 0:01:56
      134500 -- [-1827.122] (-1823.356) (-1825.527) (-1827.118) * [-1820.707] (-1823.952) (-1823.910) (-1825.464) -- 0:01:55
      135000 -- (-1822.778) [-1822.496] (-1824.082) (-1823.247) * (-1825.171) (-1822.838) [-1831.191] (-1833.701) -- 0:01:55

      Average standard deviation of split frequencies: 0.020467

      135500 -- (-1827.152) (-1831.437) (-1828.590) [-1828.391] * [-1825.246] (-1835.162) (-1826.074) (-1828.994) -- 0:01:54
      136000 -- (-1820.801) (-1827.146) (-1833.758) [-1834.680] * (-1825.572) [-1825.432] (-1821.545) (-1835.835) -- 0:01:54
      136500 -- [-1822.756] (-1825.489) (-1832.439) (-1826.383) * (-1822.501) (-1829.496) [-1822.506] (-1829.640) -- 0:01:53
      137000 -- (-1828.139) (-1824.065) (-1831.755) [-1825.195] * (-1829.606) (-1831.987) (-1825.872) [-1829.903] -- 0:01:53
      137500 -- (-1831.260) (-1823.757) (-1822.259) [-1822.989] * (-1824.224) (-1821.741) (-1831.481) [-1830.085] -- 0:01:52
      138000 -- (-1832.976) [-1825.601] (-1830.769) (-1827.138) * (-1824.505) (-1832.522) [-1819.430] (-1823.100) -- 0:01:52
      138500 -- (-1830.220) (-1822.658) (-1824.027) [-1823.196] * (-1831.126) (-1837.286) (-1828.772) [-1816.739] -- 0:01:51
      139000 -- [-1824.987] (-1822.722) (-1825.460) (-1829.178) * [-1829.520] (-1821.536) (-1824.970) (-1828.102) -- 0:01:51
      139500 -- [-1826.280] (-1830.545) (-1828.499) (-1831.116) * [-1828.476] (-1835.374) (-1826.784) (-1832.851) -- 0:01:51
      140000 -- (-1831.460) (-1828.921) (-1821.354) [-1823.863] * [-1823.573] (-1831.885) (-1825.600) (-1827.913) -- 0:01:50

      Average standard deviation of split frequencies: 0.021518

      140500 -- (-1825.937) (-1826.495) [-1822.365] (-1825.483) * [-1831.724] (-1827.511) (-1821.858) (-1831.072) -- 0:01:50
      141000 -- [-1823.850] (-1831.764) (-1829.640) (-1827.476) * (-1824.866) (-1825.740) (-1828.671) [-1819.207] -- 0:01:55
      141500 -- (-1826.880) (-1823.166) [-1822.548] (-1827.385) * (-1834.875) [-1828.270] (-1827.833) (-1821.101) -- 0:01:55
      142000 -- [-1820.330] (-1826.230) (-1830.148) (-1824.158) * [-1827.515] (-1828.339) (-1833.915) (-1825.549) -- 0:01:54
      142500 -- (-1825.398) [-1820.596] (-1831.918) (-1824.801) * [-1822.101] (-1832.904) (-1821.766) (-1828.344) -- 0:01:54
      143000 -- (-1831.329) (-1830.408) [-1820.619] (-1829.571) * (-1827.072) (-1835.518) (-1830.417) [-1829.112] -- 0:01:53
      143500 -- (-1828.979) [-1825.762] (-1823.268) (-1825.320) * (-1827.271) (-1824.687) (-1832.532) [-1828.905] -- 0:01:53
      144000 -- (-1827.214) [-1827.575] (-1838.769) (-1825.246) * (-1823.772) [-1823.224] (-1824.631) (-1826.711) -- 0:01:52
      144500 -- (-1825.087) (-1829.189) (-1829.766) [-1818.879] * (-1837.242) [-1825.941] (-1828.184) (-1828.098) -- 0:01:52
      145000 -- (-1829.713) (-1832.681) [-1819.565] (-1832.008) * (-1836.627) [-1827.102] (-1819.668) (-1823.614) -- 0:01:52

      Average standard deviation of split frequencies: 0.019988

      145500 -- (-1823.869) [-1830.957] (-1828.305) (-1825.170) * (-1829.894) (-1826.782) [-1827.114] (-1820.265) -- 0:01:51
      146000 -- [-1822.048] (-1830.325) (-1823.297) (-1821.991) * (-1830.113) (-1831.471) (-1830.017) [-1826.810] -- 0:01:51
      146500 -- [-1822.509] (-1834.353) (-1822.391) (-1822.744) * [-1822.739] (-1827.894) (-1829.216) (-1824.895) -- 0:01:50
      147000 -- (-1837.760) (-1850.338) (-1825.943) [-1818.026] * (-1821.435) (-1828.109) (-1818.926) [-1824.931] -- 0:01:50
      147500 -- [-1824.160] (-1823.287) (-1828.860) (-1827.127) * (-1826.302) (-1827.725) [-1818.934] (-1826.371) -- 0:01:49
      148000 -- (-1833.057) [-1828.678] (-1827.208) (-1828.547) * (-1820.828) [-1824.647] (-1829.146) (-1829.475) -- 0:01:49
      148500 -- (-1829.519) [-1828.861] (-1828.064) (-1829.334) * [-1828.089] (-1827.588) (-1826.639) (-1830.377) -- 0:01:54
      149000 -- [-1824.272] (-1827.922) (-1823.344) (-1822.576) * (-1822.934) (-1828.108) (-1836.865) [-1820.471] -- 0:01:54
      149500 -- [-1824.064] (-1826.043) (-1829.620) (-1832.866) * [-1821.178] (-1828.647) (-1826.169) (-1820.821) -- 0:01:53
      150000 -- [-1819.392] (-1826.626) (-1827.052) (-1830.594) * (-1826.164) [-1827.006] (-1829.287) (-1823.346) -- 0:01:53

      Average standard deviation of split frequencies: 0.019199

      150500 -- (-1826.715) (-1825.314) [-1819.409] (-1824.285) * (-1827.226) [-1820.151] (-1825.433) (-1824.233) -- 0:01:52
      151000 -- (-1823.407) (-1821.883) [-1823.716] (-1827.247) * (-1824.037) (-1828.413) [-1825.109] (-1825.553) -- 0:01:52
      151500 -- (-1824.484) (-1833.916) [-1825.915] (-1826.246) * (-1824.830) [-1822.819] (-1831.095) (-1832.565) -- 0:01:52
      152000 -- (-1822.494) (-1828.928) [-1825.296] (-1821.374) * [-1829.851] (-1826.737) (-1827.182) (-1825.903) -- 0:01:51
      152500 -- (-1820.465) [-1830.359] (-1831.897) (-1831.549) * (-1820.244) (-1825.331) (-1820.498) [-1825.527] -- 0:01:51
      153000 -- (-1826.156) (-1823.981) (-1825.061) [-1825.559] * (-1827.627) [-1823.400] (-1829.254) (-1832.459) -- 0:01:50
      153500 -- [-1821.427] (-1825.761) (-1835.619) (-1827.394) * [-1825.509] (-1828.424) (-1823.222) (-1830.490) -- 0:01:50
      154000 -- [-1822.831] (-1827.112) (-1822.189) (-1821.324) * (-1826.930) [-1825.934] (-1824.929) (-1832.187) -- 0:01:49
      154500 -- (-1822.537) [-1823.127] (-1826.492) (-1833.413) * (-1829.799) [-1829.280] (-1828.078) (-1832.166) -- 0:01:49
      155000 -- (-1839.385) (-1830.649) (-1828.926) [-1827.926] * (-1830.314) (-1830.037) (-1827.366) [-1827.582] -- 0:01:49

      Average standard deviation of split frequencies: 0.017829

      155500 -- (-1825.566) [-1824.962] (-1825.351) (-1834.685) * [-1828.590] (-1823.125) (-1827.080) (-1828.060) -- 0:01:48
      156000 -- (-1826.954) (-1823.854) (-1824.707) [-1824.017] * [-1819.652] (-1831.100) (-1826.980) (-1833.942) -- 0:01:53
      156500 -- (-1822.806) (-1829.999) [-1822.302] (-1828.866) * (-1827.198) [-1826.620] (-1828.146) (-1825.537) -- 0:01:53
      157000 -- [-1823.811] (-1824.410) (-1832.779) (-1832.047) * (-1824.496) (-1826.024) (-1822.286) [-1827.467] -- 0:01:52
      157500 -- (-1832.943) [-1826.353] (-1823.346) (-1829.242) * (-1826.471) (-1826.692) [-1817.076] (-1823.767) -- 0:01:52
      158000 -- (-1834.119) (-1826.137) (-1830.384) [-1829.141] * (-1830.281) (-1826.728) (-1823.763) [-1823.853] -- 0:01:51
      158500 -- (-1820.612) (-1842.531) [-1828.522] (-1828.580) * [-1823.005] (-1825.752) (-1824.556) (-1828.674) -- 0:01:51
      159000 -- (-1827.685) [-1826.988] (-1826.351) (-1826.533) * (-1828.765) (-1827.720) [-1820.903] (-1820.658) -- 0:01:51
      159500 -- (-1828.663) (-1824.809) (-1826.733) [-1826.449] * [-1821.550] (-1823.854) (-1829.350) (-1824.615) -- 0:01:50
      160000 -- (-1824.280) (-1832.467) [-1829.142] (-1828.634) * (-1825.747) (-1826.232) (-1827.268) [-1819.948] -- 0:01:50

      Average standard deviation of split frequencies: 0.017164

      160500 -- (-1822.902) (-1827.157) (-1829.786) [-1827.350] * (-1831.493) [-1822.684] (-1826.927) (-1825.221) -- 0:01:49
      161000 -- (-1823.824) (-1827.146) [-1826.071] (-1829.992) * (-1827.852) (-1820.956) (-1824.754) [-1826.109] -- 0:01:49
      161500 -- [-1820.605] (-1826.965) (-1839.067) (-1822.571) * (-1828.876) (-1822.717) (-1833.992) [-1826.779] -- 0:01:49
      162000 -- (-1824.744) (-1827.946) [-1822.131] (-1829.425) * (-1824.793) [-1826.105] (-1825.349) (-1836.322) -- 0:01:48
      162500 -- (-1821.030) (-1828.412) [-1823.420] (-1822.916) * [-1820.309] (-1835.847) (-1817.828) (-1833.061) -- 0:01:48
      163000 -- [-1824.631] (-1821.751) (-1830.705) (-1827.924) * (-1835.046) (-1823.518) [-1822.775] (-1829.056) -- 0:01:47
      163500 -- (-1826.031) [-1831.416] (-1829.568) (-1828.294) * (-1830.645) [-1822.318] (-1830.322) (-1828.117) -- 0:01:52
      164000 -- [-1822.963] (-1824.150) (-1832.085) (-1830.596) * (-1830.227) (-1826.478) [-1825.315] (-1826.130) -- 0:01:52
      164500 -- (-1825.586) (-1831.160) [-1829.493] (-1837.386) * [-1835.153] (-1840.129) (-1825.294) (-1835.444) -- 0:01:51
      165000 -- (-1831.678) (-1831.811) (-1832.741) [-1830.344] * (-1826.571) (-1826.847) [-1825.783] (-1821.604) -- 0:01:51

      Average standard deviation of split frequencies: 0.019202

      165500 -- (-1826.432) (-1823.388) [-1823.949] (-1838.595) * [-1828.467] (-1834.622) (-1824.471) (-1823.255) -- 0:01:50
      166000 -- (-1830.913) (-1825.715) [-1832.454] (-1821.426) * (-1827.534) (-1832.051) (-1830.706) [-1826.947] -- 0:01:50
      166500 -- (-1824.114) [-1824.978] (-1826.330) (-1830.526) * (-1827.636) [-1833.731] (-1828.036) (-1819.559) -- 0:01:50
      167000 -- (-1834.392) [-1830.376] (-1820.348) (-1839.578) * (-1841.405) (-1829.859) (-1826.888) [-1821.637] -- 0:01:49
      167500 -- (-1822.699) (-1830.396) (-1828.386) [-1821.876] * (-1821.841) [-1827.250] (-1820.825) (-1821.570) -- 0:01:49
      168000 -- (-1831.556) [-1825.582] (-1828.570) (-1825.998) * (-1830.712) (-1825.773) (-1825.097) [-1825.526] -- 0:01:48
      168500 -- [-1828.526] (-1830.104) (-1826.538) (-1829.384) * [-1823.298] (-1826.237) (-1825.704) (-1825.508) -- 0:01:48
      169000 -- (-1826.613) (-1821.874) (-1830.318) [-1818.773] * (-1822.833) [-1831.551] (-1825.993) (-1832.551) -- 0:01:48
      169500 -- [-1820.977] (-1822.807) (-1832.669) (-1824.622) * (-1826.764) (-1827.906) (-1826.947) [-1824.265] -- 0:01:47
      170000 -- (-1824.067) (-1831.168) (-1819.486) [-1828.849] * (-1829.254) (-1822.302) (-1835.646) [-1825.536] -- 0:01:47

      Average standard deviation of split frequencies: 0.019466

      170500 -- [-1821.982] (-1828.845) (-1828.540) (-1822.672) * (-1830.156) (-1829.973) [-1820.301] (-1830.470) -- 0:01:47
      171000 -- (-1838.725) (-1836.729) [-1822.040] (-1830.027) * (-1833.087) (-1828.431) [-1820.761] (-1831.616) -- 0:01:51
      171500 -- (-1828.662) (-1829.528) (-1822.852) [-1827.937] * (-1826.173) (-1827.054) (-1827.768) [-1824.137] -- 0:01:51
      172000 -- [-1824.968] (-1826.563) (-1825.823) (-1819.576) * (-1827.549) (-1825.140) [-1826.640] (-1819.798) -- 0:01:50
      172500 -- [-1826.703] (-1832.093) (-1836.317) (-1824.130) * (-1840.645) (-1830.441) (-1836.901) [-1821.810] -- 0:01:50
      173000 -- [-1825.835] (-1830.108) (-1829.431) (-1824.249) * [-1820.884] (-1828.100) (-1823.464) (-1824.730) -- 0:01:49
      173500 -- (-1823.176) [-1825.473] (-1828.886) (-1824.165) * [-1826.375] (-1826.842) (-1828.198) (-1826.714) -- 0:01:49
      174000 -- (-1826.188) (-1828.660) [-1824.600] (-1827.614) * [-1823.543] (-1829.060) (-1827.350) (-1823.207) -- 0:01:49
      174500 -- (-1825.363) [-1825.754] (-1832.623) (-1832.197) * [-1822.123] (-1823.628) (-1831.746) (-1828.402) -- 0:01:48
      175000 -- (-1826.931) [-1825.123] (-1828.069) (-1823.165) * (-1824.144) (-1823.889) (-1832.706) [-1826.172] -- 0:01:48

      Average standard deviation of split frequencies: 0.018347

      175500 -- [-1823.303] (-1827.931) (-1832.214) (-1823.682) * (-1833.161) [-1825.355] (-1822.838) (-1824.764) -- 0:01:48
      176000 -- (-1825.618) (-1827.041) [-1831.478] (-1834.629) * [-1821.836] (-1827.896) (-1838.105) (-1823.837) -- 0:01:47
      176500 -- (-1823.283) (-1824.511) (-1825.962) [-1827.640] * (-1830.826) [-1826.670] (-1826.710) (-1838.572) -- 0:01:47
      177000 -- [-1819.648] (-1828.609) (-1826.364) (-1833.965) * (-1822.778) (-1821.412) (-1833.626) [-1823.972] -- 0:01:46
      177500 -- (-1825.136) (-1829.855) [-1823.951] (-1833.749) * (-1830.113) [-1823.822] (-1830.105) (-1834.253) -- 0:01:46
      178000 -- (-1824.477) (-1829.011) [-1829.839] (-1826.865) * (-1822.569) (-1826.039) [-1826.895] (-1832.331) -- 0:01:46
      178500 -- (-1823.447) (-1831.167) [-1824.053] (-1827.041) * (-1822.649) (-1828.469) [-1822.102] (-1835.107) -- 0:01:50
      179000 -- (-1822.829) (-1820.452) (-1833.335) [-1828.678] * (-1836.935) [-1836.289] (-1838.511) (-1829.106) -- 0:01:50
      179500 -- (-1826.519) (-1827.640) (-1825.978) [-1824.027] * (-1829.486) (-1825.493) (-1824.167) [-1833.850] -- 0:01:49
      180000 -- (-1829.869) (-1831.006) (-1827.854) [-1825.075] * (-1834.098) [-1832.671] (-1827.855) (-1823.057) -- 0:01:49

      Average standard deviation of split frequencies: 0.017743

      180500 -- (-1829.194) (-1821.569) (-1821.288) [-1823.785] * (-1828.495) (-1837.568) [-1826.080] (-1826.022) -- 0:01:48
      181000 -- (-1826.547) (-1826.001) [-1822.926] (-1840.067) * (-1825.321) (-1830.488) (-1823.787) [-1830.458] -- 0:01:48
      181500 -- (-1832.005) (-1824.575) [-1822.723] (-1820.479) * [-1826.873] (-1826.294) (-1825.395) (-1832.279) -- 0:01:48
      182000 -- (-1830.921) (-1831.478) [-1832.331] (-1825.968) * (-1832.899) (-1838.951) [-1821.292] (-1825.222) -- 0:01:47
      182500 -- [-1823.646] (-1825.489) (-1828.555) (-1827.926) * [-1832.261] (-1826.942) (-1825.735) (-1823.750) -- 0:01:47
      183000 -- (-1827.872) (-1833.408) (-1827.807) [-1820.545] * (-1828.150) [-1825.053] (-1824.303) (-1828.565) -- 0:01:47
      183500 -- [-1826.045] (-1831.904) (-1843.383) (-1822.784) * (-1829.982) [-1822.303] (-1833.905) (-1834.649) -- 0:01:46
      184000 -- (-1827.865) (-1828.583) (-1828.930) [-1825.414] * (-1838.310) (-1822.444) [-1820.997] (-1834.803) -- 0:01:46
      184500 -- (-1829.205) [-1829.848] (-1829.103) (-1820.115) * [-1829.421] (-1837.560) (-1831.515) (-1830.185) -- 0:01:46
      185000 -- (-1828.185) [-1828.686] (-1826.888) (-1824.593) * (-1829.357) [-1829.555] (-1830.447) (-1830.856) -- 0:01:45

      Average standard deviation of split frequencies: 0.016807

      185500 -- (-1822.227) (-1832.007) [-1829.891] (-1829.239) * (-1833.135) (-1829.062) [-1829.689] (-1837.818) -- 0:01:45
      186000 -- (-1823.917) (-1824.344) (-1832.151) [-1825.576] * (-1830.064) (-1826.543) [-1824.690] (-1834.508) -- 0:01:49
      186500 -- (-1828.642) (-1825.203) [-1824.212] (-1830.710) * [-1824.168] (-1830.874) (-1833.610) (-1823.334) -- 0:01:49
      187000 -- (-1830.065) (-1823.715) (-1824.835) [-1825.196] * (-1825.107) (-1832.461) [-1828.423] (-1827.499) -- 0:01:48
      187500 -- [-1822.033] (-1826.577) (-1831.384) (-1827.239) * (-1827.965) (-1835.439) [-1837.306] (-1823.373) -- 0:01:48
      188000 -- (-1826.905) (-1832.930) [-1827.566] (-1827.855) * (-1832.039) (-1829.505) (-1837.005) [-1825.827] -- 0:01:47
      188500 -- (-1828.325) (-1831.022) [-1825.736] (-1827.604) * (-1826.860) [-1829.456] (-1829.124) (-1826.755) -- 0:01:47
      189000 -- (-1823.660) (-1826.143) (-1846.777) [-1821.810] * (-1823.604) [-1824.373] (-1835.213) (-1828.912) -- 0:01:47
      189500 -- (-1826.062) (-1828.880) [-1824.448] (-1824.588) * (-1829.379) (-1828.021) (-1831.461) [-1823.496] -- 0:01:46
      190000 -- (-1822.779) (-1824.066) (-1824.320) [-1822.094] * (-1826.236) (-1830.371) (-1825.325) [-1824.503] -- 0:01:46

      Average standard deviation of split frequencies: 0.017177

      190500 -- (-1822.777) [-1822.835] (-1819.937) (-1822.706) * (-1828.959) (-1827.768) (-1836.415) [-1825.928] -- 0:01:46
      191000 -- [-1824.601] (-1824.429) (-1819.299) (-1832.888) * (-1825.637) [-1834.444] (-1825.112) (-1828.988) -- 0:01:45
      191500 -- (-1825.615) (-1828.230) [-1822.690] (-1847.439) * (-1827.654) (-1846.830) (-1830.418) [-1826.455] -- 0:01:45
      192000 -- (-1832.781) (-1826.088) (-1826.317) [-1828.553] * [-1831.899] (-1826.305) (-1830.450) (-1819.621) -- 0:01:45
      192500 -- [-1825.881] (-1827.042) (-1827.728) (-1823.506) * (-1834.245) (-1833.499) (-1826.481) [-1827.222] -- 0:01:44
      193000 -- (-1829.480) (-1827.503) [-1822.397] (-1828.156) * (-1833.224) (-1834.121) (-1838.168) [-1827.117] -- 0:01:44
      193500 -- (-1828.392) [-1823.778] (-1827.240) (-1826.481) * (-1833.455) (-1832.969) (-1830.750) [-1825.839] -- 0:01:48
      194000 -- (-1826.814) (-1822.973) (-1827.290) [-1830.536] * [-1826.658] (-1835.561) (-1830.004) (-1822.986) -- 0:01:48
      194500 -- (-1823.264) (-1830.738) [-1834.279] (-1831.390) * (-1826.375) (-1835.281) (-1826.161) [-1823.845] -- 0:01:47
      195000 -- (-1835.692) (-1823.409) (-1823.182) [-1822.476] * (-1823.583) (-1831.382) [-1831.763] (-1836.232) -- 0:01:47

      Average standard deviation of split frequencies: 0.015823

      195500 -- (-1830.959) (-1836.344) [-1822.204] (-1828.985) * (-1821.979) [-1831.576] (-1832.233) (-1832.550) -- 0:01:46
      196000 -- (-1823.693) (-1829.992) [-1823.087] (-1839.719) * [-1824.101] (-1834.106) (-1837.943) (-1833.252) -- 0:01:46
      196500 -- (-1825.335) [-1836.022] (-1824.248) (-1826.734) * (-1831.014) [-1827.133] (-1826.412) (-1825.603) -- 0:01:46
      197000 -- (-1833.256) [-1827.207] (-1831.810) (-1833.999) * (-1833.596) (-1834.073) [-1826.677] (-1836.890) -- 0:01:45
      197500 -- (-1825.543) (-1831.834) [-1825.024] (-1826.507) * (-1829.386) (-1826.336) [-1825.429] (-1831.306) -- 0:01:45
      198000 -- [-1823.410] (-1834.528) (-1823.815) (-1836.817) * (-1824.114) [-1831.445] (-1837.317) (-1830.168) -- 0:01:45
      198500 -- (-1826.132) [-1834.308] (-1824.114) (-1833.475) * (-1829.810) (-1826.519) [-1842.491] (-1830.204) -- 0:01:44
      199000 -- (-1825.579) (-1832.083) [-1826.932] (-1826.961) * (-1822.007) [-1830.322] (-1830.982) (-1831.014) -- 0:01:44
      199500 -- (-1830.149) (-1830.028) (-1821.585) [-1828.250] * (-1827.834) (-1829.769) [-1822.595] (-1830.049) -- 0:01:44
      200000 -- (-1820.364) [-1823.019] (-1834.951) (-1832.254) * (-1831.685) [-1829.041] (-1832.404) (-1840.008) -- 0:01:43

      Average standard deviation of split frequencies: 0.014342

      200500 -- (-1826.095) [-1828.766] (-1829.206) (-1836.681) * (-1823.304) (-1840.496) (-1821.432) [-1824.248] -- 0:01:43
      201000 -- (-1821.483) (-1825.309) (-1831.677) [-1827.768] * [-1830.083] (-1827.583) (-1824.762) (-1831.106) -- 0:01:47
      201500 -- (-1825.800) [-1821.177] (-1834.071) (-1834.402) * (-1828.448) (-1834.139) [-1825.454] (-1828.002) -- 0:01:46
      202000 -- (-1821.981) (-1822.802) [-1837.003] (-1826.245) * (-1828.617) (-1827.456) [-1822.091] (-1822.521) -- 0:01:46
      202500 -- (-1824.284) (-1825.964) (-1829.194) [-1832.763] * (-1827.580) (-1827.327) (-1827.837) [-1822.551] -- 0:01:46
      203000 -- [-1830.154] (-1830.290) (-1839.737) (-1833.949) * (-1826.483) [-1827.012] (-1831.697) (-1827.027) -- 0:01:46
      203500 -- [-1833.968] (-1828.233) (-1831.572) (-1836.029) * (-1822.085) [-1831.233] (-1826.855) (-1827.215) -- 0:01:45
      204000 -- [-1827.364] (-1834.190) (-1830.590) (-1830.402) * [-1820.577] (-1825.988) (-1832.190) (-1822.837) -- 0:01:45
      204500 -- (-1823.919) (-1828.387) [-1824.198] (-1831.909) * [-1820.810] (-1824.648) (-1825.669) (-1828.028) -- 0:01:45
      205000 -- (-1828.084) [-1832.449] (-1825.764) (-1830.781) * (-1825.661) [-1827.977] (-1825.988) (-1824.806) -- 0:01:44

      Average standard deviation of split frequencies: 0.013273

      205500 -- [-1830.007] (-1834.478) (-1824.161) (-1828.421) * [-1825.716] (-1827.510) (-1828.067) (-1827.067) -- 0:01:44
      206000 -- (-1819.818) (-1830.561) [-1827.671] (-1822.256) * [-1820.384] (-1830.725) (-1828.225) (-1825.980) -- 0:01:44
      206500 -- [-1822.183] (-1830.032) (-1824.594) (-1836.509) * (-1826.112) [-1827.650] (-1829.809) (-1828.328) -- 0:01:43
      207000 -- (-1824.252) (-1840.100) (-1823.191) [-1829.247] * (-1825.292) [-1825.917] (-1829.405) (-1833.228) -- 0:01:43
      207500 -- (-1840.911) (-1826.205) (-1827.261) [-1828.436] * (-1832.443) [-1827.446] (-1827.078) (-1828.967) -- 0:01:43
      208000 -- (-1832.776) [-1826.846] (-1834.279) (-1835.440) * (-1825.814) [-1831.821] (-1835.021) (-1823.511) -- 0:01:42
      208500 -- (-1829.143) (-1829.683) [-1824.142] (-1827.881) * (-1828.259) (-1828.495) (-1824.406) [-1822.390] -- 0:01:46
      209000 -- (-1827.653) (-1825.475) (-1818.828) [-1825.524] * (-1824.551) (-1829.423) [-1826.823] (-1825.143) -- 0:01:45
      209500 -- (-1829.373) (-1824.660) (-1826.883) [-1823.172] * (-1832.902) [-1837.100] (-1828.167) (-1830.906) -- 0:01:45
      210000 -- (-1827.695) [-1822.919] (-1832.708) (-1826.763) * (-1830.114) [-1840.538] (-1828.002) (-1824.658) -- 0:01:45

      Average standard deviation of split frequencies: 0.014048

      210500 -- (-1830.998) (-1823.535) (-1823.558) [-1824.704] * (-1837.760) (-1836.159) (-1823.028) [-1829.694] -- 0:01:45
      211000 -- (-1828.110) [-1824.516] (-1825.546) (-1824.818) * (-1825.966) (-1823.089) (-1824.510) [-1825.078] -- 0:01:44
      211500 -- (-1827.429) (-1828.746) [-1819.026] (-1820.256) * (-1823.441) [-1826.855] (-1830.993) (-1824.535) -- 0:01:44
      212000 -- (-1823.799) (-1833.848) [-1823.300] (-1821.328) * [-1827.201] (-1825.847) (-1822.290) (-1820.596) -- 0:01:44
      212500 -- [-1824.964] (-1832.157) (-1824.838) (-1824.294) * (-1831.042) (-1821.166) [-1827.753] (-1827.345) -- 0:01:43
      213000 -- (-1824.886) (-1831.239) [-1823.251] (-1821.085) * (-1823.054) [-1821.126] (-1825.893) (-1820.869) -- 0:01:43
      213500 -- (-1824.336) [-1825.993] (-1820.258) (-1826.331) * (-1836.850) (-1828.742) (-1831.656) [-1826.808] -- 0:01:43
      214000 -- (-1830.462) (-1829.545) [-1825.592] (-1826.201) * (-1821.455) (-1831.666) (-1827.301) [-1822.713] -- 0:01:42
      214500 -- (-1826.773) [-1828.814] (-1825.950) (-1823.846) * (-1821.988) (-1822.590) (-1828.720) [-1829.541] -- 0:01:42
      215000 -- (-1821.875) (-1823.635) (-1827.545) [-1820.727] * (-1826.549) (-1833.737) [-1830.973] (-1822.886) -- 0:01:42

      Average standard deviation of split frequencies: 0.013504

      215500 -- (-1827.423) (-1829.087) [-1820.258] (-1822.981) * (-1827.514) [-1822.084] (-1824.963) (-1831.260) -- 0:01:41
      216000 -- (-1827.284) (-1819.930) [-1831.300] (-1824.176) * [-1829.307] (-1827.609) (-1823.358) (-1823.559) -- 0:01:45
      216500 -- (-1825.249) [-1823.499] (-1829.862) (-1818.873) * (-1826.668) (-1825.217) [-1822.644] (-1828.976) -- 0:01:44
      217000 -- (-1827.346) (-1828.164) (-1827.804) [-1825.865] * (-1829.140) [-1820.971] (-1823.182) (-1833.242) -- 0:01:44
      217500 -- (-1823.762) (-1822.272) (-1825.237) [-1825.159] * (-1827.065) (-1827.197) [-1820.006] (-1827.328) -- 0:01:44
      218000 -- (-1828.537) [-1827.051] (-1824.979) (-1823.123) * (-1828.556) [-1824.089] (-1830.321) (-1821.255) -- 0:01:44
      218500 -- (-1827.319) [-1818.992] (-1827.653) (-1825.287) * (-1825.502) [-1824.508] (-1823.687) (-1832.931) -- 0:01:43
      219000 -- (-1824.375) (-1826.743) (-1823.882) [-1821.424] * [-1826.288] (-1820.800) (-1823.820) (-1825.891) -- 0:01:43
      219500 -- (-1824.274) [-1828.631] (-1824.825) (-1824.657) * [-1826.687] (-1824.993) (-1822.370) (-1833.180) -- 0:01:43
      220000 -- (-1820.625) [-1823.292] (-1831.284) (-1822.631) * (-1824.125) (-1824.556) (-1826.692) [-1825.668] -- 0:01:42

      Average standard deviation of split frequencies: 0.013352

      220500 -- (-1826.458) (-1823.605) [-1825.388] (-1835.715) * (-1827.408) (-1819.911) (-1833.199) [-1825.409] -- 0:01:42
      221000 -- (-1829.693) (-1828.975) (-1827.532) [-1824.705] * (-1829.163) [-1823.000] (-1836.257) (-1829.555) -- 0:01:42
      221500 -- [-1825.875] (-1829.524) (-1830.102) (-1833.614) * [-1830.168] (-1824.355) (-1831.290) (-1823.607) -- 0:01:41
      222000 -- [-1824.172] (-1827.201) (-1825.068) (-1830.596) * (-1830.275) [-1829.214] (-1838.347) (-1829.488) -- 0:01:41
      222500 -- [-1824.869] (-1831.515) (-1825.651) (-1826.127) * (-1830.905) [-1823.901] (-1826.018) (-1832.940) -- 0:01:41
      223000 -- (-1825.419) [-1827.902] (-1829.013) (-1828.524) * (-1832.599) [-1825.136] (-1817.301) (-1830.448) -- 0:01:41
      223500 -- (-1830.531) (-1833.307) (-1826.367) [-1822.139] * [-1829.680] (-1828.132) (-1822.910) (-1825.193) -- 0:01:44
      224000 -- [-1822.174] (-1828.367) (-1831.942) (-1823.974) * (-1822.495) (-1821.777) [-1821.099] (-1842.521) -- 0:01:43
      224500 -- [-1826.836] (-1830.375) (-1830.751) (-1825.312) * (-1827.219) [-1822.187] (-1826.616) (-1823.244) -- 0:01:43
      225000 -- [-1824.141] (-1828.531) (-1827.828) (-1825.572) * (-1821.573) (-1830.207) [-1824.826] (-1820.229) -- 0:01:43

      Average standard deviation of split frequencies: 0.014233

      225500 -- [-1825.690] (-1831.207) (-1827.301) (-1832.618) * (-1829.517) (-1821.749) (-1825.361) [-1824.833] -- 0:01:43
      226000 -- [-1825.787] (-1824.524) (-1823.747) (-1820.166) * (-1818.650) [-1826.175] (-1827.453) (-1827.001) -- 0:01:42
      226500 -- (-1828.307) (-1823.795) (-1828.737) [-1823.412] * [-1830.264] (-1826.741) (-1838.277) (-1825.881) -- 0:01:42
      227000 -- (-1838.274) (-1828.743) (-1828.256) [-1823.123] * (-1824.944) (-1833.825) [-1829.036] (-1825.358) -- 0:01:42
      227500 -- (-1822.835) (-1825.393) (-1830.416) [-1820.854] * (-1826.463) [-1826.869] (-1827.762) (-1828.743) -- 0:01:41
      228000 -- (-1826.330) (-1827.942) (-1835.997) [-1825.344] * (-1826.713) [-1825.629] (-1831.145) (-1831.514) -- 0:01:41
      228500 -- (-1831.137) (-1825.705) (-1829.947) [-1831.407] * (-1826.820) [-1820.882] (-1833.885) (-1826.048) -- 0:01:41
      229000 -- [-1823.934] (-1825.892) (-1828.455) (-1825.897) * [-1821.777] (-1832.819) (-1826.764) (-1822.166) -- 0:01:41
      229500 -- (-1832.696) (-1834.937) [-1823.200] (-1822.548) * (-1830.957) (-1822.950) [-1821.605] (-1822.915) -- 0:01:40
      230000 -- (-1827.900) (-1830.284) [-1830.517] (-1826.393) * (-1824.732) (-1822.808) (-1825.279) [-1824.471] -- 0:01:40

      Average standard deviation of split frequencies: 0.014413

      230500 -- (-1825.142) (-1831.599) (-1827.781) [-1821.018] * (-1826.824) (-1827.261) (-1821.533) [-1822.988] -- 0:01:40
      231000 -- (-1824.084) (-1829.791) (-1833.365) [-1820.876] * (-1826.983) (-1828.548) (-1830.701) [-1828.520] -- 0:01:43
      231500 -- [-1821.876] (-1835.779) (-1835.843) (-1827.555) * (-1837.674) (-1830.786) (-1831.864) [-1822.309] -- 0:01:42
      232000 -- (-1823.104) (-1821.265) (-1831.343) [-1821.294] * (-1832.868) (-1825.113) [-1824.408] (-1822.767) -- 0:01:42
      232500 -- (-1827.455) (-1824.501) (-1841.163) [-1831.725] * (-1822.133) (-1824.549) (-1832.503) [-1821.602] -- 0:01:42
      233000 -- [-1825.086] (-1828.862) (-1836.803) (-1821.821) * [-1823.635] (-1829.174) (-1830.997) (-1820.364) -- 0:01:42
      233500 -- [-1824.492] (-1836.627) (-1833.334) (-1826.219) * (-1826.368) (-1823.313) [-1824.766] (-1822.890) -- 0:01:41
      234000 -- (-1829.854) (-1827.073) (-1830.622) [-1824.082] * [-1828.344] (-1819.152) (-1829.302) (-1822.400) -- 0:01:41
      234500 -- (-1826.724) (-1835.143) [-1825.164] (-1824.575) * [-1826.440] (-1828.917) (-1825.511) (-1839.153) -- 0:01:41
      235000 -- (-1829.545) [-1826.464] (-1821.798) (-1824.975) * (-1825.992) [-1819.076] (-1837.691) (-1828.230) -- 0:01:40

      Average standard deviation of split frequencies: 0.014981

      235500 -- (-1826.914) (-1823.456) (-1830.826) [-1822.381] * [-1826.310] (-1832.257) (-1833.892) (-1834.544) -- 0:01:40
      236000 -- (-1827.207) [-1824.877] (-1831.584) (-1831.686) * (-1822.120) (-1826.713) [-1821.433] (-1831.264) -- 0:01:40
      236500 -- (-1832.192) (-1821.795) (-1831.030) [-1823.548] * (-1829.181) (-1824.102) [-1820.250] (-1833.173) -- 0:01:40
      237000 -- (-1831.345) [-1821.511] (-1830.176) (-1822.721) * (-1829.639) [-1825.171] (-1834.821) (-1828.068) -- 0:01:39
      237500 -- [-1822.736] (-1824.486) (-1834.377) (-1828.290) * (-1830.517) [-1829.313] (-1825.731) (-1836.105) -- 0:01:39
      238000 -- (-1828.412) (-1832.848) [-1826.749] (-1832.044) * (-1826.699) (-1822.698) (-1826.267) [-1821.046] -- 0:01:39
      238500 -- (-1830.881) (-1829.370) [-1835.046] (-1825.742) * (-1833.465) (-1837.887) (-1841.026) [-1821.693] -- 0:01:42
      239000 -- (-1833.862) (-1818.583) [-1824.374] (-1835.527) * [-1827.138] (-1824.425) (-1829.789) (-1827.795) -- 0:01:41
      239500 -- (-1824.952) (-1828.186) (-1832.038) [-1832.392] * [-1827.280] (-1822.492) (-1831.121) (-1827.470) -- 0:01:41
      240000 -- (-1830.009) [-1830.008] (-1825.465) (-1826.989) * (-1824.989) [-1825.606] (-1830.078) (-1828.550) -- 0:01:41

      Average standard deviation of split frequencies: 0.015361

      240500 -- (-1822.735) (-1825.486) (-1828.130) [-1826.839] * [-1823.926] (-1832.514) (-1822.071) (-1817.671) -- 0:01:41
      241000 -- [-1823.690] (-1829.869) (-1826.847) (-1832.079) * (-1824.190) (-1835.456) (-1831.690) [-1830.950] -- 0:01:40
      241500 -- (-1819.925) (-1823.958) [-1824.797] (-1831.188) * [-1826.844] (-1825.909) (-1829.163) (-1828.543) -- 0:01:40
      242000 -- (-1824.603) (-1821.722) [-1818.008] (-1825.839) * (-1826.200) [-1827.777] (-1829.742) (-1824.707) -- 0:01:40
      242500 -- [-1820.404] (-1836.167) (-1825.711) (-1834.963) * [-1828.062] (-1827.464) (-1833.257) (-1827.507) -- 0:01:39
      243000 -- (-1829.699) (-1821.740) [-1827.706] (-1823.330) * [-1827.045] (-1825.165) (-1831.381) (-1831.648) -- 0:01:39
      243500 -- (-1825.262) (-1828.792) (-1827.617) [-1824.921] * (-1828.207) [-1827.907] (-1829.137) (-1831.113) -- 0:01:39
      244000 -- (-1826.595) (-1820.406) [-1825.704] (-1826.402) * (-1826.000) (-1827.704) [-1826.134] (-1825.372) -- 0:01:39
      244500 -- (-1828.446) (-1827.709) (-1824.173) [-1827.453] * (-1832.154) [-1825.332] (-1823.491) (-1824.039) -- 0:01:38
      245000 -- [-1822.169] (-1834.893) (-1832.123) (-1824.487) * (-1830.885) [-1823.733] (-1825.634) (-1835.563) -- 0:01:38

      Average standard deviation of split frequencies: 0.015229

      245500 -- (-1823.359) (-1831.162) [-1828.608] (-1827.292) * (-1830.213) (-1823.306) [-1828.865] (-1821.876) -- 0:01:41
      246000 -- (-1827.102) (-1838.085) (-1830.358) [-1824.973] * [-1828.407] (-1822.869) (-1824.849) (-1827.169) -- 0:01:41
      246500 -- (-1829.703) (-1825.856) [-1822.683] (-1819.656) * (-1831.817) [-1836.227] (-1820.486) (-1833.144) -- 0:01:40
      247000 -- (-1831.554) [-1823.370] (-1828.932) (-1826.346) * (-1829.978) [-1824.513] (-1830.236) (-1831.687) -- 0:01:40
      247500 -- (-1829.851) (-1828.798) [-1825.942] (-1827.887) * (-1838.985) (-1828.551) (-1828.391) [-1824.373] -- 0:01:40
      248000 -- (-1823.383) (-1835.122) [-1822.805] (-1823.850) * (-1821.100) (-1832.108) [-1828.234] (-1825.868) -- 0:01:40
      248500 -- [-1826.557] (-1829.712) (-1831.576) (-1825.264) * (-1826.252) (-1826.044) [-1828.274] (-1837.857) -- 0:01:39
      249000 -- (-1825.690) (-1835.662) (-1824.031) [-1825.320] * [-1830.024] (-1823.373) (-1832.864) (-1831.748) -- 0:01:39
      249500 -- [-1820.551] (-1831.881) (-1826.901) (-1823.546) * (-1829.753) (-1827.159) (-1822.533) [-1825.842] -- 0:01:39
      250000 -- (-1827.972) [-1833.976] (-1829.208) (-1823.945) * (-1831.517) (-1830.814) [-1819.804] (-1822.708) -- 0:01:39

      Average standard deviation of split frequencies: 0.015837

      250500 -- (-1824.267) (-1823.078) [-1825.062] (-1828.345) * (-1830.216) (-1840.235) (-1820.422) [-1825.645] -- 0:01:38
      251000 -- (-1827.520) (-1823.099) (-1820.228) [-1824.698] * (-1835.192) (-1826.609) (-1830.071) [-1822.322] -- 0:01:38
      251500 -- (-1819.506) (-1820.145) (-1827.735) [-1822.113] * [-1821.932] (-1826.583) (-1832.370) (-1830.591) -- 0:01:38
      252000 -- (-1823.786) (-1831.785) [-1822.986] (-1825.637) * (-1824.839) (-1833.072) (-1826.951) [-1825.123] -- 0:01:37
      252500 -- (-1832.000) (-1827.498) (-1829.226) [-1824.544] * [-1824.264] (-1834.094) (-1827.320) (-1826.301) -- 0:01:37
      253000 -- (-1826.675) [-1824.875] (-1829.521) (-1836.857) * [-1821.061] (-1825.064) (-1834.189) (-1829.745) -- 0:01:37
      253500 -- (-1836.698) (-1825.024) [-1825.929] (-1825.268) * (-1823.993) [-1820.290] (-1826.241) (-1832.300) -- 0:01:40
      254000 -- (-1826.930) (-1831.710) [-1826.173] (-1834.605) * (-1828.580) [-1820.272] (-1826.608) (-1828.216) -- 0:01:39
      254500 -- [-1825.687] (-1822.997) (-1827.715) (-1820.840) * (-1824.942) (-1829.914) (-1832.545) [-1831.808] -- 0:01:39
      255000 -- (-1841.402) (-1822.594) [-1826.167] (-1830.909) * (-1829.995) (-1824.767) [-1828.882] (-1837.615) -- 0:01:39

      Average standard deviation of split frequencies: 0.015652

      255500 -- (-1820.886) (-1824.950) [-1823.582] (-1827.351) * (-1830.217) [-1821.485] (-1823.623) (-1831.483) -- 0:01:39
      256000 -- (-1821.429) (-1829.778) [-1829.752] (-1818.826) * (-1821.525) [-1832.260] (-1826.069) (-1828.739) -- 0:01:38
      256500 -- (-1828.840) (-1826.416) [-1829.814] (-1826.042) * (-1828.830) (-1825.253) [-1831.467] (-1829.821) -- 0:01:38
      257000 -- (-1828.302) [-1826.167] (-1828.341) (-1834.726) * [-1825.710] (-1828.000) (-1825.022) (-1824.535) -- 0:01:38
      257500 -- (-1828.724) [-1823.177] (-1825.755) (-1832.924) * (-1828.771) (-1829.687) (-1827.244) [-1828.850] -- 0:01:38
      258000 -- (-1829.139) [-1825.447] (-1821.473) (-1824.675) * (-1833.937) (-1826.215) [-1836.999] (-1831.218) -- 0:01:37
      258500 -- (-1827.907) (-1828.524) [-1821.689] (-1831.517) * (-1833.731) [-1827.749] (-1826.456) (-1829.510) -- 0:01:37
      259000 -- (-1825.698) (-1828.159) [-1824.153] (-1827.979) * (-1837.550) (-1826.503) (-1834.324) [-1834.366] -- 0:01:37
      259500 -- [-1819.288] (-1833.969) (-1826.384) (-1831.075) * (-1826.159) [-1825.689] (-1827.178) (-1828.757) -- 0:01:37
      260000 -- (-1827.560) [-1822.727] (-1822.956) (-1824.929) * (-1827.629) (-1825.001) (-1831.429) [-1821.528] -- 0:01:36

      Average standard deviation of split frequencies: 0.015744

      260500 -- (-1825.695) (-1827.828) (-1825.212) [-1825.728] * (-1842.845) [-1826.003] (-1825.017) (-1827.814) -- 0:01:39
      261000 -- (-1821.993) [-1822.408] (-1835.867) (-1831.672) * (-1835.536) (-1826.262) (-1828.224) [-1826.010] -- 0:01:39
      261500 -- (-1819.133) [-1827.155] (-1826.989) (-1828.359) * (-1840.053) (-1828.397) [-1822.297] (-1832.188) -- 0:01:38
      262000 -- [-1825.326] (-1825.052) (-1820.635) (-1829.751) * [-1824.508] (-1835.852) (-1823.245) (-1831.753) -- 0:01:38
      262500 -- [-1824.911] (-1827.536) (-1835.009) (-1827.949) * (-1834.947) (-1828.280) [-1826.416] (-1825.135) -- 0:01:38
      263000 -- (-1824.726) [-1829.669] (-1830.161) (-1825.050) * (-1827.650) (-1831.511) [-1826.400] (-1822.910) -- 0:01:38
      263500 -- [-1824.195] (-1829.034) (-1828.969) (-1829.862) * (-1829.382) (-1821.163) (-1826.994) [-1826.178] -- 0:01:37
      264000 -- (-1828.980) (-1823.900) (-1826.971) [-1820.964] * [-1825.531] (-1823.256) (-1827.363) (-1828.156) -- 0:01:37
      264500 -- (-1833.202) [-1824.635] (-1844.899) (-1830.116) * (-1836.851) (-1821.313) [-1823.846] (-1831.999) -- 0:01:37
      265000 -- (-1829.317) [-1827.228] (-1826.415) (-1823.362) * (-1834.977) (-1823.643) (-1823.982) [-1827.880] -- 0:01:37

      Average standard deviation of split frequencies: 0.015637

      265500 -- (-1835.708) (-1827.227) (-1831.427) [-1824.261] * (-1831.171) (-1827.693) (-1819.331) [-1825.411] -- 0:01:36
      266000 -- (-1826.728) (-1824.746) [-1820.895] (-1838.403) * (-1822.760) [-1825.985] (-1827.446) (-1830.941) -- 0:01:36
      266500 -- (-1828.726) (-1835.704) (-1829.569) [-1825.855] * [-1826.093] (-1822.058) (-1821.994) (-1835.436) -- 0:01:36
      267000 -- (-1824.153) [-1822.621] (-1822.000) (-1829.570) * (-1835.328) (-1825.350) [-1829.411] (-1828.822) -- 0:01:36
      267500 -- (-1832.250) (-1835.899) (-1828.119) [-1823.372] * [-1822.948] (-1824.949) (-1826.654) (-1833.762) -- 0:01:35
      268000 -- [-1826.395] (-1826.564) (-1829.583) (-1830.542) * (-1824.831) (-1825.811) [-1834.315] (-1827.519) -- 0:01:38
      268500 -- (-1833.515) [-1828.610] (-1831.449) (-1822.464) * (-1824.427) [-1825.909] (-1835.003) (-1829.407) -- 0:01:38
      269000 -- (-1828.233) (-1825.367) (-1826.674) [-1825.147] * (-1826.656) [-1823.508] (-1829.781) (-1823.591) -- 0:01:37
      269500 -- (-1826.631) (-1824.323) [-1827.341] (-1830.814) * (-1830.251) (-1827.503) (-1835.337) [-1834.606] -- 0:01:37
      270000 -- [-1823.057] (-1836.343) (-1824.710) (-1840.178) * [-1828.827] (-1823.055) (-1822.575) (-1831.213) -- 0:01:37

      Average standard deviation of split frequencies: 0.016187

      270500 -- (-1828.390) (-1823.285) (-1831.651) [-1836.212] * (-1824.450) [-1825.080] (-1822.366) (-1827.409) -- 0:01:37
      271000 -- (-1825.698) (-1822.572) [-1822.966] (-1835.368) * (-1825.903) (-1830.219) (-1829.256) [-1823.864] -- 0:01:36
      271500 -- (-1832.344) (-1824.378) [-1836.037] (-1827.920) * (-1825.728) (-1834.888) (-1832.734) [-1825.954] -- 0:01:36
      272000 -- (-1828.650) (-1832.683) (-1827.001) [-1826.111] * [-1827.798] (-1825.971) (-1830.270) (-1835.774) -- 0:01:36
      272500 -- [-1830.680] (-1823.993) (-1828.210) (-1825.559) * (-1829.098) [-1829.327] (-1827.590) (-1834.307) -- 0:01:36
      273000 -- (-1825.618) [-1827.272] (-1820.267) (-1823.206) * (-1826.124) [-1827.356] (-1824.687) (-1821.004) -- 0:01:35
      273500 -- (-1824.537) [-1821.653] (-1824.566) (-1840.348) * (-1835.591) (-1827.809) [-1827.576] (-1823.023) -- 0:01:35
      274000 -- (-1825.770) [-1826.763] (-1827.544) (-1827.283) * (-1821.918) [-1831.482] (-1825.906) (-1827.662) -- 0:01:35
      274500 -- (-1833.448) [-1826.466] (-1833.926) (-1822.313) * [-1820.855] (-1832.258) (-1826.888) (-1823.774) -- 0:01:35
      275000 -- (-1822.811) (-1825.983) [-1826.557] (-1827.610) * (-1829.373) (-1830.854) (-1827.318) [-1827.544] -- 0:01:34

      Average standard deviation of split frequencies: 0.015774

      275500 -- (-1827.695) [-1822.991] (-1828.192) (-1838.824) * (-1828.674) (-1831.579) (-1824.427) [-1827.237] -- 0:01:37
      276000 -- (-1824.091) [-1824.918] (-1828.938) (-1822.311) * (-1828.695) (-1825.465) (-1831.954) [-1825.253] -- 0:01:37
      276500 -- (-1832.454) (-1826.496) [-1820.871] (-1826.068) * [-1830.204] (-1830.598) (-1837.415) (-1823.927) -- 0:01:36
      277000 -- (-1831.714) [-1827.325] (-1825.009) (-1822.974) * (-1836.920) [-1822.661] (-1826.248) (-1831.661) -- 0:01:36
      277500 -- [-1824.027] (-1830.148) (-1832.902) (-1828.418) * (-1827.109) (-1831.437) (-1824.007) [-1821.179] -- 0:01:36
      278000 -- [-1829.234] (-1829.867) (-1827.989) (-1826.139) * (-1835.592) (-1826.145) [-1824.820] (-1838.674) -- 0:01:36
      278500 -- (-1823.842) (-1825.506) [-1829.072] (-1827.981) * [-1830.193] (-1830.075) (-1824.841) (-1823.064) -- 0:01:35
      279000 -- (-1823.402) (-1831.577) [-1824.830] (-1828.286) * [-1824.326] (-1832.600) (-1830.122) (-1826.785) -- 0:01:35
      279500 -- (-1835.894) (-1821.711) (-1834.154) [-1820.209] * (-1833.510) [-1833.566] (-1829.933) (-1828.125) -- 0:01:35
      280000 -- [-1827.239] (-1824.044) (-1832.619) (-1824.137) * (-1822.173) (-1830.338) [-1825.882] (-1833.389) -- 0:01:35

      Average standard deviation of split frequencies: 0.014425

      280500 -- [-1823.065] (-1830.703) (-1827.104) (-1836.988) * (-1832.161) [-1826.850] (-1832.264) (-1827.567) -- 0:01:34
      281000 -- (-1835.802) (-1825.899) [-1826.189] (-1827.188) * [-1827.482] (-1827.132) (-1827.502) (-1835.915) -- 0:01:34
      281500 -- (-1824.598) [-1831.404] (-1822.303) (-1825.900) * [-1826.185] (-1828.150) (-1831.556) (-1835.733) -- 0:01:34
      282000 -- (-1831.000) [-1825.818] (-1830.305) (-1826.890) * (-1826.842) (-1822.011) [-1820.533] (-1834.545) -- 0:01:34
      282500 -- [-1825.341] (-1825.629) (-1831.874) (-1826.464) * (-1832.967) (-1825.319) [-1825.550] (-1821.453) -- 0:01:33
      283000 -- (-1822.397) [-1823.929] (-1823.772) (-1827.104) * (-1824.700) (-1840.771) [-1827.342] (-1835.041) -- 0:01:36
      283500 -- (-1825.013) (-1823.833) (-1822.197) [-1823.462] * [-1824.847] (-1833.235) (-1824.540) (-1827.859) -- 0:01:36
      284000 -- [-1824.967] (-1827.031) (-1822.833) (-1820.864) * (-1830.727) [-1823.793] (-1830.409) (-1823.331) -- 0:01:35
      284500 -- [-1829.072] (-1825.719) (-1834.377) (-1824.505) * (-1828.823) (-1826.651) (-1826.467) [-1825.487] -- 0:01:35
      285000 -- (-1832.788) [-1829.414] (-1834.279) (-1824.790) * (-1835.011) (-1825.752) (-1831.518) [-1820.629] -- 0:01:35

      Average standard deviation of split frequencies: 0.014102

      285500 -- (-1827.354) (-1827.623) (-1824.389) [-1824.520] * (-1822.715) [-1828.809] (-1825.145) (-1827.315) -- 0:01:35
      286000 -- (-1835.237) (-1824.847) [-1827.304] (-1828.347) * (-1825.739) (-1823.204) (-1822.462) [-1827.941] -- 0:01:34
      286500 -- (-1831.115) [-1826.999] (-1831.256) (-1827.003) * (-1824.560) (-1833.445) [-1825.503] (-1825.488) -- 0:01:34
      287000 -- (-1829.742) (-1829.503) (-1831.711) [-1829.445] * (-1830.311) (-1822.640) (-1819.226) [-1822.537] -- 0:01:34
      287500 -- (-1831.600) [-1819.780] (-1822.691) (-1835.707) * (-1824.595) [-1822.629] (-1833.782) (-1819.831) -- 0:01:34
      288000 -- (-1822.660) (-1824.799) [-1823.395] (-1825.530) * (-1825.155) [-1824.253] (-1829.647) (-1829.838) -- 0:01:33
      288500 -- (-1832.693) [-1823.985] (-1829.345) (-1829.164) * (-1826.433) [-1821.185] (-1825.074) (-1831.206) -- 0:01:33
      289000 -- (-1835.499) (-1830.934) (-1829.558) [-1818.357] * (-1829.482) (-1823.925) (-1835.209) [-1827.824] -- 0:01:33
      289500 -- (-1821.169) (-1827.169) (-1829.965) [-1832.577] * [-1828.986] (-1826.274) (-1825.448) (-1825.827) -- 0:01:33
      290000 -- (-1819.764) (-1829.883) [-1830.052] (-1827.527) * (-1824.119) (-1831.250) (-1832.049) [-1819.451] -- 0:01:33

      Average standard deviation of split frequencies: 0.014957

      290500 -- (-1822.795) (-1831.671) (-1828.278) [-1826.178] * [-1828.652] (-1831.322) (-1825.924) (-1833.969) -- 0:01:35
      291000 -- (-1821.417) [-1821.783] (-1843.962) (-1828.348) * (-1836.601) [-1826.470] (-1825.519) (-1823.540) -- 0:01:35
      291500 -- (-1828.513) (-1824.401) (-1833.332) [-1829.757] * [-1831.108] (-1826.710) (-1827.180) (-1828.967) -- 0:01:34
      292000 -- [-1827.717] (-1827.144) (-1827.685) (-1822.370) * [-1833.278] (-1821.304) (-1828.872) (-1829.387) -- 0:01:34
      292500 -- (-1820.342) (-1834.078) [-1821.831] (-1825.504) * (-1830.908) (-1822.283) (-1828.250) [-1829.091] -- 0:01:34
      293000 -- (-1830.820) [-1828.058] (-1832.517) (-1838.414) * (-1833.287) (-1826.380) [-1826.889] (-1828.477) -- 0:01:34
      293500 -- [-1824.680] (-1828.424) (-1829.519) (-1822.920) * [-1831.263] (-1821.500) (-1826.783) (-1842.908) -- 0:01:33
      294000 -- (-1830.845) (-1824.561) [-1830.820] (-1831.018) * (-1830.657) (-1830.537) [-1824.163] (-1832.879) -- 0:01:33
      294500 -- (-1828.402) (-1826.105) (-1821.294) [-1828.188] * (-1826.076) (-1830.276) (-1834.975) [-1828.999] -- 0:01:33
      295000 -- (-1841.138) (-1827.615) [-1825.188] (-1830.976) * (-1832.814) (-1835.272) [-1821.518] (-1833.416) -- 0:01:33

      Average standard deviation of split frequencies: 0.013584

      295500 -- (-1827.473) (-1827.985) [-1821.534] (-1829.566) * (-1831.270) (-1832.637) [-1822.192] (-1826.586) -- 0:01:32
      296000 -- (-1826.740) [-1836.178] (-1823.268) (-1829.659) * (-1827.308) (-1838.871) [-1821.514] (-1830.755) -- 0:01:32
      296500 -- (-1829.536) [-1819.319] (-1822.313) (-1834.525) * (-1826.540) (-1826.033) (-1825.100) [-1829.148] -- 0:01:32
      297000 -- (-1831.872) (-1824.595) [-1831.218] (-1828.805) * (-1825.862) (-1827.636) (-1818.881) [-1823.860] -- 0:01:32
      297500 -- (-1836.488) (-1826.594) (-1824.109) [-1819.175] * (-1823.322) (-1827.437) [-1829.435] (-1820.541) -- 0:01:32
      298000 -- [-1828.506] (-1830.781) (-1822.459) (-1823.604) * (-1824.404) [-1822.420] (-1834.005) (-1830.324) -- 0:01:34
      298500 -- (-1834.356) [-1821.069] (-1827.710) (-1826.255) * (-1821.890) [-1824.642] (-1833.249) (-1827.885) -- 0:01:34
      299000 -- (-1834.214) [-1822.770] (-1817.435) (-1827.928) * (-1828.328) (-1829.919) (-1837.974) [-1825.511] -- 0:01:33
      299500 -- (-1826.434) [-1837.719] (-1824.395) (-1821.101) * (-1828.059) (-1834.293) [-1829.682] (-1830.571) -- 0:01:33
      300000 -- (-1832.344) (-1825.740) [-1826.285] (-1823.112) * (-1837.406) [-1823.861] (-1839.519) (-1825.860) -- 0:01:33

      Average standard deviation of split frequencies: 0.014387

      300500 -- [-1829.839] (-1823.287) (-1828.177) (-1826.517) * (-1824.665) (-1846.378) (-1828.672) [-1822.079] -- 0:01:33
      301000 -- (-1835.549) (-1835.718) [-1826.132] (-1830.854) * (-1830.429) [-1825.502] (-1828.937) (-1829.078) -- 0:01:32
      301500 -- (-1823.992) (-1823.055) [-1820.227] (-1828.004) * [-1823.107] (-1823.499) (-1833.989) (-1830.929) -- 0:01:32
      302000 -- [-1825.254] (-1830.344) (-1819.422) (-1825.645) * (-1826.453) (-1819.166) (-1822.229) [-1822.683] -- 0:01:32
      302500 -- (-1833.365) (-1828.611) (-1830.409) [-1822.663] * (-1828.584) [-1828.985] (-1843.014) (-1823.789) -- 0:01:32
      303000 -- [-1825.818] (-1833.740) (-1835.078) (-1822.197) * (-1834.548) [-1822.280] (-1836.109) (-1823.347) -- 0:01:32
      303500 -- (-1832.608) (-1830.921) [-1824.370] (-1828.830) * (-1830.921) (-1823.070) (-1827.111) [-1824.453] -- 0:01:31
      304000 -- [-1826.218] (-1834.349) (-1824.477) (-1822.631) * [-1828.894] (-1827.988) (-1836.389) (-1824.448) -- 0:01:31
      304500 -- [-1824.446] (-1827.599) (-1821.051) (-1828.903) * (-1828.147) (-1823.237) (-1837.073) [-1826.723] -- 0:01:31
      305000 -- (-1824.120) (-1827.490) (-1825.461) [-1823.286] * [-1816.819] (-1828.222) (-1829.835) (-1833.091) -- 0:01:31

      Average standard deviation of split frequencies: 0.013480

      305500 -- (-1827.882) [-1826.821] (-1822.479) (-1826.553) * (-1825.557) [-1823.904] (-1829.489) (-1821.327) -- 0:01:33
      306000 -- [-1829.031] (-1829.994) (-1840.770) (-1838.255) * (-1824.169) (-1826.430) (-1828.751) [-1826.088] -- 0:01:32
      306500 -- (-1833.884) (-1829.062) (-1822.294) [-1827.382] * (-1833.656) [-1821.499] (-1827.076) (-1826.722) -- 0:01:32
      307000 -- (-1837.511) (-1834.671) (-1824.339) [-1829.604] * (-1831.402) (-1833.299) [-1824.894] (-1821.325) -- 0:01:32
      307500 -- (-1830.028) (-1833.377) (-1827.500) [-1832.648] * (-1824.648) (-1831.184) (-1828.952) [-1825.689] -- 0:01:32
      308000 -- (-1830.342) (-1827.612) [-1828.185] (-1828.341) * (-1831.138) (-1836.856) (-1826.440) [-1822.567] -- 0:01:32
      308500 -- (-1825.820) [-1832.842] (-1826.252) (-1826.682) * (-1833.119) (-1824.672) (-1827.060) [-1822.925] -- 0:01:31
      309000 -- (-1839.415) (-1830.921) (-1829.325) [-1832.087] * (-1822.281) (-1830.814) [-1823.558] (-1821.882) -- 0:01:31
      309500 -- (-1825.006) (-1823.016) (-1824.320) [-1821.070] * [-1822.048] (-1828.457) (-1821.546) (-1826.366) -- 0:01:31
      310000 -- (-1824.864) (-1823.662) (-1826.433) [-1827.794] * [-1829.441] (-1831.859) (-1833.766) (-1829.218) -- 0:01:31

      Average standard deviation of split frequencies: 0.013182

      310500 -- (-1832.103) (-1837.369) (-1832.791) [-1826.022] * (-1823.271) [-1823.229] (-1826.913) (-1825.093) -- 0:01:31
      311000 -- (-1823.844) (-1826.178) [-1823.341] (-1829.574) * [-1833.359] (-1822.787) (-1828.595) (-1835.372) -- 0:01:30
      311500 -- [-1822.591] (-1828.406) (-1825.129) (-1838.657) * [-1826.966] (-1821.763) (-1825.795) (-1836.447) -- 0:01:30
      312000 -- [-1826.554] (-1825.858) (-1822.848) (-1829.107) * (-1824.745) (-1825.914) [-1822.774] (-1824.222) -- 0:01:30
      312500 -- (-1836.805) (-1828.931) [-1831.355] (-1822.576) * (-1824.816) (-1825.602) [-1830.184] (-1830.996) -- 0:01:30
      313000 -- (-1822.636) (-1832.909) [-1820.487] (-1827.402) * (-1827.908) (-1828.164) [-1826.142] (-1828.672) -- 0:01:32
      313500 -- (-1822.552) (-1824.130) [-1824.025] (-1828.568) * [-1827.322] (-1825.749) (-1827.494) (-1833.283) -- 0:01:31
      314000 -- (-1839.401) (-1821.158) (-1829.035) [-1821.350] * (-1823.786) (-1820.201) (-1824.229) [-1827.371] -- 0:01:31
      314500 -- [-1827.987] (-1822.211) (-1828.487) (-1824.305) * (-1822.712) [-1822.664] (-1827.751) (-1825.496) -- 0:01:31
      315000 -- (-1823.139) (-1824.415) (-1825.784) [-1824.614] * [-1833.853] (-1828.756) (-1821.569) (-1827.814) -- 0:01:31

      Average standard deviation of split frequencies: 0.012773

      315500 -- [-1833.290] (-1831.485) (-1831.733) (-1830.233) * (-1820.179) (-1822.514) [-1826.842] (-1823.275) -- 0:01:31
      316000 -- (-1824.139) (-1821.145) [-1829.241] (-1827.038) * [-1823.111] (-1825.094) (-1836.419) (-1829.783) -- 0:01:30
      316500 -- [-1822.231] (-1824.795) (-1829.972) (-1828.460) * (-1824.643) [-1826.394] (-1836.134) (-1824.897) -- 0:01:30
      317000 -- (-1830.058) (-1822.438) (-1832.472) [-1827.357] * [-1827.970] (-1831.473) (-1828.470) (-1825.268) -- 0:01:30
      317500 -- (-1820.490) (-1826.315) (-1829.261) [-1822.931] * [-1823.161] (-1828.231) (-1823.952) (-1819.616) -- 0:01:30
      318000 -- (-1831.165) (-1824.803) (-1821.954) [-1817.734] * (-1828.411) (-1827.822) [-1822.915] (-1821.227) -- 0:01:30
      318500 -- (-1824.772) [-1824.054] (-1828.032) (-1829.279) * (-1826.278) [-1822.858] (-1829.774) (-1825.489) -- 0:01:29
      319000 -- (-1824.324) (-1829.442) [-1829.768] (-1824.992) * (-1824.737) (-1829.939) [-1825.424] (-1829.300) -- 0:01:29
      319500 -- (-1825.952) (-1826.042) (-1827.676) [-1826.920] * (-1840.019) [-1826.054] (-1827.107) (-1829.927) -- 0:01:29
      320000 -- (-1823.372) (-1820.454) (-1828.444) [-1823.425] * (-1827.303) [-1825.403] (-1819.530) (-1823.936) -- 0:01:29

      Average standard deviation of split frequencies: 0.011669

      320500 -- (-1825.677) [-1829.415] (-1830.362) (-1826.071) * (-1824.421) (-1830.795) (-1828.550) [-1824.983] -- 0:01:31
      321000 -- (-1832.087) [-1825.088] (-1841.570) (-1824.329) * (-1827.020) (-1830.804) [-1825.199] (-1826.109) -- 0:01:30
      321500 -- (-1833.305) (-1820.410) (-1831.913) [-1825.424] * (-1827.096) [-1822.578] (-1830.584) (-1824.159) -- 0:01:30
      322000 -- (-1825.485) (-1819.532) (-1827.553) [-1826.669] * (-1820.294) (-1826.374) (-1830.271) [-1832.665] -- 0:01:30
      322500 -- (-1828.724) (-1824.017) (-1828.960) [-1821.920] * (-1824.641) (-1833.453) [-1831.840] (-1822.764) -- 0:01:30
      323000 -- (-1826.584) (-1825.980) [-1834.569] (-1824.223) * [-1823.820] (-1822.882) (-1830.696) (-1828.847) -- 0:01:30
      323500 -- [-1821.615] (-1826.652) (-1836.871) (-1824.502) * (-1826.795) [-1823.768] (-1828.902) (-1829.997) -- 0:01:29
      324000 -- (-1827.692) (-1822.614) (-1832.049) [-1824.256] * (-1826.292) [-1828.391] (-1824.208) (-1836.299) -- 0:01:29
      324500 -- (-1822.460) (-1826.785) [-1838.669] (-1826.416) * (-1822.172) (-1828.388) [-1828.127] (-1826.274) -- 0:01:29
      325000 -- (-1827.587) [-1822.779] (-1835.078) (-1824.639) * [-1834.445] (-1827.460) (-1823.906) (-1827.289) -- 0:01:29

      Average standard deviation of split frequencies: 0.011659

      325500 -- (-1820.179) [-1821.689] (-1848.039) (-1825.242) * (-1825.328) [-1822.955] (-1831.464) (-1833.832) -- 0:01:29
      326000 -- (-1826.691) [-1827.652] (-1828.669) (-1831.407) * (-1824.576) [-1825.013] (-1835.844) (-1836.791) -- 0:01:28
      326500 -- (-1826.226) [-1828.378] (-1834.175) (-1827.291) * (-1829.062) (-1829.893) (-1829.126) [-1827.793] -- 0:01:28
      327000 -- (-1824.795) (-1823.126) [-1831.905] (-1833.553) * (-1822.573) (-1829.541) (-1822.593) [-1832.620] -- 0:01:28
      327500 -- [-1828.119] (-1825.611) (-1836.101) (-1825.337) * (-1825.146) (-1841.203) [-1819.648] (-1834.460) -- 0:01:28
      328000 -- (-1824.890) [-1832.744] (-1826.714) (-1822.418) * (-1825.610) [-1825.432] (-1824.025) (-1827.758) -- 0:01:30
      328500 -- (-1828.045) (-1826.067) (-1824.845) [-1832.804] * (-1832.249) (-1825.801) [-1820.810] (-1826.197) -- 0:01:29
      329000 -- (-1828.734) [-1821.824] (-1827.167) (-1829.286) * (-1828.398) (-1820.899) [-1820.938] (-1828.431) -- 0:01:29
      329500 -- (-1841.080) [-1829.732] (-1831.191) (-1826.148) * (-1839.062) [-1826.734] (-1829.689) (-1819.499) -- 0:01:29
      330000 -- (-1823.594) (-1827.805) [-1825.991] (-1821.766) * (-1823.900) (-1821.402) (-1830.567) [-1826.461] -- 0:01:29

      Average standard deviation of split frequencies: 0.011138

      330500 -- (-1837.314) (-1827.179) (-1829.372) [-1826.554] * (-1822.323) [-1823.030] (-1825.056) (-1820.317) -- 0:01:29
      331000 -- (-1827.552) (-1829.116) [-1829.561] (-1823.958) * (-1834.242) (-1825.921) [-1828.932] (-1832.845) -- 0:01:28
      331500 -- [-1833.386] (-1827.713) (-1837.602) (-1836.674) * (-1832.778) [-1833.607] (-1829.777) (-1832.623) -- 0:01:28
      332000 -- (-1833.493) (-1837.537) [-1822.762] (-1830.835) * (-1826.024) (-1821.959) [-1824.909] (-1829.293) -- 0:01:28
      332500 -- [-1823.727] (-1832.930) (-1824.983) (-1830.953) * [-1823.882] (-1833.777) (-1832.935) (-1831.288) -- 0:01:28
      333000 -- (-1828.907) (-1826.346) (-1828.508) [-1825.387] * (-1830.370) [-1823.959] (-1824.866) (-1822.500) -- 0:01:28
      333500 -- [-1818.728] (-1822.306) (-1830.543) (-1827.533) * [-1824.940] (-1827.775) (-1824.612) (-1826.759) -- 0:01:27
      334000 -- (-1822.579) (-1824.537) (-1829.989) [-1821.129] * (-1826.083) (-1833.964) (-1828.320) [-1832.621] -- 0:01:27
      334500 -- (-1833.054) (-1824.855) [-1825.182] (-1825.213) * (-1826.805) (-1824.648) [-1835.127] (-1822.964) -- 0:01:27
      335000 -- (-1825.063) (-1822.163) [-1824.116] (-1830.608) * [-1824.957] (-1830.041) (-1826.173) (-1825.741) -- 0:01:27

      Average standard deviation of split frequencies: 0.010698

      335500 -- (-1827.538) (-1843.039) [-1821.086] (-1826.859) * (-1828.198) (-1832.579) (-1833.023) [-1834.661] -- 0:01:29
      336000 -- (-1824.089) (-1831.671) (-1822.746) [-1822.411] * (-1821.462) (-1826.239) (-1821.472) [-1827.346] -- 0:01:28
      336500 -- (-1831.389) (-1825.289) [-1826.453] (-1825.880) * (-1827.920) (-1834.669) (-1831.982) [-1820.717] -- 0:01:28
      337000 -- (-1829.510) (-1832.934) [-1820.868] (-1838.646) * (-1826.994) (-1823.626) (-1829.019) [-1827.228] -- 0:01:28
      337500 -- [-1819.662] (-1829.245) (-1828.650) (-1824.756) * (-1827.991) (-1826.904) (-1825.347) [-1825.623] -- 0:01:28
      338000 -- [-1822.974] (-1828.080) (-1829.212) (-1825.160) * (-1828.519) [-1829.145] (-1820.551) (-1829.676) -- 0:01:28
      338500 -- (-1823.361) (-1835.285) [-1826.370] (-1835.092) * (-1824.590) (-1830.863) [-1823.792] (-1826.080) -- 0:01:27
      339000 -- (-1828.712) (-1832.067) (-1826.892) [-1827.643] * (-1824.021) (-1832.931) [-1826.117] (-1831.081) -- 0:01:27
      339500 -- [-1823.149] (-1824.063) (-1826.454) (-1833.876) * (-1832.976) [-1821.924] (-1819.167) (-1827.480) -- 0:01:27
      340000 -- [-1825.584] (-1825.962) (-1827.843) (-1829.906) * (-1829.059) (-1825.420) [-1817.574] (-1821.875) -- 0:01:27

      Average standard deviation of split frequencies: 0.010465

      340500 -- (-1822.846) (-1824.725) (-1838.254) [-1819.586] * (-1836.328) (-1830.550) [-1825.350] (-1820.370) -- 0:01:27
      341000 -- (-1828.849) (-1840.136) (-1825.484) [-1824.751] * (-1827.355) [-1826.384] (-1830.582) (-1827.706) -- 0:01:26
      341500 -- (-1831.662) (-1823.051) [-1822.838] (-1832.358) * (-1826.497) (-1825.757) [-1819.317] (-1829.261) -- 0:01:26
      342000 -- (-1829.986) (-1823.718) (-1826.660) [-1822.753] * (-1822.587) (-1828.069) (-1824.728) [-1829.086] -- 0:01:26
      342500 -- (-1836.485) (-1825.236) [-1824.472] (-1824.485) * [-1824.130] (-1832.668) (-1828.855) (-1826.724) -- 0:01:26
      343000 -- (-1829.323) (-1829.267) [-1829.503] (-1823.913) * (-1825.851) [-1828.004] (-1824.191) (-1829.972) -- 0:01:28
      343500 -- (-1829.286) [-1830.867] (-1835.553) (-1821.986) * [-1821.177] (-1828.759) (-1823.789) (-1828.813) -- 0:01:27
      344000 -- (-1830.714) [-1825.898] (-1840.233) (-1825.697) * [-1822.590] (-1829.816) (-1827.050) (-1828.683) -- 0:01:27
      344500 -- (-1836.504) (-1823.554) (-1830.553) [-1831.774] * [-1824.940] (-1828.886) (-1826.062) (-1832.202) -- 0:01:27
      345000 -- (-1831.712) [-1824.729] (-1832.959) (-1821.361) * (-1830.453) (-1835.008) (-1817.742) [-1827.818] -- 0:01:27

      Average standard deviation of split frequencies: 0.010559

      345500 -- [-1844.535] (-1829.604) (-1825.272) (-1829.608) * (-1832.976) (-1822.810) [-1829.046] (-1834.508) -- 0:01:27
      346000 -- (-1843.458) (-1825.640) (-1829.060) [-1822.108] * (-1828.269) [-1823.848] (-1824.529) (-1831.287) -- 0:01:26
      346500 -- [-1827.198] (-1823.416) (-1823.605) (-1822.426) * (-1820.700) (-1829.621) [-1823.236] (-1826.930) -- 0:01:26
      347000 -- (-1826.717) (-1827.490) (-1824.825) [-1823.430] * (-1830.106) (-1822.682) [-1820.166] (-1834.538) -- 0:01:26
      347500 -- [-1830.856] (-1827.471) (-1829.008) (-1820.400) * (-1841.547) [-1821.635] (-1830.611) (-1825.986) -- 0:01:26
      348000 -- (-1827.533) [-1828.113] (-1835.575) (-1825.091) * (-1829.773) (-1823.144) (-1823.206) [-1826.203] -- 0:01:26
      348500 -- (-1828.555) (-1825.689) (-1825.054) [-1821.427] * (-1826.829) (-1835.041) [-1823.758] (-1837.078) -- 0:01:25
      349000 -- [-1825.021] (-1827.706) (-1824.179) (-1823.233) * (-1820.995) (-1824.524) (-1836.128) [-1830.310] -- 0:01:25
      349500 -- [-1829.834] (-1829.049) (-1825.446) (-1830.967) * [-1829.093] (-1825.575) (-1827.266) (-1826.947) -- 0:01:25
      350000 -- (-1831.308) [-1822.580] (-1822.637) (-1831.080) * (-1820.009) (-1823.818) (-1824.091) [-1828.863] -- 0:01:25

      Average standard deviation of split frequencies: 0.010670

      350500 -- [-1825.524] (-1836.763) (-1830.992) (-1828.268) * (-1827.213) (-1824.550) (-1822.547) [-1829.557] -- 0:01:27
      351000 -- [-1818.900] (-1831.495) (-1841.890) (-1829.547) * [-1833.795] (-1828.947) (-1839.797) (-1826.462) -- 0:01:26
      351500 -- (-1823.372) (-1828.418) [-1823.997] (-1836.654) * (-1830.649) [-1826.118] (-1820.444) (-1830.290) -- 0:01:26
      352000 -- (-1826.837) (-1826.372) [-1825.117] (-1829.755) * (-1827.063) (-1831.452) [-1825.574] (-1826.674) -- 0:01:26
      352500 -- [-1833.506] (-1824.491) (-1831.357) (-1831.442) * [-1828.172] (-1824.891) (-1822.869) (-1836.387) -- 0:01:26
      353000 -- [-1820.703] (-1836.740) (-1825.024) (-1832.083) * (-1829.867) (-1823.750) (-1831.815) [-1822.780] -- 0:01:26
      353500 -- (-1824.447) (-1826.695) (-1822.873) [-1829.937] * [-1823.980] (-1827.710) (-1825.026) (-1828.393) -- 0:01:25
      354000 -- (-1834.033) (-1830.351) [-1824.512] (-1840.178) * [-1823.548] (-1824.143) (-1831.825) (-1825.703) -- 0:01:25
      354500 -- (-1832.668) [-1830.684] (-1823.736) (-1827.455) * [-1832.434] (-1838.457) (-1830.008) (-1828.480) -- 0:01:25
      355000 -- (-1826.596) (-1826.139) (-1827.625) [-1821.337] * (-1825.190) [-1828.159] (-1820.482) (-1825.205) -- 0:01:25

      Average standard deviation of split frequencies: 0.010345

      355500 -- (-1829.810) [-1827.785] (-1821.113) (-1827.499) * (-1827.069) (-1832.318) [-1824.908] (-1827.214) -- 0:01:25
      356000 -- (-1822.836) (-1831.675) [-1831.264] (-1831.472) * [-1820.101] (-1842.569) (-1824.812) (-1824.285) -- 0:01:25
      356500 -- [-1820.472] (-1834.671) (-1823.209) (-1827.362) * [-1830.18