--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 12:32:03 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/ML2696/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -995.12 -998.49
2 -995.09 -999.01
--------------------------------------
TOTAL -995.10 -998.78
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894883 0.091536 0.385920 1.510580 0.850727 1432.06 1466.53 1.000
r(A<->C){all} 0.156341 0.017032 0.000218 0.415406 0.121576 239.63 244.78 1.001
r(A<->G){all} 0.168980 0.021811 0.000057 0.471032 0.127915 347.21 422.01 1.001
r(A<->T){all} 0.167197 0.020962 0.000033 0.457504 0.121908 133.28 210.16 1.004
r(C<->G){all} 0.178584 0.021602 0.000226 0.481386 0.142206 201.65 206.27 1.000
r(C<->T){all} 0.169340 0.020376 0.000072 0.455916 0.132560 213.35 222.12 1.005
r(G<->T){all} 0.159557 0.018012 0.000025 0.425931 0.123547 242.23 290.01 1.005
pi(A){all} 0.205751 0.000218 0.177695 0.235018 0.205248 1274.95 1318.46 1.000
pi(C){all} 0.328057 0.000303 0.294854 0.361295 0.328159 1302.69 1308.52 1.000
pi(G){all} 0.274378 0.000252 0.244234 0.305897 0.274435 1256.78 1290.74 1.000
pi(T){all} 0.191814 0.000222 0.163564 0.221633 0.191422 791.18 1072.77 1.000
alpha{1,2} 0.410627 0.199828 0.000113 1.362898 0.248713 1145.47 1246.88 1.000
alpha{3} 0.457259 0.238771 0.000104 1.422236 0.302238 1194.73 1195.22 1.000
pinvar{all} 0.997862 0.000006 0.992951 0.999999 0.998664 1155.30 1168.86 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -970.855469
Model 2: PositiveSelection -970.855324
Model 0: one-ratio -970.855505
Model 7: beta -970.855324
Model 8: beta&w>1 -970.85533
Model 0 vs 1 7.200000004559115E-5
Model 2 vs 1 2.899999999499414E-4
Model 8 vs 7 1.1999999969702912E-5
>C1
LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
>C2
LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
>C3
LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
>C4
LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
>C5
LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
>C6
LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=243
C1 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
C2 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
C3 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
C4 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
C5 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
C6 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
**************************************************
C1 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
C2 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
C3 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
C4 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
C5 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
C6 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
**************************************************
C1 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
C2 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
C3 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
C4 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
C5 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
C6 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
**************************************************
C1 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
C2 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
C3 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
C4 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
C5 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
C6 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
**************************************************
C1 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
C2 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
C3 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
C4 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
C5 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
C6 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
*******************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 243 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 243 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7290]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7290]--->[7290]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.492 Mb, Max= 30.794 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
C2 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
C3 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
C4 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
C5 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
C6 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
**************************************************
C1 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
C2 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
C3 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
C4 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
C5 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
C6 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
**************************************************
C1 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
C2 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
C3 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
C4 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
C5 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
C6 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
**************************************************
C1 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
C2 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
C3 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
C4 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
C5 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
C6 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
**************************************************
C1 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
C2 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
C3 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
C4 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
C5 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
C6 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
*******************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG
C2 TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG
C3 TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG
C4 TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG
C5 TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG
C6 TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG
**************************************************
C1 ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT
C2 ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT
C3 ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT
C4 ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT
C5 ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT
C6 ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT
**************************************************
C1 ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG
C2 ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG
C3 ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG
C4 ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG
C5 ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG
C6 ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG
**************************************************
C1 CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC
C2 CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC
C3 CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC
C4 CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC
C5 CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC
C6 CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC
**************************************************
C1 CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG
C2 CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG
C3 CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG
C4 CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG
C5 CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG
C6 CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG
**************************************************
C1 CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA
C2 CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA
C3 CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA
C4 CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA
C5 CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA
C6 CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA
**************************************************
C1 CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA
C2 CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA
C3 CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA
C4 CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA
C5 CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA
C6 CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA
**************************************************
C1 ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC
C2 ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC
C3 ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC
C4 ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC
C5 ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC
C6 ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC
**************************************************
C1 CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC
C2 CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC
C3 CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC
C4 CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC
C5 CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC
C6 CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC
**************************************************
C1 ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC
C2 ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC
C3 ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC
C4 ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC
C5 ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC
C6 ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC
**************************************************
C1 GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG
C2 GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG
C3 GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG
C4 GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG
C5 GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG
C6 GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG
**************************************************
C1 GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA
C2 GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA
C3 GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA
C4 GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA
C5 GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA
C6 GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA
**************************************************
C1 ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC
C2 ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC
C3 ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC
C4 ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC
C5 ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC
C6 ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC
**************************************************
C1 GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG
C2 GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG
C3 GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG
C4 GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG
C5 GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG
C6 GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG
**************************************************
C1 CCGGCGACTCGCCCGCATGCAAGCAGGCA
C2 CCGGCGACTCGCCCGCATGCAAGCAGGCA
C3 CCGGCGACTCGCCCGCATGCAAGCAGGCA
C4 CCGGCGACTCGCCCGCATGCAAGCAGGCA
C5 CCGGCGACTCGCCCGCATGCAAGCAGGCA
C6 CCGGCGACTCGCCCGCATGCAAGCAGGCA
*****************************
>C1
TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG
ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT
ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG
CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC
CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG
CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA
CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA
ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC
CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC
ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC
GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG
GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA
ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC
GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG
CCGGCGACTCGCCCGCATGCAAGCAGGCA
>C2
TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG
ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT
ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG
CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC
CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG
CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA
CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA
ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC
CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC
ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC
GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG
GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA
ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC
GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG
CCGGCGACTCGCCCGCATGCAAGCAGGCA
>C3
TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG
ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT
ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG
CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC
CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG
CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA
CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA
ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC
CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC
ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC
GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG
GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA
ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC
GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG
CCGGCGACTCGCCCGCATGCAAGCAGGCA
>C4
TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG
ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT
ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG
CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC
CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG
CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA
CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA
ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC
CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC
ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC
GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG
GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA
ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC
GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG
CCGGCGACTCGCCCGCATGCAAGCAGGCA
>C5
TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG
ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT
ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG
CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC
CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG
CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA
CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA
ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC
CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC
ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC
GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG
GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA
ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC
GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG
CCGGCGACTCGCCCGCATGCAAGCAGGCA
>C6
TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG
ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT
ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG
CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC
CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG
CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA
CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA
ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC
CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC
ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC
GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG
GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA
ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC
GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG
CCGGCGACTCGCCCGCATGCAAGCAGGCA
>C1
LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
>C2
LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
>C3
LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
>C4
LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
>C5
LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
>C6
LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 729 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579782651
Setting output file names to "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 490198703
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9602685080
Seed = 1563065289
Swapseed = 1579782651
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1631.536953 -- -24.965149
Chain 2 -- -1631.536704 -- -24.965149
Chain 3 -- -1631.536953 -- -24.965149
Chain 4 -- -1631.536860 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1631.536953 -- -24.965149
Chain 2 -- -1631.536860 -- -24.965149
Chain 3 -- -1631.536860 -- -24.965149
Chain 4 -- -1631.536953 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1631.537] (-1631.537) (-1631.537) (-1631.537) * [-1631.537] (-1631.537) (-1631.537) (-1631.537)
500 -- (-1022.320) (-1007.533) (-1009.394) [-1008.005] * (-1009.791) (-1005.747) (-1006.495) [-1003.840] -- 0:00:00
1000 -- [-1002.722] (-1004.132) (-1001.399) (-1011.186) * (-1009.313) (-1006.695) (-1006.960) [-1004.546] -- 0:00:00
1500 -- [-1004.277] (-1012.853) (-1007.902) (-1002.008) * [-1005.405] (-1004.917) (-1004.306) (-1003.207) -- 0:00:00
2000 -- [-1005.435] (-1006.620) (-1001.172) (-1002.824) * (-1004.963) [-1009.077] (-1006.087) (-1001.320) -- 0:00:00
2500 -- (-1009.590) (-1007.927) (-1009.508) [-1003.024] * (-1005.189) [-1004.606] (-1000.768) (-1007.450) -- 0:00:00
3000 -- [-1003.454] (-1010.923) (-1004.376) (-1005.204) * (-1001.616) (-1010.337) (-1010.027) [-1003.508] -- 0:00:00
3500 -- [-1003.077] (-1002.334) (-1011.227) (-1003.533) * (-1000.746) (-1014.776) [-1004.297] (-1006.104) -- 0:00:00
4000 -- (-1001.731) (-1005.468) [-1001.428] (-1004.116) * [-998.748] (-1000.554) (-1009.058) (-998.689) -- 0:00:00
4500 -- [-999.359] (-1007.018) (-1003.212) (-1005.456) * (-1008.443) (-1006.978) [-1001.815] (-1000.863) -- 0:00:00
5000 -- (-1002.101) (-1016.574) [-1011.814] (-1006.952) * (-1002.648) (-1007.109) [-998.590] (-1005.383) -- 0:00:00
Average standard deviation of split frequencies: 0.088815
5500 -- (-1004.053) [-1003.565] (-1004.280) (-1004.225) * (-1003.764) (-1002.082) (-1015.260) [-999.247] -- 0:00:00
6000 -- (-1014.545) (-1006.930) (-1000.859) [-1000.798] * (-1012.218) (-1010.948) [-1010.408] (-1002.823) -- 0:02:45
6500 -- [-1014.782] (-1008.295) (-1005.880) (-1012.146) * (-1003.464) (-998.789) [-1002.710] (-998.904) -- 0:02:32
7000 -- (-1005.386) (-1004.617) (-1007.548) [-1002.774] * (-1005.811) (-1006.536) [-1002.737] (-1000.533) -- 0:02:21
7500 -- [-1007.979] (-1017.529) (-1006.322) (-1001.783) * (-1000.584) [-1005.017] (-1001.412) (-1001.029) -- 0:02:12
8000 -- [-1004.396] (-1010.413) (-1001.686) (-1006.992) * (-1006.821) (-1008.016) (-1006.428) [-1003.089] -- 0:02:04
8500 -- (-1000.373) (-1006.515) (-1006.331) [-1003.797] * (-1004.258) (-1003.172) [-1007.480] (-1015.263) -- 0:01:56
9000 -- (-1015.578) [-999.806] (-1011.281) (-1005.361) * (-1011.919) [-1000.228] (-1009.241) (-1003.415) -- 0:01:50
9500 -- (-1003.013) (-1008.234) [-1000.838] (-1003.416) * (-1002.022) (-1008.702) (-1008.759) [-1005.841] -- 0:01:44
10000 -- (-1004.574) [-999.580] (-1007.673) (-1004.054) * [-1002.700] (-999.180) (-1004.620) (-1001.217) -- 0:01:39
Average standard deviation of split frequencies: 0.077340
10500 -- (-1014.746) (-1005.951) (-1011.211) [-1003.933] * (-1007.516) (-1010.417) [-1001.257] (-1000.295) -- 0:01:34
11000 -- (-1012.695) (-1003.809) (-1011.110) [-1002.451] * (-1007.740) [-1005.870] (-1002.232) (-1006.312) -- 0:01:29
11500 -- (-1008.412) (-1005.098) [-1001.516] (-1000.309) * (-1008.886) [-1004.218] (-1003.847) (-1004.485) -- 0:01:25
12000 -- [-1000.074] (-1003.689) (-1003.469) (-1010.005) * [-1004.731] (-1001.524) (-1007.133) (-1003.402) -- 0:01:22
12500 -- (-1001.291) (-1007.333) (-1004.567) [-1004.287] * (-1011.008) (-1003.869) (-1004.146) [-1002.818] -- 0:01:19
13000 -- (-995.573) [-1003.857] (-1009.219) (-1005.334) * (-1010.874) (-1009.586) (-1006.804) [-1001.459] -- 0:01:15
13500 -- (-996.665) (-1004.737) (-1033.625) [-1008.438] * (-1027.942) (-1004.787) (-999.743) [-1001.846] -- 0:01:13
14000 -- (-996.811) (-1008.480) [-1004.627] (-1009.024) * (-1002.910) (-1008.638) [-1001.993] (-1005.470) -- 0:01:10
14500 -- (-998.545) [-1001.839] (-996.091) (-1009.062) * (-997.915) [-1002.375] (-1003.641) (-1008.793) -- 0:01:07
15000 -- (-994.536) (-1010.094) (-998.553) [-1000.455] * (-996.799) (-1004.952) [-1005.285] (-1006.525) -- 0:01:05
Average standard deviation of split frequencies: 0.060399
15500 -- (-994.707) [-1007.777] (-998.012) (-1014.231) * (-1005.367) [-1004.293] (-1002.034) (-1003.993) -- 0:01:03
16000 -- (-994.499) [-1000.731] (-998.353) (-1024.454) * (-996.964) (-1008.192) [-1000.459] (-1007.212) -- 0:01:01
16500 -- (-994.625) (-1010.658) (-997.367) [-995.995] * (-995.901) (-1005.873) [-1006.834] (-1011.240) -- 0:00:59
17000 -- (-994.479) (-1001.420) (-997.785) [-996.085] * [-996.007] (-1004.255) (-1014.740) (-1004.915) -- 0:00:57
17500 -- (-997.769) [-1002.281] (-995.268) (-996.573) * (-995.927) (-1002.591) [-1003.298] (-1013.682) -- 0:00:56
18000 -- (-994.412) (-1009.783) (-995.131) [-996.534] * (-995.812) [-1006.498] (-1007.743) (-1001.735) -- 0:00:54
18500 -- (-997.520) (-1012.154) [-995.473] (-994.798) * (-995.085) [-1006.250] (-1004.584) (-1003.911) -- 0:00:53
19000 -- [-995.470] (-1015.253) (-999.202) (-997.932) * (-995.797) (-1005.466) [-1008.300] (-1005.826) -- 0:00:51
19500 -- [-995.925] (-995.367) (-995.225) (-997.172) * (-999.406) (-1004.735) (-1004.258) [-1001.418] -- 0:00:50
20000 -- (-995.993) (-996.156) (-996.021) [-999.298] * (-1005.605) (-1006.792) [-1006.108] (-1006.342) -- 0:00:49
Average standard deviation of split frequencies: 0.045620
20500 -- (-995.117) (-995.771) [-995.898] (-999.977) * (-994.899) (-1007.519) (-1004.102) [-1013.595] -- 0:00:47
21000 -- (-997.549) [-994.304] (-995.509) (-994.864) * (-995.242) (-1005.089) (-1001.771) [-1001.201] -- 0:00:46
21500 -- (-1000.532) (-999.170) (-995.150) [-996.229] * (-1000.645) [-1003.782] (-1006.088) (-1004.979) -- 0:01:31
22000 -- (-995.514) [-997.055] (-997.086) (-999.326) * (-998.419) (-1006.642) (-1009.905) [-1007.227] -- 0:01:28
22500 -- [-994.611] (-1001.038) (-999.558) (-998.588) * [-994.181] (-999.567) (-1011.701) (-1002.628) -- 0:01:26
23000 -- (-995.765) (-999.942) (-997.844) [-996.299] * (-994.207) (-1015.795) (-1008.114) [-1002.200] -- 0:01:24
23500 -- [-997.093] (-997.612) (-995.975) (-995.313) * (-995.095) [-1004.317] (-1002.927) (-1001.824) -- 0:01:23
24000 -- [-997.168] (-998.815) (-999.130) (-994.916) * [-996.360] (-1005.860) (-1012.178) (-1010.119) -- 0:01:21
24500 -- (-999.003) (-997.670) (-997.234) [-995.470] * (-998.282) (-1000.919) (-1005.194) [-1000.748] -- 0:01:19
25000 -- (-999.821) [-993.882] (-995.264) (-994.012) * [-996.012] (-1006.754) (-1002.392) (-999.870) -- 0:01:18
Average standard deviation of split frequencies: 0.027196
25500 -- (-1001.256) [-999.149] (-995.082) (-996.130) * (-995.205) [-1000.946] (-1003.750) (-1011.533) -- 0:01:16
26000 -- (-995.735) (-994.508) [-995.094] (-996.767) * (-995.341) (-1008.413) [-1000.616] (-1002.423) -- 0:01:14
26500 -- (-1000.116) (-994.737) [-994.380] (-994.721) * (-994.773) [-1005.623] (-1005.041) (-1001.799) -- 0:01:13
27000 -- (-998.012) (-996.346) [-993.996] (-996.040) * (-997.243) (-999.796) (-1006.451) [-1000.929] -- 0:01:12
27500 -- (-999.125) (-999.497) [-994.208] (-996.132) * (-994.090) (-1012.821) (-1011.494) [-1003.090] -- 0:01:10
28000 -- (-1000.692) [-998.736] (-994.417) (-997.219) * [-995.689] (-1003.769) (-1013.552) (-1006.387) -- 0:01:09
28500 -- (-997.297) (-995.337) [-996.382] (-996.918) * (-994.274) (-1006.087) (-1001.851) [-1002.510] -- 0:01:08
29000 -- [-996.180] (-994.495) (-997.793) (-995.376) * (-995.129) (-1002.132) [-1000.834] (-1010.202) -- 0:01:06
29500 -- (-994.605) (-995.597) [-996.496] (-995.839) * (-993.913) (-1011.748) [-1004.857] (-1010.424) -- 0:01:05
30000 -- (-996.684) [-995.336] (-996.420) (-997.531) * [-995.508] (-1010.216) (-1006.808) (-1003.748) -- 0:01:04
Average standard deviation of split frequencies: 0.030744
30500 -- [-998.580] (-999.693) (-997.906) (-996.110) * (-995.492) [-998.036] (-1013.450) (-1005.587) -- 0:01:03
31000 -- (-998.048) [-995.921] (-997.963) (-997.377) * (-995.819) (-997.717) (-1007.620) [-1002.968] -- 0:01:02
31500 -- (-996.824) (-997.281) [-994.716] (-998.618) * (-995.315) (-997.715) (-1008.783) [-1007.452] -- 0:01:01
32000 -- (-997.325) (-994.929) (-994.803) [-996.820] * (-996.128) [-998.757] (-1007.726) (-1007.690) -- 0:01:00
32500 -- (-999.138) (-994.688) [-993.728] (-998.630) * (-997.075) (-998.423) (-1007.289) [-1003.495] -- 0:00:59
33000 -- (-997.740) (-999.926) [-995.777] (-999.569) * (-995.473) (-1001.595) (-1010.741) [-1005.540] -- 0:00:58
33500 -- (-994.505) (-996.835) (-996.758) [-1000.962] * (-998.517) (-1002.096) [-1004.022] (-1009.780) -- 0:00:57
34000 -- (-997.309) [-995.715] (-996.037) (-997.119) * [-997.910] (-999.074) (-1004.905) (-999.770) -- 0:00:56
34500 -- (-998.127) (-994.667) [-997.067] (-996.049) * (-997.451) (-998.227) (-1019.335) [-995.049] -- 0:00:55
35000 -- (-999.980) (-995.740) [-997.758] (-994.346) * (-997.664) (-996.590) (-1033.744) [-997.221] -- 0:00:55
Average standard deviation of split frequencies: 0.028500
35500 -- [-995.512] (-994.871) (-999.247) (-1000.195) * (-995.349) [-995.221] (-1004.223) (-995.048) -- 0:00:54
36000 -- (-997.435) [-996.007] (-995.032) (-995.902) * (-998.112) (-995.101) [-999.666] (-995.183) -- 0:00:53
36500 -- [-995.497] (-997.302) (-996.167) (-997.233) * (-995.775) (-994.056) [-996.819] (-996.057) -- 0:00:52
37000 -- [-993.973] (-994.933) (-996.361) (-995.772) * (-994.653) (-993.855) [-996.642] (-995.299) -- 0:00:52
37500 -- [-993.654] (-995.607) (-994.760) (-997.260) * (-1000.712) (-994.791) [-996.708] (-994.589) -- 0:01:17
38000 -- (-993.942) (-996.264) (-995.266) [-996.560] * [-997.026] (-997.283) (-995.351) (-994.655) -- 0:01:15
38500 -- (-993.620) [-994.404] (-997.398) (-995.920) * (-997.560) (-995.017) [-996.170] (-995.704) -- 0:01:14
39000 -- (-996.995) (-995.627) [-995.966] (-996.297) * (-997.346) (-995.323) (-995.186) [-996.963] -- 0:01:13
39500 -- (-996.279) (-997.732) (-997.443) [-994.413] * (-998.343) [-994.607] (-994.791) (-995.109) -- 0:01:12
40000 -- (-996.724) [-995.350] (-1001.349) (-996.747) * (-997.528) [-994.282] (-996.623) (-999.212) -- 0:01:12
Average standard deviation of split frequencies: 0.036139
40500 -- (-996.535) (-1001.340) (-995.041) [-998.156] * (-997.177) (-997.036) [-994.656] (-999.011) -- 0:01:11
41000 -- (-995.611) (-998.112) [-996.940] (-998.316) * (-995.026) (-995.590) [-994.413] (-996.675) -- 0:01:10
41500 -- (-994.416) [-995.304] (-998.501) (-998.685) * (-996.156) (-995.266) (-993.809) [-994.234] -- 0:01:09
42000 -- [-995.424] (-994.564) (-993.965) (-997.437) * (-996.143) (-995.472) [-995.845] (-994.330) -- 0:01:08
42500 -- (-996.413) (-996.584) [-996.237] (-995.057) * (-995.577) (-997.056) (-996.980) [-995.103] -- 0:01:07
43000 -- (-995.284) (-996.794) (-994.427) [-995.930] * (-996.671) (-995.506) (-999.546) [-999.097] -- 0:01:06
43500 -- [-994.673] (-997.383) (-994.441) (-994.328) * (-994.771) (-996.427) [-997.500] (-999.392) -- 0:01:05
44000 -- [-994.145] (-998.899) (-994.003) (-997.286) * (-999.016) (-995.270) (-995.616) [-994.519] -- 0:01:05
44500 -- [-994.205] (-995.667) (-994.438) (-998.388) * (-994.808) (-997.492) [-996.390] (-996.185) -- 0:01:04
45000 -- (-996.867) (-998.808) [-994.162] (-994.458) * (-993.828) [-994.704] (-995.072) (-995.579) -- 0:01:03
Average standard deviation of split frequencies: 0.031823
45500 -- (-994.343) (-1003.818) [-994.212] (-994.389) * (-994.207) (-996.207) [-995.983] (-995.752) -- 0:01:02
46000 -- (-994.590) (-1000.621) (-997.661) [-994.673] * [-993.626] (-994.397) (-998.861) (-996.072) -- 0:01:02
46500 -- (-996.585) (-997.244) [-996.859] (-999.650) * (-993.715) (-994.973) (-995.091) [-994.598] -- 0:01:01
47000 -- (-994.088) [-1000.669] (-997.109) (-996.316) * [-995.265] (-994.784) (-1001.031) (-994.104) -- 0:01:00
47500 -- [-993.959] (-994.278) (-995.039) (-995.628) * [-995.137] (-996.033) (-996.372) (-996.125) -- 0:01:00
48000 -- [-996.306] (-995.498) (-995.538) (-998.383) * (-996.028) [-993.918] (-997.358) (-997.082) -- 0:00:59
48500 -- [-994.564] (-994.728) (-998.527) (-998.381) * (-994.753) (-993.851) [-997.990] (-997.055) -- 0:00:58
49000 -- [-994.846] (-997.165) (-994.860) (-994.288) * [-996.997] (-995.128) (-995.724) (-995.167) -- 0:00:58
49500 -- (-995.550) [-1001.307] (-998.130) (-993.925) * (-995.798) (-997.786) (-995.422) [-995.435] -- 0:00:57
50000 -- [-993.565] (-994.718) (-997.378) (-998.524) * (-995.147) (-994.276) [-995.259] (-997.343) -- 0:00:57
Average standard deviation of split frequencies: 0.027912
50500 -- (-995.184) (-994.936) (-995.642) [-995.702] * (-994.764) [-995.670] (-999.410) (-994.977) -- 0:00:56
51000 -- [-993.868] (-1002.132) (-996.741) (-995.700) * (-995.941) [-994.100] (-998.657) (-994.118) -- 0:00:55
51500 -- [-995.503] (-996.107) (-997.029) (-999.819) * [-995.092] (-998.814) (-997.845) (-994.663) -- 0:00:55
52000 -- (-995.426) [-995.407] (-994.564) (-994.707) * (-994.277) (-993.926) (-1000.522) [-995.085] -- 0:00:54
52500 -- [-995.604] (-996.371) (-995.803) (-995.470) * (-996.119) (-994.626) (-999.326) [-995.538] -- 0:00:54
53000 -- [-997.299] (-998.171) (-995.078) (-998.337) * [-994.147] (-999.980) (-997.620) (-996.178) -- 0:00:53
53500 -- (-998.792) [-993.936] (-998.340) (-995.400) * [-996.691] (-997.493) (-998.863) (-996.867) -- 0:00:53
54000 -- (-996.729) (-995.416) [-1001.485] (-997.904) * (-1000.511) (-997.088) [-997.344] (-995.197) -- 0:00:52
54500 -- (-994.723) [-994.911] (-1002.008) (-996.453) * (-995.882) (-1004.094) (-995.456) [-994.348] -- 0:01:09
55000 -- [-995.528] (-996.261) (-1000.066) (-1000.062) * [-995.512] (-1000.081) (-996.348) (-997.076) -- 0:01:08
Average standard deviation of split frequencies: 0.029042
55500 -- (-997.069) [-997.550] (-995.929) (-995.156) * (-994.640) [-993.930] (-995.896) (-994.531) -- 0:01:08
56000 -- (-996.570) (-996.845) (-996.563) [-995.214] * (-994.538) (-993.911) (-997.529) [-996.309] -- 0:01:07
56500 -- [-995.047] (-999.488) (-997.546) (-997.245) * [-995.232] (-997.250) (-998.762) (-997.425) -- 0:01:06
57000 -- (-994.344) [-1000.370] (-995.243) (-997.894) * [-993.871] (-995.033) (-994.354) (-998.744) -- 0:01:06
57500 -- (-994.283) [-996.445] (-996.981) (-996.135) * [-994.929] (-994.276) (-994.130) (-997.985) -- 0:01:05
58000 -- [-994.226] (-994.875) (-995.371) (-995.137) * (-996.033) (-996.656) (-998.754) [-996.836] -- 0:01:04
58500 -- (-993.874) (-994.766) (-996.632) [-995.852] * (-996.145) (-995.379) (-995.119) [-996.292] -- 0:01:04
59000 -- (-994.313) (-995.373) (-998.334) [-995.367] * (-996.954) (-996.026) (-996.051) [-996.074] -- 0:01:03
59500 -- (-995.004) (-994.865) [-996.352] (-994.565) * (-996.091) (-997.035) [-996.104] (-994.299) -- 0:01:03
60000 -- (-994.687) (-995.351) (-994.617) [-993.944] * (-995.543) (-993.653) [-993.867] (-994.423) -- 0:01:02
Average standard deviation of split frequencies: 0.031513
60500 -- (-996.074) (-996.429) (-998.759) [-994.640] * (-995.025) (-995.665) [-994.863] (-996.142) -- 0:01:02
61000 -- [-996.998] (-998.773) (-996.659) (-995.950) * (-994.274) (-1000.522) (-997.894) [-995.416] -- 0:01:01
61500 -- (-995.649) (-995.188) [-999.247] (-995.545) * (-994.280) (-999.632) [-995.937] (-997.089) -- 0:01:01
62000 -- [-995.062] (-1001.093) (-995.223) (-999.063) * (-995.023) (-997.058) (-994.527) [-993.786] -- 0:01:00
62500 -- (-995.414) (-999.581) [-997.632] (-994.510) * (-995.232) [-995.067] (-995.397) (-993.806) -- 0:01:00
63000 -- (-996.516) (-993.559) [-998.774] (-998.980) * (-996.079) (-994.504) [-995.642] (-993.963) -- 0:00:59
63500 -- (-994.755) (-994.224) (-998.471) [-996.629] * (-995.145) (-994.436) (-995.964) [-993.827] -- 0:00:58
64000 -- (-995.962) (-994.921) [-995.862] (-995.231) * (-997.412) (-997.280) (-1000.377) [-994.607] -- 0:00:58
64500 -- [-994.518] (-995.931) (-995.688) (-995.106) * (-994.479) (-997.220) (-998.856) [-994.171] -- 0:00:58
65000 -- [-996.470] (-995.859) (-994.806) (-1001.200) * (-995.324) [-995.544] (-998.441) (-994.189) -- 0:00:57
Average standard deviation of split frequencies: 0.022931
65500 -- [-993.974] (-995.078) (-997.056) (-996.600) * (-998.236) (-998.374) [-997.238] (-994.218) -- 0:00:57
66000 -- [-996.160] (-995.469) (-995.019) (-999.201) * [-994.661] (-997.888) (-997.304) (-997.450) -- 0:00:56
66500 -- (-996.427) [-996.502] (-996.635) (-997.543) * (-994.998) (-996.550) [-997.060] (-993.948) -- 0:00:56
67000 -- [-994.542] (-996.764) (-994.949) (-994.794) * (-995.329) [-999.019] (-997.118) (-996.441) -- 0:00:55
67500 -- [-995.410] (-994.722) (-996.018) (-996.024) * (-995.206) [-994.603] (-999.638) (-999.670) -- 0:00:55
68000 -- (-994.107) (-997.751) (-995.736) [-994.307] * (-994.660) (-995.410) [-994.435] (-996.812) -- 0:00:54
68500 -- [-996.878] (-994.410) (-996.986) (-994.070) * [-994.734] (-995.141) (-997.430) (-995.424) -- 0:00:54
69000 -- (-994.527) (-1000.342) [-999.229] (-998.562) * [-995.393] (-996.210) (-995.863) (-995.964) -- 0:00:53
69500 -- [-995.986] (-995.966) (-995.980) (-998.841) * (-995.275) (-996.563) [-994.476] (-1000.336) -- 0:00:53
70000 -- [-998.532] (-996.035) (-996.476) (-993.988) * (-995.126) (-997.054) [-1001.632] (-1000.401) -- 0:00:53
Average standard deviation of split frequencies: 0.022097
70500 -- (-1000.348) [-995.369] (-994.131) (-995.230) * [-996.128] (-995.512) (-996.082) (-999.990) -- 0:01:05
71000 -- (-1000.778) [-994.734] (-994.131) (-995.148) * (-996.517) (-997.881) (-995.290) [-1002.484] -- 0:01:05
71500 -- (-1007.203) [-996.708] (-999.403) (-995.452) * (-996.254) (-1000.672) [-994.876] (-994.755) -- 0:01:04
72000 -- (-996.737) (-996.760) [-995.806] (-994.590) * (-998.948) [-996.711] (-995.631) (-996.386) -- 0:01:04
72500 -- (-1002.972) (-998.727) [-998.610] (-994.045) * [-994.383] (-1000.678) (-997.538) (-995.705) -- 0:01:03
73000 -- (-996.401) [-997.705] (-994.001) (-995.157) * (-995.368) [-993.967] (-994.797) (-996.373) -- 0:01:03
73500 -- (-1003.159) (-997.431) (-996.630) [-994.453] * [-994.972] (-995.153) (-995.426) (-997.503) -- 0:01:03
74000 -- [-994.758] (-993.454) (-995.869) (-994.886) * (-995.287) [-994.652] (-995.785) (-996.444) -- 0:01:02
74500 -- (-995.055) [-994.919] (-997.559) (-994.905) * [-994.717] (-994.144) (-999.971) (-994.399) -- 0:01:02
75000 -- (-995.899) (-994.745) [-993.914] (-994.826) * (-994.805) (-994.407) (-996.935) [-995.505] -- 0:01:01
Average standard deviation of split frequencies: 0.024397
75500 -- (-996.712) [-993.520] (-995.072) (-996.112) * (-994.837) [-996.072] (-995.900) (-994.475) -- 0:01:01
76000 -- (-997.652) (-993.541) [-994.154] (-994.725) * [-994.546] (-995.376) (-996.593) (-994.749) -- 0:01:00
76500 -- (-999.558) (-994.740) [-994.820] (-994.622) * (-995.959) (-996.225) (-997.008) [-994.090] -- 0:01:00
77000 -- (-997.908) (-1001.777) [-997.072] (-994.888) * (-994.497) (-994.066) [-994.586] (-1000.176) -- 0:00:59
77500 -- (-996.108) (-998.673) [-995.571] (-994.679) * (-995.708) (-997.372) [-995.187] (-996.550) -- 0:00:59
78000 -- (-996.097) (-996.743) [-994.153] (-996.106) * (-993.695) (-994.399) (-994.738) [-998.330] -- 0:00:59
78500 -- (-996.640) (-996.487) [-1001.844] (-994.771) * (-994.273) [-995.342] (-998.428) (-994.471) -- 0:00:58
79000 -- (-996.301) (-995.859) [-995.859] (-996.541) * [-993.879] (-994.675) (-997.133) (-994.999) -- 0:00:58
79500 -- [-995.432] (-999.826) (-997.830) (-995.320) * (-994.642) (-996.333) [-998.222] (-995.319) -- 0:00:57
80000 -- (-995.191) [-1002.183] (-996.993) (-993.747) * [-994.041] (-996.190) (-995.147) (-996.771) -- 0:00:57
Average standard deviation of split frequencies: 0.023765
80500 -- (-996.446) (-995.567) (-996.335) [-994.623] * (-995.948) (-995.039) (-995.143) [-996.557] -- 0:00:57
81000 -- (-994.909) [-995.478] (-997.404) (-995.763) * (-998.168) (-994.732) (-994.166) [-994.062] -- 0:00:56
81500 -- (-998.555) [-996.745] (-996.420) (-996.257) * (-994.604) (-994.613) (-995.081) [-994.141] -- 0:00:56
82000 -- [-996.450] (-995.648) (-997.188) (-997.046) * (-996.774) [-994.139] (-995.691) (-994.746) -- 0:00:55
82500 -- (-996.382) [-995.859] (-995.835) (-994.773) * (-1001.036) (-994.060) (-1000.626) [-995.474] -- 0:00:55
83000 -- (-996.443) (-998.101) [-996.111] (-996.288) * (-999.439) (-994.116) (-994.793) [-994.669] -- 0:00:55
83500 -- (-996.728) [-996.072] (-994.495) (-996.222) * [-998.375] (-998.469) (-994.864) (-994.071) -- 0:00:54
84000 -- (-994.544) (-995.338) [-996.074] (-994.820) * (-997.278) (-995.538) [-994.383] (-993.948) -- 0:00:54
84500 -- (-994.355) (-995.341) (-995.404) [-994.710] * (-996.285) (-994.901) (-996.016) [-993.948] -- 0:00:54
85000 -- [-996.186] (-997.209) (-994.087) (-996.618) * (-995.317) (-996.068) (-994.960) [-995.508] -- 0:00:53
Average standard deviation of split frequencies: 0.022503
85500 -- (-995.214) [-995.306] (-996.173) (-998.795) * (-996.532) (-997.183) (-998.666) [-997.023] -- 0:00:53
86000 -- [-995.614] (-995.540) (-995.606) (-998.089) * (-997.488) (-994.730) (-996.718) [-995.464] -- 0:00:53
86500 -- (-995.972) [-993.784] (-998.100) (-995.055) * [-997.877] (-996.206) (-999.632) (-995.566) -- 0:00:52
87000 -- [-996.241] (-995.903) (-996.718) (-997.895) * [-1000.080] (-998.614) (-999.511) (-995.293) -- 0:00:52
87500 -- (-996.814) [-996.600] (-995.566) (-995.540) * (-1001.013) [-994.031] (-998.746) (-996.250) -- 0:01:02
88000 -- [-995.330] (-994.943) (-998.444) (-995.868) * (-995.969) (-993.753) [-995.769] (-995.074) -- 0:01:02
88500 -- (-994.998) (-997.801) (-995.605) [-996.087] * [-996.107] (-993.907) (-995.224) (-995.899) -- 0:01:01
89000 -- (-997.138) [-994.286] (-995.848) (-995.857) * (-995.703) (-995.258) (-995.093) [-996.494] -- 0:01:01
89500 -- (-995.946) [-996.299] (-996.034) (-995.148) * (-996.110) (-995.154) [-995.616] (-998.890) -- 0:01:01
90000 -- (-995.167) (-994.873) [-996.224] (-994.870) * [-995.446] (-1000.568) (-998.223) (-996.077) -- 0:01:00
Average standard deviation of split frequencies: 0.022021
90500 -- [-997.147] (-997.564) (-1001.416) (-1000.149) * [-994.882] (-997.636) (-994.257) (-997.208) -- 0:01:00
91000 -- (-998.313) [-998.221] (-997.718) (-996.290) * (-995.206) [-994.230] (-998.251) (-997.755) -- 0:00:59
91500 -- (-1000.345) [-994.315] (-995.904) (-994.654) * (-993.403) (-995.973) (-998.892) [-996.461] -- 0:00:59
92000 -- (-998.121) (-996.349) [-995.853] (-995.433) * (-1001.149) (-995.009) (-995.020) [-995.817] -- 0:00:59
92500 -- (-995.681) (-998.123) (-994.772) [-995.612] * (-999.167) (-994.159) [-995.775] (-998.719) -- 0:00:58
93000 -- (-995.365) [-994.949] (-995.550) (-995.362) * (-999.734) (-994.944) [-996.758] (-997.531) -- 0:00:58
93500 -- [-998.051] (-993.599) (-994.392) (-995.506) * [-994.754] (-998.379) (-996.485) (-994.312) -- 0:00:58
94000 -- (-1002.098) (-994.542) [-997.665] (-995.302) * (-995.155) (-994.494) (-1000.459) [-993.615] -- 0:00:57
94500 -- [-998.315] (-996.393) (-998.113) (-994.033) * (-996.649) (-996.094) (-997.827) [-993.752] -- 0:00:57
95000 -- (-996.316) [-993.536] (-995.064) (-995.858) * (-994.937) (-999.482) [-995.803] (-993.732) -- 0:00:57
Average standard deviation of split frequencies: 0.023686
95500 -- (-996.220) (-996.307) [-995.477] (-999.861) * (-994.462) (-995.723) [-994.259] (-993.915) -- 0:00:56
96000 -- [-996.773] (-994.718) (-998.445) (-997.313) * (-994.651) (-1003.768) [-994.114] (-996.483) -- 0:00:56
96500 -- (-997.021) (-997.710) [-999.380] (-995.609) * [-994.155] (-996.579) (-995.966) (-995.934) -- 0:00:56
97000 -- (-995.153) [-996.111] (-995.467) (-996.006) * [-994.961] (-999.674) (-994.669) (-994.175) -- 0:00:55
97500 -- (-995.635) (-996.234) (-995.755) [-997.502] * [-995.391] (-999.748) (-995.331) (-996.412) -- 0:00:55
98000 -- (-994.237) (-996.873) [-994.606] (-995.260) * (-994.180) [-996.320] (-996.259) (-997.427) -- 0:00:55
98500 -- [-995.436] (-995.592) (-996.441) (-995.610) * (-996.105) [-997.901] (-995.432) (-995.803) -- 0:00:54
99000 -- (-997.628) [-1000.303] (-1000.039) (-995.406) * (-993.981) (-1003.208) (-995.167) [-996.253] -- 0:00:54
99500 -- (-999.043) (-1000.610) [-997.436] (-996.839) * [-994.264] (-997.733) (-996.846) (-995.242) -- 0:00:54
100000 -- (-999.121) (-995.616) (-998.158) [-997.854] * (-993.984) (-994.829) (-997.323) [-995.564] -- 0:00:54
Average standard deviation of split frequencies: 0.025893
100500 -- (-997.018) (-995.266) [-996.612] (-994.069) * (-993.904) (-994.683) (-996.940) [-995.038] -- 0:00:53
101000 -- [-994.653] (-997.475) (-995.374) (-994.993) * (-995.464) (-994.433) (-995.208) [-993.865] -- 0:00:53
101500 -- (-994.487) [-995.250] (-994.495) (-995.980) * (-993.954) (-995.291) (-995.280) [-995.875] -- 0:00:53
102000 -- (-994.456) (-996.718) [-995.500] (-995.986) * (-993.827) (-995.834) (-994.023) [-995.941] -- 0:00:52
102500 -- [-998.989] (-999.798) (-997.366) (-995.849) * (-993.783) [-999.331] (-994.279) (-996.469) -- 0:00:52
103000 -- (-995.491) (-999.731) (-994.313) [-994.648] * (-997.498) [-997.505] (-994.354) (-997.951) -- 0:00:52
103500 -- (-995.069) (-997.051) (-997.530) [-994.652] * [-993.587] (-996.598) (-997.008) (-996.671) -- 0:00:51
104000 -- (-996.114) [-996.200] (-998.773) (-995.346) * [-998.865] (-996.536) (-996.611) (-995.413) -- 0:01:00
104500 -- [-995.671] (-996.065) (-997.852) (-995.157) * [-994.520] (-996.545) (-994.040) (-995.876) -- 0:00:59
105000 -- [-995.139] (-997.135) (-997.035) (-996.415) * [-997.401] (-996.762) (-993.775) (-997.064) -- 0:00:59
Average standard deviation of split frequencies: 0.025747
105500 -- (-995.300) (-997.125) [-996.742] (-996.967) * [-994.111] (-999.711) (-995.930) (-993.850) -- 0:00:59
106000 -- [-995.637] (-995.008) (-996.114) (-997.613) * (-995.135) (-995.614) (-995.440) [-993.774] -- 0:00:59
106500 -- [-994.314] (-996.566) (-998.423) (-994.307) * (-994.960) (-994.915) [-995.500] (-995.651) -- 0:00:58
107000 -- (-996.963) (-995.935) (-995.219) [-995.826] * (-994.675) [-994.915] (-996.055) (-995.734) -- 0:00:58
107500 -- (-997.666) [-995.414] (-993.722) (-993.519) * (-995.338) (-999.142) (-994.261) [-998.185] -- 0:00:58
108000 -- (-1000.870) (-996.582) [-996.011] (-996.150) * (-998.181) [-996.228] (-993.941) (-999.438) -- 0:00:57
108500 -- [-995.182] (-994.923) (-1000.815) (-994.359) * [-995.473] (-995.663) (-996.719) (-1000.856) -- 0:00:57
109000 -- (-996.418) (-995.094) [-995.884] (-993.610) * (-994.536) (-994.053) [-997.653] (-999.219) -- 0:00:57
109500 -- [-994.129] (-995.554) (-994.990) (-994.710) * (-994.883) [-994.091] (-998.028) (-999.730) -- 0:00:56
110000 -- (-997.291) (-993.633) (-994.808) [-994.465] * (-994.925) [-994.449] (-997.191) (-995.575) -- 0:00:56
Average standard deviation of split frequencies: 0.023902
110500 -- (-997.175) [-996.334] (-994.183) (-993.944) * (-994.228) [-995.052] (-997.574) (-996.019) -- 0:00:56
111000 -- [-995.790] (-996.117) (-998.077) (-995.277) * (-1001.673) (-995.224) [-996.613] (-996.855) -- 0:00:56
111500 -- (-996.193) (-999.278) [-996.650] (-995.578) * [-996.292] (-996.009) (-994.830) (-994.686) -- 0:00:55
112000 -- (-998.959) [-995.139] (-994.567) (-999.324) * [-993.501] (-995.280) (-994.890) (-994.653) -- 0:00:55
112500 -- (-999.716) [-993.944] (-995.420) (-994.894) * (-995.200) (-995.496) (-997.546) [-993.907] -- 0:00:55
113000 -- [-997.546] (-994.758) (-994.935) (-995.705) * [-995.196] (-994.553) (-996.792) (-997.234) -- 0:00:54
113500 -- (-996.386) (-994.999) (-995.488) [-993.859] * (-994.163) [-994.192] (-997.257) (-997.267) -- 0:00:54
114000 -- (-996.404) [-997.058] (-995.763) (-996.194) * [-997.171] (-994.234) (-997.695) (-995.846) -- 0:00:54
114500 -- (-997.011) [-995.286] (-993.948) (-996.298) * (-996.026) [-995.527] (-994.959) (-995.767) -- 0:00:54
115000 -- (-994.837) (-995.199) (-996.058) [-997.278] * [-998.710] (-999.088) (-994.616) (-994.287) -- 0:00:53
Average standard deviation of split frequencies: 0.025399
115500 -- (-995.147) [-995.755] (-994.510) (-995.199) * [-993.527] (-997.247) (-997.040) (-994.289) -- 0:00:53
116000 -- (-998.030) [-1000.517] (-994.189) (-995.628) * (-996.776) (-995.666) (-995.533) [-994.649] -- 0:00:53
116500 -- [-994.120] (-997.055) (-998.723) (-995.963) * (-995.746) [-994.943] (-997.274) (-996.692) -- 0:00:53
117000 -- (-995.902) [-994.982] (-999.984) (-996.470) * (-994.303) (-994.763) [-994.203] (-996.273) -- 0:00:52
117500 -- [-995.066] (-995.610) (-999.305) (-998.144) * (-994.280) (-995.402) (-994.128) [-993.896] -- 0:00:52
118000 -- [-995.851] (-997.762) (-995.831) (-1003.549) * [-995.057] (-996.370) (-995.305) (-994.904) -- 0:00:52
118500 -- [-995.084] (-996.498) (-995.698) (-997.924) * (-997.206) (-994.345) (-996.688) [-994.445] -- 0:00:52
119000 -- (-995.736) [-993.869] (-998.804) (-997.020) * (-996.805) (-997.576) [-996.181] (-996.941) -- 0:00:51
119500 -- [-998.999] (-994.723) (-996.343) (-998.460) * [-1001.240] (-993.798) (-994.462) (-996.671) -- 0:00:51
120000 -- (-997.819) (-995.769) (-994.874) [-998.557] * (-997.293) [-994.994] (-996.337) (-995.561) -- 0:00:51
Average standard deviation of split frequencies: 0.025085
120500 -- (-997.135) (-995.036) [-996.427] (-1000.871) * (-997.839) [-996.680] (-995.705) (-995.110) -- 0:00:58
121000 -- (-994.566) [-993.938] (-995.821) (-997.599) * (-997.860) (-994.524) [-994.760] (-997.757) -- 0:00:58
121500 -- (-994.491) (-995.576) (-995.964) [-993.936] * (-996.852) (-997.888) (-995.228) [-994.726] -- 0:00:57
122000 -- (-995.916) (-994.357) [-997.440] (-994.810) * (-997.026) (-997.924) [-997.261] (-993.878) -- 0:00:57
122500 -- (-998.108) [-994.532] (-995.951) (-995.655) * (-994.831) (-996.777) [-995.802] (-996.953) -- 0:00:57
123000 -- [-996.099] (-997.542) (-995.984) (-995.605) * (-997.580) [-993.991] (-995.820) (-995.402) -- 0:00:57
123500 -- (-996.211) (-994.029) (-1001.972) [-996.893] * (-996.234) (-994.065) [-994.505] (-994.301) -- 0:00:56
124000 -- (-995.723) (-994.582) [-993.991] (-999.511) * (-998.647) (-993.829) [-995.163] (-999.382) -- 0:00:56
124500 -- [-994.660] (-996.074) (-994.136) (-995.694) * [-999.851] (-994.438) (-997.917) (-999.515) -- 0:00:56
125000 -- [-995.434] (-996.219) (-996.029) (-995.049) * (-996.748) [-995.834] (-996.294) (-999.508) -- 0:00:56
Average standard deviation of split frequencies: 0.026002
125500 -- (-995.762) (-995.326) (-998.914) [-996.425] * [-994.059] (-995.554) (-994.599) (-997.360) -- 0:00:55
126000 -- [-994.904] (-994.366) (-995.983) (-996.056) * (-994.364) (-997.265) (-996.526) [-997.001] -- 0:00:55
126500 -- (-995.815) (-994.770) [-995.428] (-995.758) * (-996.091) [-996.986] (-996.833) (-1003.908) -- 0:00:55
127000 -- (-996.669) [-998.141] (-994.694) (-997.572) * (-996.887) (-996.460) [-996.669] (-1005.967) -- 0:00:54
127500 -- (-995.788) (-995.070) [-996.166] (-997.238) * (-994.438) [-995.142] (-996.594) (-995.879) -- 0:00:54
128000 -- (-993.995) [-995.671] (-995.650) (-995.474) * [-995.471] (-995.696) (-1000.740) (-995.939) -- 0:00:54
128500 -- (-995.198) (-994.933) (-995.031) [-994.506] * (-995.219) (-996.167) (-996.105) [-995.810] -- 0:00:54
129000 -- (-995.938) (-997.268) [-996.913] (-998.382) * (-994.600) (-997.045) (-995.141) [-999.582] -- 0:00:54
129500 -- (-997.413) (-999.775) (-1000.498) [-995.272] * (-995.074) (-995.178) [-994.459] (-994.857) -- 0:00:53
130000 -- (-993.708) [-1000.630] (-1000.026) (-998.016) * (-994.499) (-995.646) [-995.416] (-996.595) -- 0:00:53
Average standard deviation of split frequencies: 0.024713
130500 -- (-995.173) (-997.309) [-997.998] (-995.108) * (-996.865) (-995.628) (-995.830) [-998.046] -- 0:00:53
131000 -- (-995.823) (-996.222) [-994.656] (-995.485) * [-995.756] (-995.455) (-1000.748) (-998.655) -- 0:00:53
131500 -- (-996.471) [-996.931] (-997.212) (-996.360) * (-996.404) (-996.457) (-994.899) [-994.867] -- 0:00:52
132000 -- [-995.915] (-997.976) (-995.971) (-995.230) * (-997.884) (-996.430) [-995.724] (-997.048) -- 0:00:52
132500 -- [-995.130] (-1003.881) (-995.994) (-996.533) * (-994.953) [-994.093] (-999.960) (-994.555) -- 0:00:52
133000 -- [-995.068] (-994.578) (-994.718) (-994.746) * (-995.270) (-996.905) (-997.234) [-994.721] -- 0:00:52
133500 -- (-998.117) [-998.391] (-994.885) (-995.082) * (-995.483) (-1001.983) (-999.622) [-994.223] -- 0:00:51
134000 -- (-997.226) [-995.049] (-993.792) (-996.366) * (-1005.280) (-998.547) (-1003.588) [-997.356] -- 0:00:51
134500 -- [-996.426] (-993.683) (-997.081) (-997.287) * (-1000.858) [-997.885] (-998.903) (-996.819) -- 0:00:51
135000 -- (-996.833) (-995.874) [-993.864] (-998.024) * (-998.932) (-995.233) (-997.764) [-995.580] -- 0:00:51
Average standard deviation of split frequencies: 0.020797
135500 -- (-997.780) [-996.369] (-994.605) (-1003.270) * [-996.135] (-995.678) (-995.376) (-999.464) -- 0:00:51
136000 -- [-994.570] (-993.997) (-995.266) (-995.993) * [-995.891] (-999.068) (-998.397) (-994.738) -- 0:00:50
136500 -- (-995.085) [-994.318] (-996.680) (-996.863) * (-1000.073) (-999.380) (-996.385) [-995.166] -- 0:00:50
137000 -- (-994.694) (-997.904) [-1000.902] (-996.417) * [-994.711] (-995.199) (-999.335) (-994.781) -- 0:00:50
137500 -- [-995.858] (-993.762) (-995.696) (-996.039) * [-997.427] (-996.709) (-997.565) (-997.878) -- 0:00:56
138000 -- (-995.156) (-994.926) [-995.896] (-996.045) * [-997.705] (-997.318) (-995.026) (-995.166) -- 0:00:56
138500 -- (-999.016) (-997.765) (-995.679) [-996.002] * (-996.099) (-996.600) [-994.514] (-998.056) -- 0:00:55
139000 -- (-993.700) [-994.321] (-997.155) (-997.417) * (-996.647) [-997.951] (-995.388) (-997.860) -- 0:00:55
139500 -- [-994.089] (-997.879) (-997.721) (-996.594) * [-995.546] (-998.715) (-996.402) (-996.295) -- 0:00:55
140000 -- (-994.427) (-995.999) (-996.938) [-995.845] * (-998.057) [-997.170] (-998.388) (-995.841) -- 0:00:55
Average standard deviation of split frequencies: 0.020107
140500 -- (-995.690) [-997.596] (-996.802) (-994.688) * [-997.240] (-996.149) (-999.531) (-995.869) -- 0:00:55
141000 -- (-994.999) (-997.219) (-997.910) [-995.970] * [-995.865] (-999.651) (-996.813) (-996.275) -- 0:00:54
141500 -- [-994.425] (-994.233) (-997.133) (-996.451) * (-995.826) (-995.509) [-996.481] (-997.161) -- 0:00:54
142000 -- [-994.272] (-995.102) (-995.695) (-994.252) * (-998.388) (-995.521) [-995.032] (-997.059) -- 0:00:54
142500 -- (-994.408) (-995.588) [-1002.598] (-994.512) * (-996.757) (-994.187) [-998.676] (-996.215) -- 0:00:54
143000 -- (-1000.339) [-994.767] (-1002.257) (-994.794) * [-997.072] (-993.967) (-995.396) (-995.490) -- 0:00:53
143500 -- [-1001.105] (-995.077) (-999.337) (-994.423) * (-996.709) (-995.160) (-994.705) [-995.064] -- 0:00:53
144000 -- (-997.535) (-997.345) [-995.284] (-997.548) * (-999.163) (-995.739) [-996.779] (-994.874) -- 0:00:53
144500 -- [-996.259] (-996.345) (-993.665) (-995.638) * (-999.902) [-996.908] (-997.505) (-999.382) -- 0:00:53
145000 -- (-996.027) (-1000.305) [-994.059] (-994.697) * [-996.017] (-1000.164) (-999.426) (-995.329) -- 0:00:53
Average standard deviation of split frequencies: 0.019373
145500 -- (-998.086) (-996.090) (-994.879) [-996.179] * (-998.525) (-997.649) [-998.459] (-1000.059) -- 0:00:52
146000 -- (-1000.394) (-998.984) (-994.332) [-994.709] * (-997.056) (-996.798) [-995.125] (-999.971) -- 0:00:52
146500 -- (-995.151) (-998.680) (-995.514) [-995.307] * (-998.220) (-994.176) [-995.641] (-999.408) -- 0:00:52
147000 -- (-994.921) (-997.602) (-996.716) [-995.454] * (-997.433) [-995.110] (-994.671) (-1001.184) -- 0:00:52
147500 -- [-995.042] (-995.784) (-995.698) (-996.027) * (-999.727) (-996.507) [-996.107] (-997.596) -- 0:00:52
148000 -- [-994.880] (-995.528) (-997.369) (-996.286) * (-994.376) (-996.197) (-996.752) [-994.434] -- 0:00:51
148500 -- (-996.324) (-996.161) (-998.529) [-997.888] * (-996.325) (-996.062) [-995.696] (-1001.404) -- 0:00:51
149000 -- (-997.823) (-998.511) [-994.783] (-995.787) * (-994.494) (-994.797) (-994.842) [-998.608] -- 0:00:51
149500 -- [-996.388] (-996.455) (-997.832) (-998.070) * (-997.033) [-995.451] (-994.781) (-996.469) -- 0:00:51
150000 -- (-994.184) [-998.224] (-995.828) (-994.926) * (-998.322) (-996.946) (-994.115) [-994.962] -- 0:00:51
Average standard deviation of split frequencies: 0.018608
150500 -- (-996.056) (-1000.160) [-995.528] (-994.453) * (-994.270) (-997.201) [-993.963] (-998.610) -- 0:00:50
151000 -- (-994.176) (-993.994) (-998.096) [-995.087] * (-994.327) (-999.176) (-996.211) [-996.147] -- 0:00:50
151500 -- [-995.755] (-994.092) (-997.875) (-995.983) * (-994.858) [-995.336] (-995.753) (-996.182) -- 0:00:50
152000 -- (-995.202) (-995.550) [-994.769] (-996.789) * (-999.124) (-995.746) [-996.615] (-993.756) -- 0:00:50
152500 -- (-994.493) (-994.349) [-995.327] (-995.221) * [-994.462] (-996.042) (-997.296) (-994.713) -- 0:00:50
153000 -- (-996.897) (-995.581) [-995.406] (-995.625) * (-995.112) [-996.372] (-998.191) (-995.981) -- 0:00:49
153500 -- [-993.882] (-994.965) (-997.410) (-995.883) * (-993.967) (-997.550) [-995.331] (-996.416) -- 0:00:49
154000 -- (-995.073) [-993.709] (-995.485) (-996.163) * (-994.751) (-996.255) [-996.065] (-995.645) -- 0:00:54
154500 -- (-994.341) (-996.637) [-994.248] (-994.941) * (-994.838) [-995.284] (-997.218) (-995.775) -- 0:00:54
155000 -- (-994.510) (-997.016) [-995.965] (-995.206) * (-996.250) (-995.728) [-995.699] (-995.190) -- 0:00:54
Average standard deviation of split frequencies: 0.017795
155500 -- (-996.397) [-996.747] (-1000.094) (-994.367) * [-994.398] (-994.610) (-994.774) (-995.408) -- 0:00:54
156000 -- (-995.882) (-995.820) [-996.211] (-995.367) * (-994.349) (-995.637) (-1002.806) [-996.389] -- 0:00:54
156500 -- (-994.879) (-996.299) [-995.538] (-995.087) * (-997.878) (-994.765) [-995.765] (-994.907) -- 0:00:53
157000 -- (-994.741) (-994.477) (-994.659) [-996.746] * [-996.215] (-995.219) (-997.386) (-996.408) -- 0:00:53
157500 -- (-999.747) (-996.143) [-996.060] (-998.721) * (-994.530) (-999.197) (-994.417) [-995.036] -- 0:00:53
158000 -- [-998.027] (-995.502) (-996.976) (-995.963) * [-994.567] (-995.605) (-996.418) (-996.703) -- 0:00:53
158500 -- (-995.619) [-997.953] (-995.574) (-995.204) * (-997.862) [-994.545] (-999.240) (-997.649) -- 0:00:53
159000 -- (-995.154) (-1000.415) [-994.475] (-996.690) * (-997.920) (-994.295) (-1001.637) [-996.772] -- 0:00:52
159500 -- (-997.572) (-1000.671) [-994.479] (-996.427) * (-998.797) [-994.097] (-996.995) (-995.409) -- 0:00:52
160000 -- [-995.266] (-1000.861) (-994.047) (-994.450) * [-995.648] (-999.613) (-997.624) (-996.906) -- 0:00:52
Average standard deviation of split frequencies: 0.019457
160500 -- [-995.321] (-998.309) (-994.652) (-997.119) * [-996.110] (-996.442) (-995.584) (-997.817) -- 0:00:52
161000 -- (-996.452) [-995.602] (-994.790) (-997.919) * (-994.877) (-994.812) (-996.737) [-995.158] -- 0:00:52
161500 -- [-995.196] (-997.151) (-996.237) (-997.915) * (-999.712) [-994.916] (-997.595) (-993.857) -- 0:00:51
162000 -- (-994.375) [-996.300] (-999.406) (-995.913) * [-997.097] (-995.857) (-998.675) (-997.711) -- 0:00:51
162500 -- (-994.996) [-995.766] (-998.690) (-995.529) * (-994.990) (-994.799) [-996.917] (-996.130) -- 0:00:51
163000 -- (-994.845) [-995.329] (-997.050) (-996.175) * [-996.220] (-995.403) (-995.684) (-998.768) -- 0:00:51
163500 -- (-997.486) [-995.216] (-997.867) (-995.433) * (-995.054) [-994.326] (-998.005) (-998.365) -- 0:00:51
164000 -- (-998.572) (-996.152) (-996.572) [-995.637] * (-995.547) (-994.654) (-1002.801) [-994.645] -- 0:00:50
164500 -- (-997.363) (-995.589) (-996.700) [-994.440] * (-994.734) (-997.230) (-994.850) [-996.491] -- 0:00:50
165000 -- [-995.938] (-999.096) (-1000.071) (-993.985) * [-995.853] (-998.531) (-997.195) (-995.660) -- 0:00:50
Average standard deviation of split frequencies: 0.017465
165500 -- [-994.631] (-995.244) (-995.206) (-995.598) * (-996.254) [-995.789] (-999.157) (-995.437) -- 0:00:50
166000 -- (-996.977) (-994.161) (-995.108) [-996.149] * [-996.122] (-997.903) (-995.986) (-998.274) -- 0:00:50
166500 -- (-995.759) [-994.476] (-997.220) (-994.897) * (-997.713) (-998.592) (-995.954) [-994.692] -- 0:00:50
167000 -- (-995.673) (-995.497) [-994.788] (-995.144) * (-995.931) (-996.687) (-994.411) [-997.483] -- 0:00:49
167500 -- (-999.794) [-996.830] (-996.340) (-996.789) * (-996.327) [-995.903] (-995.633) (-998.271) -- 0:00:49
168000 -- (-994.161) [-994.200] (-998.024) (-995.430) * (-996.141) [-997.313] (-996.035) (-999.133) -- 0:00:49
168500 -- (-994.930) [-994.294] (-996.099) (-996.997) * [-994.992] (-996.442) (-995.602) (-998.681) -- 0:00:49
169000 -- (-995.182) (-995.288) [-994.412] (-995.687) * [-996.160] (-998.718) (-996.271) (-995.028) -- 0:00:49
169500 -- (-996.249) (-995.553) (-996.186) [-997.747] * (-997.622) (-997.383) (-1001.538) [-994.619] -- 0:00:48
170000 -- (-994.892) (-996.553) (-996.402) [-997.611] * (-996.856) (-996.225) (-998.617) [-996.969] -- 0:00:48
Average standard deviation of split frequencies: 0.016864
170500 -- (-999.506) (-995.983) [-994.362] (-997.614) * [-1000.195] (-995.612) (-995.591) (-996.611) -- 0:00:53
171000 -- [-995.790] (-996.016) (-997.090) (-999.536) * (-1002.737) [-993.941] (-996.745) (-999.716) -- 0:00:53
171500 -- (-996.066) (-995.302) [-995.168] (-997.566) * [-995.247] (-994.298) (-994.299) (-996.008) -- 0:00:53
172000 -- [-997.333] (-995.061) (-995.488) (-995.556) * (-995.954) (-996.075) [-994.626] (-998.953) -- 0:00:52
172500 -- (-995.488) (-1002.539) [-997.436] (-999.660) * [-995.891] (-995.529) (-996.647) (-1000.042) -- 0:00:52
173000 -- (-994.081) (-999.749) [-994.261] (-997.490) * [-996.054] (-995.593) (-995.791) (-996.754) -- 0:00:52
173500 -- (-994.081) (-1000.293) [-994.983] (-996.317) * [-995.439] (-994.566) (-997.466) (-997.308) -- 0:00:52
174000 -- (-1000.178) [-998.313] (-994.307) (-996.314) * (-994.977) (-994.232) [-995.277] (-995.798) -- 0:00:52
174500 -- (-996.035) (-995.989) [-993.744] (-996.921) * (-996.132) [-994.850] (-993.737) (-995.816) -- 0:00:52
175000 -- (-994.958) (-994.436) [-993.982] (-995.417) * (-997.909) [-994.850] (-995.820) (-994.055) -- 0:00:51
Average standard deviation of split frequencies: 0.015178
175500 -- [-994.530] (-994.311) (-993.973) (-995.415) * (-996.354) (-994.415) (-995.488) [-996.136] -- 0:00:51
176000 -- (-995.854) (-996.404) [-993.529] (-994.222) * (-993.681) (-996.169) [-995.408] (-995.626) -- 0:00:51
176500 -- [-997.491] (-997.832) (-994.802) (-994.186) * (-996.711) (-997.495) (-994.570) [-995.693] -- 0:00:51
177000 -- (-995.093) (-996.699) (-994.962) [-995.395] * [-996.753] (-998.606) (-998.552) (-994.411) -- 0:00:51
177500 -- (-994.724) (-997.923) (-997.214) [-998.141] * [-995.557] (-995.507) (-998.162) (-996.528) -- 0:00:50
178000 -- (-998.608) (-996.353) (-995.237) [-997.426] * [-997.247] (-994.059) (-997.026) (-995.184) -- 0:00:50
178500 -- [-999.167] (-995.737) (-999.160) (-994.241) * (-998.353) (-995.980) [-994.413] (-995.144) -- 0:00:50
179000 -- (-998.513) (-996.988) [-999.258] (-996.255) * (-994.718) (-996.076) [-993.806] (-996.880) -- 0:00:50
179500 -- (-999.086) (-995.142) (-994.311) [-996.109] * (-994.815) (-997.184) [-993.891] (-996.191) -- 0:00:50
180000 -- (-995.470) (-995.753) [-994.224] (-996.856) * (-995.745) [-995.923] (-999.052) (-995.323) -- 0:00:50
Average standard deviation of split frequencies: 0.015502
180500 -- (-1000.579) (-994.716) [-994.232] (-995.707) * (-993.432) (-995.969) [-995.891] (-996.154) -- 0:00:49
181000 -- (-995.663) (-1004.957) [-996.837] (-996.099) * (-994.480) (-995.755) (-995.856) [-994.720] -- 0:00:49
181500 -- (-994.926) (-1002.637) (-998.171) [-996.295] * (-996.600) (-994.266) [-995.800] (-996.160) -- 0:00:49
182000 -- (-994.653) (-996.316) (-998.073) [-996.069] * (-998.407) [-993.958] (-996.786) (-995.093) -- 0:00:49
182500 -- [-995.405] (-998.123) (-995.507) (-994.983) * (-995.578) (-995.978) [-997.247] (-996.022) -- 0:00:49
183000 -- (-994.651) (-996.006) [-993.978] (-996.426) * (-998.361) [-995.532] (-998.945) (-993.974) -- 0:00:49
183500 -- (-994.409) (-994.281) [-993.996] (-995.693) * (-997.807) (-1002.831) (-995.005) [-994.337] -- 0:00:48
184000 -- (-994.035) (-994.932) [-995.327] (-995.541) * (-996.861) (-995.393) (-996.793) [-995.246] -- 0:00:48
184500 -- (-995.197) (-998.094) [-1000.948] (-994.326) * (-997.236) [-995.893] (-995.671) (-1002.766) -- 0:00:48
185000 -- [-997.105] (-997.619) (-1002.012) (-997.861) * (-998.488) (-995.423) [-997.618] (-997.321) -- 0:00:48
Average standard deviation of split frequencies: 0.015911
185500 -- [-997.672] (-995.389) (-994.226) (-995.189) * (-996.357) [-996.213] (-994.962) (-997.257) -- 0:00:48
186000 -- (-1003.866) (-994.832) (-994.079) [-996.957] * [-997.153] (-994.195) (-995.264) (-996.803) -- 0:00:48
186500 -- (-995.717) [-998.693] (-998.100) (-997.033) * [-997.679] (-995.331) (-997.236) (-995.821) -- 0:00:47
187000 -- [-994.564] (-995.719) (-996.023) (-994.979) * (-995.413) (-995.470) [-994.220] (-995.732) -- 0:00:52
187500 -- (-994.713) (-999.692) (-996.419) [-995.478] * (-994.543) (-995.456) (-995.660) [-996.343] -- 0:00:52
188000 -- (-995.119) [-999.666] (-994.959) (-995.363) * (-996.548) [-996.760] (-995.498) (-996.127) -- 0:00:51
188500 -- (-996.058) (-995.726) [-994.444] (-996.913) * (-994.049) (-995.067) [-994.413] (-995.954) -- 0:00:51
189000 -- [-995.748] (-995.906) (-996.695) (-998.253) * (-995.917) (-996.039) (-995.079) [-997.611] -- 0:00:51
189500 -- (-996.924) (-997.191) (-997.118) [-996.479] * (-1002.355) [-995.715] (-995.561) (-998.364) -- 0:00:51
190000 -- (-995.966) (-996.416) (-998.641) [-994.293] * [-997.775] (-995.948) (-999.935) (-996.651) -- 0:00:51
Average standard deviation of split frequencies: 0.014544
190500 -- [-996.584] (-993.978) (-1003.636) (-994.791) * (-994.483) (-994.077) [-995.678] (-995.092) -- 0:00:50
191000 -- [-996.735] (-994.861) (-1002.100) (-994.635) * (-994.972) (-994.655) [-994.402] (-994.768) -- 0:00:50
191500 -- (-997.022) [-998.291] (-1000.843) (-994.383) * (-995.014) (-998.274) [-996.184] (-994.452) -- 0:00:50
192000 -- (-998.099) [-996.205] (-998.872) (-994.310) * (-995.814) [-998.382] (-996.777) (-994.296) -- 0:00:50
192500 -- (-996.013) (-996.758) (-994.239) [-994.727] * (-994.711) (-994.326) [-997.475] (-995.547) -- 0:00:50
193000 -- [-996.692] (-995.953) (-995.861) (-998.221) * (-997.929) [-995.632] (-997.769) (-996.332) -- 0:00:50
193500 -- (-998.518) [-995.226] (-997.492) (-995.770) * [-995.304] (-996.073) (-997.957) (-995.519) -- 0:00:50
194000 -- (-994.362) (-997.764) (-997.689) [-994.725] * [-999.975] (-997.478) (-996.044) (-996.044) -- 0:00:49
194500 -- (-995.805) [-997.472] (-998.493) (-997.864) * (-998.073) (-1000.717) [-997.791] (-994.522) -- 0:00:49
195000 -- (-994.338) (-997.544) [-998.752] (-995.230) * (-994.986) (-999.067) [-996.435] (-995.140) -- 0:00:49
Average standard deviation of split frequencies: 0.014714
195500 -- [-994.481] (-997.448) (-999.731) (-994.002) * (-994.891) (-993.784) [-994.384] (-994.953) -- 0:00:49
196000 -- (-994.511) (-995.845) (-1004.280) [-996.362] * (-996.207) (-997.100) (-994.890) [-993.801] -- 0:00:49
196500 -- (-996.908) (-995.155) [-997.256] (-997.141) * (-994.851) [-997.104] (-998.448) (-995.543) -- 0:00:49
197000 -- (-995.022) [-996.877] (-995.487) (-997.467) * (-997.751) (-998.923) [-994.339] (-993.715) -- 0:00:48
197500 -- (-994.979) [-995.798] (-998.077) (-997.756) * (-996.480) (-996.210) (-996.363) [-993.689] -- 0:00:48
198000 -- (-995.584) (-995.833) (-996.827) [-996.432] * (-998.708) (-999.786) [-997.855] (-994.669) -- 0:00:48
198500 -- (-996.125) (-995.792) (-995.184) [-994.702] * [-996.592] (-1000.656) (-994.382) (-994.794) -- 0:00:48
199000 -- (-997.925) (-994.922) (-994.602) [-995.626] * [-994.257] (-1004.473) (-993.905) (-997.511) -- 0:00:48
199500 -- (-997.908) (-994.183) (-994.275) [-997.951] * [-996.150] (-998.882) (-994.893) (-994.666) -- 0:00:48
200000 -- [-996.418] (-995.456) (-994.948) (-996.706) * [-996.022] (-997.418) (-994.608) (-995.416) -- 0:00:48
Average standard deviation of split frequencies: 0.015400
200500 -- (-995.565) [-994.895] (-996.074) (-997.223) * (-996.243) (-997.366) (-995.086) [-994.693] -- 0:00:47
201000 -- (-1002.530) (-998.961) [-999.206] (-997.156) * (-995.948) (-997.696) [-995.380] (-995.001) -- 0:00:47
201500 -- (-999.333) (-995.868) [-997.560] (-997.108) * (-996.983) [-994.195] (-994.912) (-994.991) -- 0:00:47
202000 -- (-995.714) (-996.720) (-996.966) [-995.320] * (-997.195) (-995.596) (-994.378) [-995.596] -- 0:00:47
202500 -- (-999.493) [-994.794] (-997.689) (-996.504) * (-1001.364) (-994.415) (-995.188) [-994.794] -- 0:00:47
203000 -- (-1002.026) (-995.669) (-997.492) [-996.349] * [-995.627] (-995.076) (-995.281) (-999.377) -- 0:00:47
203500 -- (-996.293) (-994.513) [-996.261] (-997.689) * (-996.790) [-995.951] (-994.359) (-996.235) -- 0:00:50
204000 -- (-994.595) (-995.000) [-994.924] (-994.062) * (-996.298) (-997.286) [-994.789] (-995.279) -- 0:00:50
204500 -- (-996.197) (-996.078) [-994.003] (-994.632) * (-996.837) [-995.167] (-1001.716) (-999.619) -- 0:00:50
205000 -- [-996.172] (-995.594) (-994.024) (-996.291) * (-993.932) (-997.537) (-995.284) [-997.193] -- 0:00:50
Average standard deviation of split frequencies: 0.015657
205500 -- [-993.818] (-995.352) (-994.410) (-994.039) * (-993.857) (-994.316) (-995.773) [-996.043] -- 0:00:50
206000 -- (-995.719) [-997.554] (-1000.610) (-995.927) * (-994.765) (-996.401) [-993.781] (-994.526) -- 0:00:50
206500 -- (-997.613) [-994.188] (-998.696) (-999.270) * (-996.324) [-994.604] (-994.952) (-994.752) -- 0:00:49
207000 -- [-995.879] (-994.012) (-993.864) (-995.591) * (-996.001) (-996.635) [-996.196] (-994.425) -- 0:00:49
207500 -- (-994.798) [-996.846] (-995.431) (-994.632) * (-1003.348) (-995.478) [-996.380] (-993.896) -- 0:00:49
208000 -- [-996.751] (-995.053) (-995.020) (-995.123) * (-995.958) (-998.358) [-995.782] (-994.172) -- 0:00:49
208500 -- (-995.644) [-994.551] (-993.961) (-994.557) * [-996.403] (-993.644) (-996.745) (-993.883) -- 0:00:49
209000 -- (-997.178) (-996.907) (-995.194) [-993.725] * [-994.881] (-997.048) (-998.746) (-997.321) -- 0:00:49
209500 -- (-1003.206) (-994.707) (-997.338) [-995.386] * [-996.255] (-996.956) (-995.973) (-997.837) -- 0:00:49
210000 -- (-996.527) [-994.506] (-996.406) (-996.576) * (-994.426) (-994.097) (-1000.986) [-994.633] -- 0:00:48
Average standard deviation of split frequencies: 0.015899
210500 -- (-996.463) (-995.631) [-996.675] (-997.557) * [-993.655] (-994.058) (-995.318) (-993.949) -- 0:00:48
211000 -- (-997.142) [-996.566] (-998.554) (-994.330) * (-995.432) (-994.058) (-995.230) [-994.143] -- 0:00:48
211500 -- [-995.087] (-999.069) (-998.409) (-995.073) * (-994.629) (-995.314) (-997.453) [-995.037] -- 0:00:48
212000 -- [-994.913] (-1000.485) (-996.712) (-996.838) * [-996.791] (-998.650) (-1002.195) (-996.553) -- 0:00:48
212500 -- (-994.689) (-1000.398) [-996.785] (-994.229) * (-997.196) (-997.960) [-995.426] (-996.104) -- 0:00:48
213000 -- (-994.774) (-998.918) (-996.779) [-995.300] * (-999.030) (-997.052) (-995.896) [-995.291] -- 0:00:48
213500 -- [-994.961] (-995.759) (-993.835) (-994.426) * (-999.488) (-994.669) (-1000.054) [-994.829] -- 0:00:47
214000 -- [-995.040] (-995.071) (-994.225) (-994.124) * [-995.351] (-994.848) (-994.154) (-1002.991) -- 0:00:47
214500 -- (-1000.939) (-995.253) [-996.689] (-998.494) * [-995.786] (-995.584) (-994.966) (-996.542) -- 0:00:47
215000 -- [-996.127] (-994.396) (-996.903) (-997.058) * (-993.840) [-994.659] (-995.048) (-999.773) -- 0:00:47
Average standard deviation of split frequencies: 0.016611
215500 -- (-996.924) (-994.515) (-999.706) [-1001.825] * [-994.766] (-995.344) (-994.707) (-998.316) -- 0:00:47
216000 -- (-998.041) (-993.805) [-994.625] (-998.317) * (-995.383) (-997.355) [-995.537] (-996.915) -- 0:00:47
216500 -- [-996.433] (-994.982) (-996.556) (-994.636) * (-995.409) (-999.271) (-994.312) [-995.767] -- 0:00:47
217000 -- (-997.177) (-997.640) (-996.535) [-994.132] * [-995.148] (-996.925) (-994.580) (-994.354) -- 0:00:46
217500 -- (-997.979) (-994.591) [-994.838] (-994.416) * (-997.598) [-995.494] (-997.086) (-994.296) -- 0:00:46
218000 -- (-995.399) [-994.562] (-995.364) (-994.643) * (-995.088) (-994.700) (-996.176) [-997.771] -- 0:00:46
218500 -- (-994.933) (-994.648) [-997.774] (-997.589) * (-998.194) [-994.565] (-996.813) (-994.440) -- 0:00:46
219000 -- (-994.548) [-995.008] (-994.362) (-996.652) * [-995.568] (-998.603) (-995.076) (-994.402) -- 0:00:46
219500 -- (-995.676) (-994.710) (-996.345) [-996.575] * (-996.761) (-996.189) [-993.623] (-997.279) -- 0:00:46
220000 -- (-996.695) (-994.649) (-995.118) [-996.959] * (-997.151) [-1003.110] (-995.156) (-996.939) -- 0:00:49
Average standard deviation of split frequencies: 0.016085
220500 -- [-998.762] (-994.681) (-996.667) (-997.433) * (-999.968) (-1000.356) [-996.332] (-995.610) -- 0:00:49
221000 -- [-999.333] (-994.522) (-995.361) (-998.555) * (-995.013) (-999.661) (-997.183) [-995.688] -- 0:00:49
221500 -- (-996.086) (-995.004) (-996.470) [-995.049] * [-994.080] (-997.588) (-996.879) (-995.178) -- 0:00:49
222000 -- (-996.087) (-997.080) [-994.473] (-997.962) * (-996.850) (-995.577) (-995.447) [-996.020] -- 0:00:49
222500 -- (-995.123) (-998.395) (-995.084) [-994.493] * [-996.466] (-995.289) (-996.364) (-998.502) -- 0:00:48
223000 -- (-997.434) (-995.352) [-997.743] (-997.257) * (-996.079) [-997.911] (-998.021) (-996.863) -- 0:00:48
223500 -- (-997.430) [-994.266] (-998.475) (-995.631) * (-998.894) [-997.045] (-993.434) (-997.280) -- 0:00:48
224000 -- (-998.006) (-995.883) [-996.376] (-995.244) * (-997.429) [-996.673] (-996.648) (-997.098) -- 0:00:48
224500 -- (-996.976) [-995.384] (-994.858) (-995.643) * (-995.465) [-997.407] (-994.454) (-994.855) -- 0:00:48
225000 -- (-994.577) [-993.687] (-994.533) (-997.123) * (-998.603) (-996.671) (-995.489) [-996.892] -- 0:00:48
Average standard deviation of split frequencies: 0.014478
225500 -- (-996.889) (-995.560) [-996.929] (-996.466) * (-997.118) (-997.721) [-995.762] (-994.500) -- 0:00:48
226000 -- (-998.710) [-994.868] (-994.857) (-998.454) * (-995.875) [-995.312] (-994.464) (-994.338) -- 0:00:47
226500 -- (-997.275) [-995.723] (-994.065) (-1001.796) * (-998.011) (-994.634) [-994.055] (-995.681) -- 0:00:47
227000 -- (-996.301) (-994.287) (-993.848) [-999.386] * (-995.220) [-994.639] (-998.777) (-996.060) -- 0:00:47
227500 -- (-996.831) (-995.877) [-994.108] (-996.405) * (-996.488) (-994.347) [-999.300] (-994.162) -- 0:00:47
228000 -- (-995.383) [-998.520] (-995.430) (-994.655) * (-996.918) (-994.700) [-996.856] (-996.375) -- 0:00:47
228500 -- (-997.436) [-995.604] (-996.372) (-994.179) * (-998.407) [-994.468] (-994.840) (-1002.255) -- 0:00:47
229000 -- (-997.324) (-994.708) [-994.691] (-994.163) * (-995.839) [-995.004] (-995.557) (-995.054) -- 0:00:47
229500 -- [-994.826] (-995.573) (-995.202) (-994.031) * (-996.639) (-996.253) (-994.736) [-995.180] -- 0:00:47
230000 -- (-996.289) [-995.388] (-994.338) (-994.357) * [-997.391] (-998.298) (-996.816) (-997.163) -- 0:00:46
Average standard deviation of split frequencies: 0.013344
230500 -- (-995.187) (-996.089) (-994.667) [-995.287] * [-994.276] (-998.531) (-996.930) (-995.337) -- 0:00:46
231000 -- (-994.458) (-995.409) [-996.432] (-995.939) * (-995.715) (-993.909) [-995.040] (-996.277) -- 0:00:46
231500 -- (-993.885) (-995.609) [-995.801] (-996.479) * [-995.994] (-994.720) (-997.125) (-995.974) -- 0:00:46
232000 -- (-995.834) [-995.845] (-995.760) (-994.936) * (-995.200) (-998.260) (-996.053) [-999.497] -- 0:00:46
232500 -- (-994.749) (-995.538) [-996.207] (-994.467) * (-996.398) [-995.343] (-995.978) (-998.565) -- 0:00:46
233000 -- (-995.191) [-995.083] (-995.111) (-996.299) * (-995.618) (-994.139) (-994.472) [-994.769] -- 0:00:46
233500 -- (-999.015) (-996.212) (-995.147) [-996.123] * (-995.074) [-995.606] (-996.842) (-996.699) -- 0:00:45
234000 -- (-998.142) (-997.768) [-997.159] (-996.909) * (-994.969) [-995.091] (-995.326) (-995.550) -- 0:00:45
234500 -- (-994.952) (-996.512) (-994.228) [-997.078] * (-994.999) (-1001.130) [-994.465] (-996.623) -- 0:00:45
235000 -- (-999.245) [-1002.693] (-994.214) (-997.516) * (-998.448) [-995.476] (-994.274) (-995.505) -- 0:00:45
Average standard deviation of split frequencies: 0.013042
235500 -- (-993.808) (-1003.931) (-995.072) [-999.182] * (-996.682) (-994.530) [-994.368] (-994.499) -- 0:00:45
236000 -- (-994.739) (-993.855) [-994.738] (-1001.277) * (-995.442) (-995.217) [-996.597] (-997.692) -- 0:00:45
236500 -- (-994.592) (-994.520) [-995.111] (-996.424) * [-998.811] (-996.892) (-996.870) (-995.108) -- 0:00:48
237000 -- (-994.612) (-996.406) (-997.752) [-995.466] * (-995.344) (-995.800) [-998.850] (-1000.163) -- 0:00:48
237500 -- (-995.696) (-995.278) (-993.868) [-996.817] * (-993.837) (-995.902) [-996.360] (-996.639) -- 0:00:48
238000 -- (-994.747) (-994.509) [-994.731] (-997.267) * (-993.639) (-995.203) [-994.997] (-996.311) -- 0:00:48
238500 -- (-998.554) [-994.184] (-994.223) (-998.258) * [-994.526] (-993.999) (-996.096) (-998.245) -- 0:00:47
239000 -- (-1000.017) (-994.188) [-998.531] (-994.254) * [-997.295] (-995.412) (-996.692) (-996.229) -- 0:00:47
239500 -- (-995.073) [-995.460] (-999.816) (-997.329) * (-996.462) (-998.968) (-996.152) [-997.029] -- 0:00:47
240000 -- (-995.333) (-996.407) [-996.072] (-998.963) * [-1000.178] (-999.873) (-997.976) (-994.391) -- 0:00:47
Average standard deviation of split frequencies: 0.013135
240500 -- [-996.622] (-996.944) (-1002.537) (-996.603) * (-994.478) (-996.119) (-1000.568) [-995.290] -- 0:00:47
241000 -- [-996.825] (-997.625) (-994.406) (-1001.151) * (-994.931) (-998.368) (-998.365) [-994.869] -- 0:00:47
241500 -- [-998.492] (-999.751) (-995.134) (-996.495) * (-995.383) (-996.932) [-1000.081] (-995.098) -- 0:00:47
242000 -- (-998.308) (-997.084) [-997.254] (-997.232) * (-993.860) [-997.013] (-994.704) (-994.916) -- 0:00:46
242500 -- (-996.443) (-995.821) (-995.311) [-995.079] * (-996.683) (-998.556) [-994.833] (-996.198) -- 0:00:46
243000 -- [-994.901] (-999.254) (-997.354) (-996.685) * [-994.716] (-997.688) (-996.859) (-994.250) -- 0:00:46
243500 -- (-995.833) (-999.175) (-998.130) [-994.657] * (-994.492) [-997.409] (-995.556) (-994.199) -- 0:00:46
244000 -- [-994.402] (-998.861) (-999.067) (-994.556) * (-993.759) [-994.389] (-996.283) (-994.477) -- 0:00:46
244500 -- (-995.160) (-996.690) (-996.843) [-994.142] * [-995.608] (-994.365) (-996.390) (-994.051) -- 0:00:46
245000 -- [-995.176] (-997.905) (-994.837) (-994.168) * (-996.210) (-993.832) [-994.212] (-997.951) -- 0:00:46
Average standard deviation of split frequencies: 0.013639
245500 -- (-997.264) [-994.817] (-994.360) (-994.546) * (-996.764) (-998.274) (-997.225) [-998.046] -- 0:00:46
246000 -- (-997.732) [-996.003] (-995.166) (-994.641) * (-995.191) [-994.089] (-996.141) (-999.280) -- 0:00:45
246500 -- (-1001.034) [-995.355] (-996.045) (-995.836) * (-995.192) (-998.891) (-994.739) [-994.705] -- 0:00:45
247000 -- (-998.415) (-995.908) (-994.991) [-996.848] * [-993.919] (-998.095) (-998.416) (-996.051) -- 0:00:45
247500 -- [-994.840] (-995.054) (-996.563) (-1000.975) * (-993.907) (-996.321) [-995.709] (-996.786) -- 0:00:45
248000 -- (-995.637) (-996.636) (-996.342) [-998.158] * (-994.219) [-996.716] (-994.268) (-996.818) -- 0:00:45
248500 -- (-999.366) [-997.315] (-995.192) (-996.027) * [-993.882] (-997.462) (-994.969) (-995.230) -- 0:00:45
249000 -- (-1000.022) [-996.246] (-995.429) (-994.524) * (-993.904) [-998.879] (-994.854) (-997.236) -- 0:00:45
249500 -- (-995.468) [-995.866] (-995.189) (-997.429) * (-997.104) (-996.118) [-995.269] (-996.097) -- 0:00:45
250000 -- (-994.153) (-994.499) [-994.575] (-995.312) * (-995.556) (-996.066) [-998.061] (-997.216) -- 0:00:45
Average standard deviation of split frequencies: 0.014418
250500 -- (-994.326) (-994.820) [-995.492] (-996.564) * [-995.856] (-996.975) (-994.636) (-999.530) -- 0:00:44
251000 -- [-994.370] (-995.874) (-996.617) (-996.111) * [-994.156] (-996.964) (-996.812) (-997.251) -- 0:00:44
251500 -- [-1001.013] (-995.731) (-997.313) (-995.864) * (-994.365) (-995.472) [-995.274] (-999.963) -- 0:00:44
252000 -- (-994.862) [-996.010] (-998.687) (-994.890) * (-996.801) [-994.312] (-998.268) (-995.052) -- 0:00:44
252500 -- (-996.425) (-999.339) [-993.655] (-994.779) * (-998.086) (-994.569) [-996.463] (-994.423) -- 0:00:44
253000 -- (-995.952) (-996.101) (-996.876) [-994.211] * (-999.430) [-995.839] (-996.286) (-994.309) -- 0:00:47
253500 -- (-1001.916) (-997.007) [-997.872] (-993.984) * (-995.161) (-994.936) [-995.851] (-997.945) -- 0:00:47
254000 -- (-1004.064) [-998.312] (-997.709) (-994.953) * (-997.707) (-997.320) (-997.156) [-996.593] -- 0:00:46
254500 -- (-995.392) [-995.253] (-997.677) (-994.390) * (-995.453) [-996.677] (-998.218) (-996.852) -- 0:00:46
255000 -- (-994.829) [-994.544] (-1000.274) (-995.800) * (-995.087) [-996.014] (-997.244) (-996.542) -- 0:00:46
Average standard deviation of split frequencies: 0.014629
255500 -- (-995.797) (-995.766) (-996.842) [-996.349] * (-995.680) (-997.713) (-998.476) [-993.541] -- 0:00:46
256000 -- (-996.055) (-997.352) [-995.121] (-997.062) * (-995.342) [-997.321] (-995.126) (-995.255) -- 0:00:46
256500 -- (-995.557) (-997.582) [-997.504] (-997.742) * (-995.937) (-994.471) [-994.661] (-994.135) -- 0:00:46
257000 -- (-996.396) [-1002.757] (-1001.935) (-1000.658) * [-999.477] (-997.264) (-996.242) (-998.749) -- 0:00:46
257500 -- (-996.293) (-997.658) [-996.000] (-994.932) * [-996.586] (-996.071) (-993.920) (-995.795) -- 0:00:46
258000 -- (-999.654) (-994.216) [-1000.404] (-996.768) * (-994.279) (-993.985) [-998.957] (-994.280) -- 0:00:46
258500 -- (-997.711) (-994.840) [-995.776] (-997.166) * (-993.874) [-995.197] (-997.094) (-994.405) -- 0:00:45
259000 -- (-999.258) (-994.137) [-996.082] (-996.596) * [-996.766] (-996.538) (-995.916) (-995.676) -- 0:00:45
259500 -- [-996.813] (-997.517) (-997.701) (-1003.922) * (-995.902) (-996.054) [-997.167] (-993.888) -- 0:00:45
260000 -- (-995.426) (-995.977) [-996.566] (-995.159) * (-997.778) [-996.304] (-997.167) (-994.484) -- 0:00:45
Average standard deviation of split frequencies: 0.014893
260500 -- (-997.429) (-995.220) [-996.745] (-995.817) * [-996.034] (-996.892) (-997.724) (-995.241) -- 0:00:45
261000 -- (-994.320) [-997.484] (-996.018) (-1000.044) * [-996.072] (-997.631) (-1005.059) (-996.745) -- 0:00:45
261500 -- (-996.721) (-998.196) [-995.942] (-997.261) * (-994.897) [-996.757] (-994.357) (-995.512) -- 0:00:45
262000 -- (-996.284) (-998.152) [-996.143] (-995.476) * [-996.815] (-996.298) (-996.720) (-995.551) -- 0:00:45
262500 -- (-995.813) (-997.064) (-994.867) [-994.529] * (-997.418) [-994.871] (-996.013) (-997.776) -- 0:00:44
263000 -- (-995.062) [-995.506] (-993.845) (-994.760) * (-997.276) (-997.736) [-996.046] (-995.843) -- 0:00:44
263500 -- (-994.843) (-996.671) [-994.482] (-997.998) * (-997.569) [-995.202] (-994.818) (-994.868) -- 0:00:44
264000 -- [-994.587] (-999.327) (-993.839) (-996.866) * (-998.467) (-995.509) [-995.201] (-994.668) -- 0:00:44
264500 -- (-1001.543) (-996.753) (-993.779) [-995.831] * (-996.272) (-995.959) [-993.771] (-997.592) -- 0:00:44
265000 -- (-997.150) (-995.365) [-995.131] (-995.938) * (-995.029) [-995.191] (-995.463) (-997.847) -- 0:00:44
Average standard deviation of split frequencies: 0.014079
265500 -- (-994.996) [-995.329] (-995.484) (-997.691) * (-994.323) [-994.758] (-993.668) (-999.194) -- 0:00:44
266000 -- [-996.683] (-997.198) (-996.135) (-995.270) * (-995.413) (-995.220) [-994.264] (-993.966) -- 0:00:44
266500 -- [-996.017] (-997.610) (-1000.001) (-999.540) * (-999.123) [-996.310] (-996.240) (-994.320) -- 0:00:44
267000 -- (-996.600) [-996.507] (-994.889) (-998.049) * (-999.996) (-997.272) (-996.731) [-994.894] -- 0:00:43
267500 -- [-997.183] (-996.105) (-994.668) (-996.219) * [-996.494] (-998.531) (-995.711) (-1002.146) -- 0:00:43
268000 -- (-996.714) (-995.411) [-994.989] (-997.592) * [-995.812] (-996.407) (-997.096) (-997.845) -- 0:00:43
268500 -- (-994.178) (-994.324) (-994.279) [-996.530] * (-998.773) (-996.364) (-998.897) [-994.019] -- 0:00:43
269000 -- (-995.994) [-998.181] (-994.991) (-995.896) * (-997.864) [-995.632] (-998.396) (-995.451) -- 0:00:43
269500 -- (-996.215) (-994.363) (-994.776) [-996.891] * (-997.558) (-996.899) [-995.502] (-995.255) -- 0:00:46
270000 -- (-996.369) [-993.873] (-996.672) (-999.636) * (-999.097) [-999.080] (-998.813) (-995.352) -- 0:00:45
Average standard deviation of split frequencies: 0.013933
270500 -- [-995.005] (-994.495) (-995.513) (-996.588) * (-995.824) (-995.808) (-997.776) [-994.070] -- 0:00:45
271000 -- (-997.651) (-995.959) [-994.778] (-1000.410) * [-995.897] (-994.132) (-995.021) (-994.274) -- 0:00:45
271500 -- (-995.431) (-994.430) [-994.289] (-999.098) * (-997.126) (-995.109) [-994.086] (-997.460) -- 0:00:45
272000 -- [-995.474] (-995.561) (-995.530) (-999.256) * (-997.728) [-994.306] (-994.391) (-999.318) -- 0:00:45
272500 -- (-996.725) (-996.114) (-995.442) [-997.152] * (-995.471) (-994.319) [-994.418] (-995.126) -- 0:00:45
273000 -- (-996.467) [-995.928] (-995.831) (-995.875) * (-1001.014) (-997.415) (-995.778) [-999.468] -- 0:00:45
273500 -- (-997.830) [-996.338] (-994.150) (-997.641) * (-997.647) (-995.733) [-995.149] (-1000.422) -- 0:00:45
274000 -- (-994.782) (-994.815) [-996.524] (-996.327) * (-995.373) (-995.052) (-995.012) [-995.707] -- 0:00:45
274500 -- (-994.509) (-994.587) [-995.914] (-995.741) * (-998.677) (-998.003) [-995.030] (-994.890) -- 0:00:44
275000 -- [-996.165] (-996.509) (-994.460) (-996.820) * (-995.006) (-996.336) (-996.794) [-996.911] -- 0:00:44
Average standard deviation of split frequencies: 0.014367
275500 -- (-994.952) (-995.244) (-995.027) [-997.813] * (-997.210) [-994.097] (-995.565) (-995.451) -- 0:00:44
276000 -- (-998.320) (-997.352) [-996.730] (-997.433) * [-998.664] (-994.580) (-995.171) (-999.694) -- 0:00:44
276500 -- (-1000.054) [-995.736] (-998.623) (-996.146) * (-996.788) (-994.918) (-998.893) [-995.566] -- 0:00:44
277000 -- (-998.571) (-995.609) [-997.850] (-995.932) * (-993.964) (-997.409) [-995.820] (-994.303) -- 0:00:44
277500 -- (-996.377) [-996.042] (-995.396) (-994.593) * [-994.973] (-996.759) (-997.759) (-995.861) -- 0:00:44
278000 -- (-996.821) (-995.259) [-994.237] (-995.134) * (-997.878) [-996.154] (-998.577) (-997.301) -- 0:00:44
278500 -- [-995.588] (-994.726) (-995.043) (-996.700) * (-999.374) (-996.988) (-994.965) [-994.412] -- 0:00:44
279000 -- (-994.115) (-996.083) [-998.090] (-995.098) * (-999.498) (-997.040) (-995.758) [-995.390] -- 0:00:43
279500 -- (-995.268) (-994.366) [-997.609] (-995.103) * (-1002.343) (-998.484) [-995.835] (-994.991) -- 0:00:43
280000 -- (-998.038) (-994.643) [-997.084] (-994.300) * (-997.505) (-1001.999) [-996.091] (-996.656) -- 0:00:43
Average standard deviation of split frequencies: 0.013332
280500 -- (-999.912) [-994.926] (-995.981) (-998.025) * (-995.236) (-995.137) (-993.792) [-994.271] -- 0:00:43
281000 -- (-999.883) [-994.459] (-995.938) (-997.851) * (-995.158) [-996.260] (-994.578) (-993.962) -- 0:00:43
281500 -- (-996.325) [-995.109] (-995.232) (-993.683) * [-993.964] (-994.489) (-994.815) (-994.767) -- 0:00:43
282000 -- [-994.287] (-997.702) (-996.379) (-995.063) * (-995.866) (-995.366) (-996.133) [-994.021] -- 0:00:43
282500 -- (-994.417) [-994.631] (-999.269) (-995.016) * (-995.642) (-994.937) (-996.318) [-994.103] -- 0:00:43
283000 -- (-995.453) (-994.866) [-996.878] (-994.711) * (-996.248) [-996.337] (-995.586) (-993.781) -- 0:00:43
283500 -- (-995.721) (-995.895) [-994.809] (-994.711) * (-996.133) (-996.180) [-994.892] (-994.202) -- 0:00:42
284000 -- (-994.925) [-995.173] (-995.914) (-994.904) * (-996.141) [-993.817] (-996.878) (-993.778) -- 0:00:42
284500 -- (-994.236) (-995.167) (-995.097) [-996.093] * (-997.583) (-998.248) (-996.549) [-993.858] -- 0:00:42
285000 -- (-994.564) (-994.281) (-994.938) [-998.302] * [-998.499] (-995.125) (-994.354) (-996.785) -- 0:00:42
Average standard deviation of split frequencies: 0.012604
285500 -- (-995.692) [-997.270] (-996.738) (-994.942) * (-995.256) [-995.143] (-996.085) (-999.048) -- 0:00:42
286000 -- (-994.254) [-995.805] (-995.829) (-993.697) * (-994.366) [-994.505] (-996.386) (-995.052) -- 0:00:44
286500 -- [-994.801] (-998.125) (-1001.647) (-993.591) * (-995.196) (-994.032) (-995.608) [-994.474] -- 0:00:44
287000 -- [-995.254] (-995.244) (-995.652) (-995.507) * (-996.230) (-994.558) (-1000.682) [-994.953] -- 0:00:44
287500 -- (-994.520) (-1000.170) (-996.017) [-994.969] * (-995.846) [-994.255] (-997.286) (-994.392) -- 0:00:44
288000 -- (-994.653) (-994.528) [-996.050] (-995.833) * (-998.281) [-994.255] (-998.160) (-995.218) -- 0:00:44
288500 -- (-995.517) [-995.695] (-994.129) (-994.528) * (-993.993) [-994.946] (-995.416) (-994.592) -- 0:00:44
289000 -- [-994.551] (-997.172) (-995.415) (-993.546) * (-997.961) (-997.760) [-997.172] (-998.789) -- 0:00:44
289500 -- [-994.558] (-996.058) (-995.355) (-995.292) * [-994.936] (-998.202) (-995.145) (-995.135) -- 0:00:44
290000 -- (-995.502) (-995.423) (-994.578) [-994.976] * (-994.690) (-996.975) (-994.903) [-995.203] -- 0:00:44
Average standard deviation of split frequencies: 0.011066
290500 -- (-995.686) (-994.749) (-994.066) [-994.849] * (-996.145) (-994.700) [-997.495] (-994.684) -- 0:00:43
291000 -- (-996.344) (-994.849) (-1002.037) [-995.918] * [-994.382] (-994.949) (-997.304) (-996.609) -- 0:00:43
291500 -- (-996.284) (-994.214) (-994.786) [-996.888] * [-997.098] (-996.750) (-997.612) (-996.411) -- 0:00:43
292000 -- (-994.820) (-996.420) [-996.169] (-1001.257) * (-998.372) (-996.388) [-994.457] (-997.624) -- 0:00:43
292500 -- (-995.492) [-994.718] (-997.207) (-998.315) * (-995.215) (-997.874) (-994.743) [-995.245] -- 0:00:43
293000 -- [-995.861] (-998.712) (-997.252) (-995.258) * [-995.515] (-993.995) (-994.378) (-995.636) -- 0:00:43
293500 -- [-998.099] (-997.280) (-997.818) (-993.678) * (-996.085) (-994.024) (-997.400) [-995.609] -- 0:00:43
294000 -- (-996.897) [-993.900] (-997.995) (-996.449) * [-997.395] (-993.864) (-996.511) (-995.472) -- 0:00:43
294500 -- [-996.996] (-994.670) (-994.862) (-996.509) * (-997.290) (-993.801) [-994.673] (-995.883) -- 0:00:43
295000 -- (-998.022) [-995.881] (-994.204) (-998.392) * (-994.328) [-993.879] (-995.512) (-995.076) -- 0:00:43
Average standard deviation of split frequencies: 0.010551
295500 -- [-999.032] (-994.166) (-998.489) (-994.303) * [-994.651] (-995.744) (-996.748) (-999.167) -- 0:00:42
296000 -- [-993.929] (-993.722) (-996.656) (-996.702) * (-995.655) (-995.149) [-998.305] (-997.874) -- 0:00:42
296500 -- (-994.239) (-998.691) (-995.289) [-995.490] * (-994.219) (-996.848) (-995.034) [-1001.573] -- 0:00:42
297000 -- (-994.189) [-994.829] (-997.105) (-995.492) * (-995.320) (-997.352) [-995.591] (-994.893) -- 0:00:42
297500 -- (-997.091) [-993.914] (-999.143) (-994.799) * (-998.591) (-998.543) [-995.639] (-997.799) -- 0:00:42
298000 -- (-997.284) [-993.913] (-998.097) (-996.215) * (-995.322) (-996.638) [-995.199] (-998.759) -- 0:00:42
298500 -- [-994.843] (-999.742) (-995.411) (-996.909) * (-994.950) (-996.983) [-994.810] (-999.447) -- 0:00:42
299000 -- (-996.556) (-994.939) (-1001.524) [-997.238] * (-994.410) (-995.969) [-994.905] (-996.596) -- 0:00:42
299500 -- (-997.314) (-997.009) [-996.591] (-1002.891) * (-997.781) (-996.604) [-994.665] (-1002.485) -- 0:00:42
300000 -- (-996.611) (-996.275) [-994.300] (-999.257) * (-993.478) [-994.812] (-994.975) (-994.931) -- 0:00:42
Average standard deviation of split frequencies: 0.010485
300500 -- [-996.839] (-998.128) (-994.505) (-994.094) * (-999.384) (-994.791) [-995.767] (-994.079) -- 0:00:41
301000 -- (-995.243) [-995.105] (-994.364) (-993.927) * (-997.078) (-994.038) [-999.495] (-994.703) -- 0:00:41
301500 -- (-995.996) [-994.082] (-996.974) (-994.408) * (-1000.188) (-995.048) [-994.577] (-995.868) -- 0:00:41
302000 -- [-995.674] (-994.913) (-997.328) (-994.032) * (-999.608) [-998.629] (-994.808) (-996.157) -- 0:00:41
302500 -- (-995.130) (-994.760) (-996.272) [-996.331] * (-998.110) (-999.605) (-995.524) [-996.176] -- 0:00:41
303000 -- (-995.586) (-995.182) [-995.032] (-995.221) * (-994.885) (-996.792) [-994.701] (-994.841) -- 0:00:43
303500 -- (-995.722) (-996.691) [-996.335] (-1001.531) * (-994.268) [-994.374] (-995.207) (-997.423) -- 0:00:43
304000 -- [-996.803] (-994.169) (-995.207) (-997.855) * (-994.323) (-996.531) [-995.299] (-996.458) -- 0:00:43
304500 -- (-997.303) (-998.151) [-993.857] (-995.163) * (-995.420) (-1000.993) [-996.034] (-996.597) -- 0:00:43
305000 -- (-998.543) [-995.643] (-995.107) (-994.119) * [-995.029] (-999.955) (-996.375) (-995.936) -- 0:00:43
Average standard deviation of split frequencies: 0.010591
305500 -- (-995.747) (-995.875) [-995.419] (-994.100) * [-995.514] (-1000.496) (-996.464) (-995.356) -- 0:00:43
306000 -- (-995.688) [-996.044] (-995.745) (-994.763) * (-995.550) (-993.929) [-997.251] (-996.538) -- 0:00:43
306500 -- (-994.202) (-1002.342) [-995.327] (-995.557) * (-994.719) (-994.603) [-997.058] (-994.934) -- 0:00:42
307000 -- (-995.423) [-998.107] (-997.571) (-997.126) * (-994.982) [-995.983] (-996.938) (-997.698) -- 0:00:42
307500 -- (-1001.476) (-998.244) [-994.828] (-995.205) * [-997.281] (-995.126) (-998.103) (-996.036) -- 0:00:42
308000 -- (-997.878) (-995.953) (-996.459) [-998.252] * (-995.575) (-993.678) (-998.065) [-995.262] -- 0:00:42
308500 -- (-994.799) (-995.615) (-994.806) [-996.510] * (-995.408) [-995.660] (-997.689) (-993.579) -- 0:00:42
309000 -- (-995.871) (-995.215) (-999.147) [-996.529] * [-994.359] (-997.673) (-997.065) (-993.809) -- 0:00:42
309500 -- (-995.244) (-996.578) [-1001.088] (-994.953) * (-996.394) (-995.927) (-997.224) [-995.105] -- 0:00:42
310000 -- [-994.540] (-996.418) (-995.951) (-995.893) * (-995.620) (-996.004) (-998.963) [-995.248] -- 0:00:42
Average standard deviation of split frequencies: 0.010354
310500 -- (-997.093) [-996.741] (-996.028) (-994.000) * (-994.750) [-996.085] (-995.249) (-994.985) -- 0:00:42
311000 -- (-996.290) [-995.277] (-996.793) (-995.500) * (-996.546) [-998.450] (-994.536) (-994.770) -- 0:00:42
311500 -- (-995.474) (-996.258) [-996.799] (-996.221) * (-994.653) (-997.232) [-995.623] (-995.000) -- 0:00:41
312000 -- (-995.963) (-1000.766) [-996.329] (-994.502) * (-994.192) [-993.818] (-997.515) (-994.959) -- 0:00:41
312500 -- (-995.469) (-995.706) [-994.970] (-998.223) * (-993.926) (-993.767) (-994.633) [-997.046] -- 0:00:41
313000 -- (-995.111) (-1000.125) (-995.691) [-994.609] * (-994.309) [-995.072] (-993.642) (-1000.595) -- 0:00:41
313500 -- (-994.500) [-1000.616] (-995.883) (-995.923) * (-999.275) (-995.239) [-993.613] (-999.044) -- 0:00:41
314000 -- [-994.897] (-995.209) (-997.475) (-995.886) * [-996.097] (-995.045) (-996.250) (-995.378) -- 0:00:41
314500 -- [-994.298] (-999.539) (-997.249) (-999.116) * (-995.722) (-996.391) (-995.935) [-997.688] -- 0:00:41
315000 -- [-995.340] (-1000.458) (-994.638) (-995.264) * (-994.915) (-996.046) [-998.718] (-998.893) -- 0:00:41
Average standard deviation of split frequencies: 0.010706
315500 -- (-994.606) [-998.548] (-994.722) (-994.065) * (-996.205) [-995.803] (-997.229) (-997.207) -- 0:00:41
316000 -- (-995.517) (-997.054) [-994.950] (-994.961) * (-994.358) (-997.365) [-994.893] (-996.215) -- 0:00:41
316500 -- [-993.616] (-997.623) (-998.325) (-995.644) * (-995.519) (-995.772) [-995.647] (-996.504) -- 0:00:41
317000 -- [-994.216] (-995.332) (-994.326) (-999.100) * [-993.756] (-996.115) (-996.367) (-995.341) -- 0:00:40
317500 -- (-995.962) (-996.313) (-994.746) [-996.076] * [-995.074] (-997.126) (-994.760) (-995.548) -- 0:00:40
318000 -- (-996.288) (-999.762) [-993.990] (-995.877) * (-997.869) (-996.755) [-994.027] (-993.864) -- 0:00:40
318500 -- (-996.157) (-999.407) [-994.612] (-996.399) * (-994.645) [-997.401] (-994.414) (-1000.240) -- 0:00:40
319000 -- (-995.476) [-999.455] (-996.863) (-994.231) * (-994.364) (-993.556) [-995.540] (-997.866) -- 0:00:40
319500 -- (-994.797) [-994.728] (-993.881) (-994.511) * (-993.782) (-993.897) [-1000.928] (-996.155) -- 0:00:42
320000 -- (-995.296) [-995.166] (-995.375) (-995.654) * (-995.345) [-995.418] (-996.305) (-996.309) -- 0:00:42
Average standard deviation of split frequencies: 0.010658
320500 -- (-996.708) (-994.727) [-993.847] (-996.407) * (-997.598) [-995.364] (-996.684) (-997.294) -- 0:00:42
321000 -- (-997.940) (-995.658) [-994.151] (-996.572) * (-997.440) (-996.492) (-995.891) [-998.388] -- 0:00:42
321500 -- [-995.756] (-1000.212) (-995.559) (-997.308) * (-998.467) [-995.115] (-997.247) (-995.040) -- 0:00:42
322000 -- (-995.857) [-996.638] (-994.517) (-996.384) * [-995.512] (-996.788) (-995.875) (-997.917) -- 0:00:42
322500 -- (-994.836) (-995.803) [-993.976] (-995.817) * (-995.031) (-1002.124) [-994.764] (-997.379) -- 0:00:42
323000 -- (-996.728) (-995.531) [-996.519] (-997.694) * [-998.951] (-995.729) (-994.690) (-993.870) -- 0:00:41
323500 -- (-995.506) (-996.759) (-995.206) [-997.957] * [-996.275] (-994.120) (-995.151) (-996.588) -- 0:00:41
324000 -- [-997.513] (-995.939) (-997.855) (-995.790) * (-994.792) (-994.376) (-1000.484) [-994.900] -- 0:00:41
324500 -- [-997.275] (-994.003) (-995.341) (-995.833) * (-994.404) (-995.413) (-994.510) [-994.537] -- 0:00:41
325000 -- (-996.536) (-994.478) [-996.109] (-995.186) * (-995.571) (-996.998) (-994.503) [-995.484] -- 0:00:41
Average standard deviation of split frequencies: 0.010845
325500 -- (-994.593) (-997.343) [-994.643] (-996.594) * (-995.971) (-995.401) (-994.394) [-999.008] -- 0:00:41
326000 -- (-997.538) [-1000.446] (-994.567) (-996.196) * (-996.917) [-996.983] (-997.558) (-999.125) -- 0:00:41
326500 -- (-997.289) [-994.800] (-993.906) (-995.937) * [-998.573] (-996.050) (-995.738) (-994.391) -- 0:00:41
327000 -- [-994.659] (-997.151) (-995.622) (-998.499) * (-997.262) (-996.178) (-995.811) [-995.193] -- 0:00:41
327500 -- (-995.081) (-996.017) [-996.326] (-996.522) * (-997.733) (-995.655) [-994.686] (-998.194) -- 0:00:41
328000 -- (-994.160) (-994.975) (-996.195) [-997.591] * [-995.217] (-998.906) (-996.309) (-995.012) -- 0:00:40
328500 -- (-993.694) (-998.876) [-996.066] (-1001.773) * [-995.250] (-996.309) (-998.424) (-995.012) -- 0:00:40
329000 -- [-995.220] (-997.212) (-995.443) (-996.706) * (-998.771) [-993.887] (-996.424) (-995.588) -- 0:00:40
329500 -- (-996.744) [-996.814] (-995.287) (-995.651) * [-997.119] (-994.546) (-996.656) (-999.470) -- 0:00:40
330000 -- (-996.517) [-994.410] (-996.872) (-994.602) * [-997.733] (-994.428) (-996.385) (-996.877) -- 0:00:40
Average standard deviation of split frequencies: 0.009979
330500 -- (-997.575) [-995.963] (-998.043) (-995.239) * (-994.687) (-1000.253) [-997.341] (-998.681) -- 0:00:40
331000 -- (-999.884) (-995.732) [-1001.383] (-995.868) * [-994.500] (-999.771) (-996.979) (-1002.359) -- 0:00:40
331500 -- (-998.721) (-996.802) (-994.241) [-994.425] * (-994.396) (-1000.323) [-996.989] (-996.742) -- 0:00:40
332000 -- (-999.788) (-996.248) [-995.393] (-994.824) * [-996.486] (-995.129) (-994.997) (-996.711) -- 0:00:40
332500 -- [-995.155] (-996.560) (-997.617) (-995.050) * (-997.323) (-999.028) (-995.683) [-996.688] -- 0:00:40
333000 -- (-995.612) [-994.879] (-999.465) (-995.938) * (-995.782) (-996.425) [-995.852] (-998.843) -- 0:00:40
333500 -- (-995.647) [-1000.159] (-999.377) (-996.853) * (-995.550) [-997.841] (-995.480) (-996.537) -- 0:00:39
334000 -- (-994.420) (-994.535) [-995.879] (-995.931) * (-994.600) (-997.567) [-994.622] (-997.451) -- 0:00:39
334500 -- [-995.941] (-996.472) (-993.955) (-996.980) * (-994.374) (-995.788) [-996.381] (-996.954) -- 0:00:39
335000 -- (-997.626) (-996.849) [-993.956] (-996.125) * (-995.754) (-997.884) (-995.863) [-996.716] -- 0:00:39
Average standard deviation of split frequencies: 0.009447
335500 -- (-1004.946) (-996.709) [-994.066] (-994.090) * [-996.400] (-996.632) (-995.824) (-997.608) -- 0:00:41
336000 -- (-996.914) [-995.278] (-995.408) (-993.784) * (-995.156) (-995.851) [-996.917] (-997.608) -- 0:00:41
336500 -- (-996.525) (-993.512) (-995.679) [-995.035] * (-999.612) (-994.756) (-995.253) [-996.387] -- 0:00:41
337000 -- [-994.226] (-995.243) (-994.567) (-998.461) * (-993.913) (-995.485) [-996.639] (-1002.450) -- 0:00:41
337500 -- [-996.932] (-998.601) (-994.834) (-995.981) * (-993.945) [-995.004] (-1000.465) (-999.957) -- 0:00:41
338000 -- (-994.467) (-998.469) (-998.186) [-996.805] * (-994.257) (-994.905) [-998.737] (-1001.200) -- 0:00:41
338500 -- (-994.436) [-995.993] (-997.323) (-996.162) * (-994.655) [-994.685] (-995.693) (-996.239) -- 0:00:41
339000 -- (-997.265) (-997.761) [-998.153] (-995.044) * [-994.326] (-995.828) (-996.884) (-995.385) -- 0:00:40
339500 -- (-995.405) (-993.929) [-995.367] (-997.300) * (-994.936) [-994.746] (-994.692) (-998.061) -- 0:00:40
340000 -- (-996.025) (-995.277) [-996.440] (-998.330) * (-993.633) (-995.196) (-996.753) [-995.677] -- 0:00:40
Average standard deviation of split frequencies: 0.007841
340500 -- (-995.240) [-994.427] (-996.029) (-996.807) * (-993.649) [-995.698] (-999.019) (-1000.391) -- 0:00:40
341000 -- (-995.762) [-995.567] (-998.001) (-997.910) * (-995.464) (-998.238) [-996.935] (-998.006) -- 0:00:40
341500 -- (-1002.279) (-996.398) [-996.576] (-996.201) * (-997.519) (-999.464) (-994.553) [-993.984] -- 0:00:40
342000 -- [-995.376] (-997.727) (-997.519) (-996.994) * (-995.450) (-997.587) (-998.678) [-993.901] -- 0:00:40
342500 -- (-995.786) (-1000.292) (-993.770) [-995.683] * (-995.715) (-994.856) [-995.147] (-994.216) -- 0:00:40
343000 -- (-995.175) (-994.853) [-993.948] (-997.839) * (-998.007) (-995.334) (-994.586) [-996.188] -- 0:00:40
343500 -- (-996.351) (-994.404) [-995.135] (-995.181) * (-996.889) [-995.357] (-996.165) (-998.234) -- 0:00:40
344000 -- (-999.939) (-996.628) [-995.374] (-997.568) * (-997.750) [-994.248] (-1002.674) (-996.006) -- 0:00:40
344500 -- [-994.679] (-993.853) (-993.809) (-998.380) * (-995.648) [-995.306] (-1000.271) (-996.609) -- 0:00:39
345000 -- (-995.350) (-993.945) [-994.678] (-997.234) * [-996.015] (-994.904) (-1004.722) (-995.258) -- 0:00:39
Average standard deviation of split frequencies: 0.008686
345500 -- (-994.755) (-994.008) (-995.329) [-996.191] * (-998.186) (-994.721) [-996.424] (-995.258) -- 0:00:39
346000 -- (-996.739) (-995.019) [-995.013] (-995.689) * (-998.117) (-994.081) [-999.212] (-1000.020) -- 0:00:39
346500 -- (-997.614) (-996.589) [-994.788] (-996.018) * [-998.290] (-993.658) (-1001.414) (-995.444) -- 0:00:39
347000 -- [-994.506] (-994.983) (-993.963) (-995.797) * [-993.885] (-993.582) (-997.115) (-995.612) -- 0:00:39
347500 -- (-997.824) (-995.833) (-996.024) [-996.835] * [-996.167] (-995.048) (-994.626) (-995.654) -- 0:00:39
348000 -- (-1000.654) (-995.759) [-995.539] (-996.277) * [-995.970] (-994.853) (-996.853) (-998.784) -- 0:00:39
348500 -- (-1001.996) [-996.554] (-997.341) (-995.096) * (-995.818) (-997.139) (-994.901) [-995.114] -- 0:00:39
349000 -- (-996.500) [-995.335] (-997.452) (-994.169) * (-996.308) [-995.628] (-995.746) (-995.134) -- 0:00:39
349500 -- (-1000.029) (-996.955) [-997.734] (-995.429) * (-997.022) (-995.831) [-996.438] (-996.609) -- 0:00:39
350000 -- (-994.215) (-997.052) (-996.726) [-1001.286] * [-997.014] (-996.020) (-995.119) (-995.324) -- 0:00:39
Average standard deviation of split frequencies: 0.007707
350500 -- [-995.194] (-997.020) (-997.589) (-997.980) * (-996.556) (-995.398) [-995.106] (-994.761) -- 0:00:38
351000 -- (-996.965) [-996.396] (-998.305) (-996.088) * (-995.317) (-997.750) (-994.572) [-994.741] -- 0:00:38
351500 -- [-995.271] (-994.701) (-997.520) (-997.429) * [-997.355] (-996.438) (-996.432) (-994.457) -- 0:00:38
352000 -- (-995.572) (-998.664) (-996.480) [-994.113] * (-1000.981) (-997.756) (-997.425) [-997.010] -- 0:00:40
352500 -- (-1000.409) (-993.634) [-996.480] (-995.550) * (-994.465) (-995.321) [-994.080] (-994.278) -- 0:00:40
353000 -- [-995.362] (-993.712) (-999.077) (-995.054) * (-994.625) (-996.352) [-994.758] (-995.692) -- 0:00:40
353500 -- [-996.210] (-998.410) (-997.341) (-994.503) * (-997.381) (-999.102) (-996.192) [-996.539] -- 0:00:40
354000 -- [-997.135] (-994.504) (-994.272) (-995.056) * (-997.680) (-995.076) (-995.254) [-996.927] -- 0:00:40
354500 -- (-995.626) (-997.334) [-993.984] (-997.380) * (-996.833) (-995.712) (-994.701) [-996.350] -- 0:00:40
355000 -- (-994.017) [-995.258] (-998.331) (-998.558) * (-995.577) (-994.058) (-995.842) [-996.100] -- 0:00:39
Average standard deviation of split frequencies: 0.009021
355500 -- [-994.396] (-996.285) (-999.527) (-998.279) * [-995.477] (-996.317) (-997.474) (-997.591) -- 0:00:39
356000 -- [-994.431] (-994.713) (-997.262) (-995.527) * [-1000.414] (-995.656) (-994.265) (-995.373) -- 0:00:39
356500 -- [-995.135] (-994.994) (-996.718) (-997.363) * [-995.517] (-996.680) (-994.345) (-995.001) -- 0:00:39
357000 -- (-994.751) [-994.013] (-1001.231) (-997.323) * (-1000.861) [-996.439] (-996.541) (-996.017) -- 0:00:39
357500 -- (-996.537) (-995.256) [-995.660] (-997.281) * (-993.844) (-994.043) [-995.962] (-995.182) -- 0:00:39
358000 -- (-998.589) (-994.029) (-997.469) [-994.678] * (-994.578) (-996.554) (-993.867) [-998.570] -- 0:00:39
358500 -- (-997.304) (-994.671) (-997.559) [-994.982] * (-996.673) (-994.440) (-994.355) [-999.245] -- 0:00:39
359000 -- (-997.527) (-997.552) [-1000.356] (-993.853) * (-995.125) (-994.381) (-995.323) [-997.604] -- 0:00:39
359500 -- (-999.876) [-994.598] (-994.877) (-996.261) * (-995.862) [-994.384] (-996.812) (-997.670) -- 0:00:39
360000 -- (-998.550) (-994.897) [-994.998] (-996.012) * (-994.324) (-997.839) (-994.883) [-994.895] -- 0:00:39
Average standard deviation of split frequencies: 0.009411
360500 -- (-996.919) (-996.332) (-996.155) [-997.429] * [-994.324] (-996.799) (-994.071) (-1001.818) -- 0:00:39
361000 -- (-996.697) [-994.841] (-996.291) (-997.029) * (-994.886) [-997.746] (-997.525) (-994.264) -- 0:00:38
361500 -- (-995.877) (-994.375) [-994.617] (-995.641) * (-994.554) (-995.460) [-996.665] (-996.727) -- 0:00:38
362000 -- (-998.457) [-1000.981] (-995.074) (-998.858) * (-994.941) (-999.705) [-995.686] (-996.550) -- 0:00:38
362500 -- (-997.548) [-993.936] (-996.676) (-1000.902) * [-1000.991] (-1006.192) (-996.051) (-996.498) -- 0:00:38
363000 -- (-996.406) [-993.520] (-998.385) (-997.126) * [-995.854] (-994.474) (-999.485) (-996.928) -- 0:00:38
363500 -- (-996.160) [-994.978] (-998.246) (-996.186) * [-997.444] (-995.427) (-997.792) (-996.855) -- 0:00:38
364000 -- (-1000.222) [-995.295] (-994.034) (-994.964) * [-994.425] (-995.506) (-997.235) (-995.136) -- 0:00:38
364500 -- (-994.842) (-994.938) (-994.914) [-996.450] * (-999.094) [-997.405] (-997.272) (-996.620) -- 0:00:38
365000 -- (-998.516) (-995.256) [-999.734] (-998.813) * [-996.212] (-993.600) (-998.354) (-996.162) -- 0:00:38
Average standard deviation of split frequencies: 0.010223
365500 -- (-995.012) [-998.332] (-995.879) (-998.314) * (-995.900) [-995.338] (-998.485) (-994.076) -- 0:00:38
366000 -- (-994.127) (-998.612) (-995.036) [-995.731] * (-994.437) (-997.768) [-996.644] (-994.357) -- 0:00:38
366500 -- (-1000.704) (-996.491) [-996.387] (-995.004) * (-993.591) (-995.803) [-996.201] (-994.977) -- 0:00:38
367000 -- (-998.270) (-1004.204) (-994.444) [-994.516] * (-993.697) (-997.990) [-997.995] (-994.415) -- 0:00:37
367500 -- (-994.922) (-995.529) (-997.681) [-994.795] * [-993.503] (-996.560) (-994.735) (-996.951) -- 0:00:37
368000 -- (-994.619) (-994.711) [-994.569] (-997.680) * (-993.746) (-995.600) (-995.546) [-995.201] -- 0:00:37
368500 -- (-995.935) [-995.882] (-997.260) (-994.317) * [-995.451] (-995.433) (-995.281) (-995.298) -- 0:00:39
369000 -- (-997.772) (-994.823) [-994.608] (-1002.289) * (-997.195) (-997.278) (-997.046) [-998.855] -- 0:00:39
369500 -- (-995.344) (-996.366) (-995.802) [-997.380] * (-994.800) (-995.063) (-994.684) [-996.582] -- 0:00:39
370000 -- [-996.059] (-996.868) (-996.086) (-1003.855) * (-994.812) [-997.084] (-994.082) (-1002.154) -- 0:00:39
Average standard deviation of split frequencies: 0.010810
370500 -- (-994.985) (-995.472) (-994.881) [-995.329] * (-995.889) (-998.807) [-997.112] (-999.637) -- 0:00:39
371000 -- (-995.645) [-995.630] (-994.961) (-996.689) * [-999.621] (-995.387) (-995.857) (-995.650) -- 0:00:38
371500 -- (-994.190) (-995.152) [-993.815] (-998.606) * (-995.184) (-994.186) (-995.099) [-994.584] -- 0:00:38
372000 -- [-996.322] (-1001.138) (-994.796) (-993.949) * (-1001.837) (-996.855) [-995.590] (-994.246) -- 0:00:38
372500 -- (-995.469) [-995.467] (-996.186) (-998.117) * [-994.440] (-994.145) (-994.767) (-995.618) -- 0:00:38
373000 -- [-994.388] (-993.926) (-994.217) (-996.720) * (-996.435) [-995.218] (-994.766) (-995.612) -- 0:00:38
373500 -- (-999.600) (-994.514) [-994.348] (-994.638) * (-995.757) [-994.724] (-994.518) (-1000.829) -- 0:00:38
374000 -- (-996.720) (-994.871) [-995.560] (-996.181) * (-1002.213) (-995.193) [-996.237] (-996.560) -- 0:00:38
374500 -- [-994.671] (-998.969) (-998.058) (-997.593) * [-997.489] (-996.568) (-995.586) (-996.353) -- 0:00:38
375000 -- (-1002.521) (-999.630) [-996.185] (-996.571) * [-994.371] (-995.290) (-997.027) (-998.096) -- 0:00:38
Average standard deviation of split frequencies: 0.011597
375500 -- [-996.723] (-996.323) (-996.684) (-996.577) * (-994.362) [-999.477] (-997.267) (-996.033) -- 0:00:38
376000 -- [-997.237] (-998.295) (-996.326) (-998.368) * (-994.256) (-998.568) (-996.806) [-993.625] -- 0:00:38
376500 -- (-998.800) [-998.032] (-995.131) (-994.016) * (-995.579) [-997.371] (-994.360) (-993.458) -- 0:00:38
377000 -- (-997.207) (-998.101) [-995.915] (-995.165) * (-994.854) [-994.327] (-994.607) (-993.910) -- 0:00:38
377500 -- [-997.854] (-998.613) (-995.965) (-993.642) * (-994.126) (-994.332) (-994.253) [-994.345] -- 0:00:37
378000 -- [-996.832] (-997.138) (-997.283) (-993.642) * (-995.566) (-994.001) (-994.682) [-993.396] -- 0:00:37
378500 -- (-996.618) (-995.300) (-996.318) [-994.417] * (-995.109) [-993.695] (-995.173) (-994.925) -- 0:00:37
379000 -- (-996.594) (-996.721) (-996.095) [-997.170] * (-995.089) (-993.709) [-994.236] (-994.619) -- 0:00:37
379500 -- (-996.539) (-995.297) [-994.911] (-996.946) * (-996.292) (-996.109) [-995.481] (-997.887) -- 0:00:37
380000 -- (-996.287) [-994.442] (-998.477) (-995.862) * (-996.578) (-994.895) [-994.723] (-997.220) -- 0:00:37
Average standard deviation of split frequencies: 0.011228
380500 -- (-1000.197) [-994.799] (-997.635) (-995.466) * (-995.886) (-997.749) (-996.151) [-997.019] -- 0:00:37
381000 -- (-995.930) (-996.990) (-996.542) [-994.128] * (-995.520) (-996.091) (-995.079) [-994.854] -- 0:00:37
381500 -- (-995.303) (-998.097) (-999.103) [-994.392] * (-993.836) (-994.403) [-995.452] (-993.987) -- 0:00:37
382000 -- (-998.021) (-994.629) (-995.783) [-995.214] * (-994.223) (-998.318) (-998.135) [-994.582] -- 0:00:37
382500 -- (-994.088) (-994.291) (-995.565) [-995.115] * (-995.577) (-994.984) (-999.032) [-995.047] -- 0:00:37
383000 -- [-995.416] (-997.939) (-997.049) (-996.646) * [-994.428] (-994.900) (-998.911) (-996.128) -- 0:00:37
383500 -- (-995.146) (-999.247) (-1000.280) [-998.608] * (-994.979) [-995.638] (-996.021) (-996.636) -- 0:00:36
384000 -- (-994.527) (-997.666) (-1000.755) [-995.849] * (-994.798) (-996.383) [-999.281] (-995.946) -- 0:00:36
384500 -- (-995.968) (-995.574) [-997.065] (-994.142) * (-994.070) (-996.219) [-1000.228] (-997.021) -- 0:00:36
385000 -- [-994.289] (-998.447) (-998.042) (-994.499) * (-996.523) (-995.695) (-997.655) [-998.345] -- 0:00:36
Average standard deviation of split frequencies: 0.011373
385500 -- (-994.390) (-995.248) [-995.852] (-994.561) * (-995.947) [-993.772] (-994.106) (-997.422) -- 0:00:38
386000 -- (-994.019) [-996.780] (-1002.986) (-995.280) * (-996.008) (-997.295) [-1000.060] (-994.734) -- 0:00:38
386500 -- (-994.511) [-997.103] (-994.384) (-996.878) * (-996.864) [-1001.218] (-997.129) (-996.617) -- 0:00:38
387000 -- (-995.235) [-994.362] (-997.783) (-999.133) * (-994.389) (-1000.559) [-994.075] (-996.141) -- 0:00:38
387500 -- (-994.934) (-994.753) (-1000.015) [-998.085] * (-996.899) (-994.675) [-995.252] (-999.441) -- 0:00:37
388000 -- (-995.342) [-995.204] (-995.516) (-998.577) * [-999.973] (-993.903) (-995.298) (-999.002) -- 0:00:37
388500 -- [-994.852] (-997.576) (-996.364) (-995.659) * [-994.365] (-995.018) (-995.119) (-994.432) -- 0:00:37
389000 -- (-996.281) (-996.340) (-995.716) [-994.784] * (-994.550) (-996.202) (-997.069) [-994.084] -- 0:00:37
389500 -- (-994.665) (-995.613) (-995.720) [-993.907] * (-995.734) [-998.495] (-995.093) (-993.761) -- 0:00:37
390000 -- (-995.906) [-995.070] (-995.549) (-999.415) * [-996.076] (-996.857) (-1004.330) (-993.911) -- 0:00:37
Average standard deviation of split frequencies: 0.010377
390500 -- (-995.712) [-994.409] (-999.256) (-1000.625) * (-997.693) (-996.807) (-1004.088) [-994.220] -- 0:00:37
391000 -- (-996.474) [-994.714] (-997.316) (-996.743) * [-995.073] (-996.129) (-994.202) (-995.571) -- 0:00:37
391500 -- (-996.335) (-997.651) (-995.024) [-994.435] * (-999.081) [-995.366] (-994.172) (-997.405) -- 0:00:37
392000 -- (-996.501) [-995.320] (-997.308) (-999.947) * (-1001.135) (-995.820) (-994.643) [-998.170] -- 0:00:37
392500 -- (-997.996) (-995.375) (-994.530) [-998.652] * (-998.381) (-996.104) [-996.005] (-997.606) -- 0:00:37
393000 -- (-994.586) (-996.131) [-995.960] (-999.061) * (-997.021) (-994.817) (-994.838) [-995.753] -- 0:00:37
393500 -- (-994.304) (-994.712) [-996.841] (-998.152) * (-995.370) (-994.574) [-993.945] (-996.930) -- 0:00:36
394000 -- (-996.000) (-994.494) [-998.417] (-999.992) * [-994.807] (-994.099) (-994.543) (-997.113) -- 0:00:36
394500 -- (-995.018) (-994.956) (-995.900) [-996.726] * (-998.631) (-996.081) [-997.591] (-996.210) -- 0:00:36
395000 -- (-993.914) [-1000.828] (-997.739) (-995.334) * [-993.802] (-996.352) (-994.450) (-994.702) -- 0:00:36
Average standard deviation of split frequencies: 0.009841
395500 -- (-995.944) (-995.199) [-997.862] (-996.173) * (-994.158) (-994.903) [-995.747] (-995.226) -- 0:00:36
396000 -- (-1000.319) (-995.819) (-997.699) [-994.372] * [-994.718] (-997.927) (-995.449) (-1001.045) -- 0:00:36
396500 -- [-995.625] (-996.119) (-996.965) (-995.452) * [-997.704] (-996.928) (-996.246) (-997.508) -- 0:00:36
397000 -- (-996.999) (-994.280) (-995.901) [-997.057] * (-996.489) [-996.115] (-996.031) (-995.376) -- 0:00:36
397500 -- (-996.523) [-995.208] (-995.701) (-996.979) * (-995.629) [-995.809] (-998.549) (-997.347) -- 0:00:36
398000 -- (-998.309) (-997.173) [-997.510] (-997.069) * (-996.463) (-996.825) [-997.583] (-996.783) -- 0:00:36
398500 -- (-998.412) [-996.407] (-994.513) (-998.713) * (-995.182) [-994.694] (-996.206) (-999.050) -- 0:00:36
399000 -- (-997.771) (-997.198) [-995.377] (-999.534) * (-994.883) (-998.774) (-996.396) [-1000.389] -- 0:00:36
399500 -- (-995.980) (-994.006) (-994.264) [-995.640] * [-994.665] (-996.173) (-998.336) (-995.315) -- 0:00:36
400000 -- (-995.878) (-994.409) (-1003.524) [-993.937] * [-996.115] (-997.978) (-998.400) (-1000.601) -- 0:00:36
Average standard deviation of split frequencies: 0.009099
400500 -- (-995.211) [-995.804] (-997.457) (-994.002) * (-996.674) [-995.259] (-996.520) (-998.365) -- 0:00:35
401000 -- (-995.971) [-995.903] (-996.763) (-997.303) * (-996.123) (-995.737) [-995.919] (-1001.847) -- 0:00:35
401500 -- (-995.423) [-996.201] (-995.620) (-996.798) * (-995.623) (-996.175) (-994.994) [-994.605] -- 0:00:37
402000 -- (-999.145) (-997.347) [-994.867] (-994.748) * (-995.737) [-997.370] (-994.956) (-996.923) -- 0:00:37
402500 -- (-997.854) (-994.963) [-994.310] (-996.778) * [-994.194] (-996.784) (-996.035) (-995.989) -- 0:00:37
403000 -- [-994.435] (-993.539) (-996.866) (-995.450) * (-997.189) [-994.641] (-996.828) (-997.729) -- 0:00:37
403500 -- (-997.189) (-993.512) [-996.175] (-994.741) * (-994.606) (-996.462) (-997.143) [-997.465] -- 0:00:36
404000 -- (-996.712) (-993.529) [-995.289] (-995.386) * (-994.884) (-995.912) [-999.795] (-995.013) -- 0:00:36
404500 -- (-996.968) (-995.911) [-993.979] (-996.978) * (-997.833) [-997.844] (-996.840) (-995.176) -- 0:00:36
405000 -- (-1001.093) [-997.117] (-995.863) (-996.742) * [-996.180] (-1001.016) (-995.271) (-995.895) -- 0:00:36
Average standard deviation of split frequencies: 0.008902
405500 -- (-997.887) (-994.001) (-997.700) [-996.610] * (-995.739) (-999.658) (-995.070) [-994.669] -- 0:00:36
406000 -- (-999.095) (-996.343) (-997.493) [-993.757] * (-998.043) (-995.597) (-996.654) [-995.939] -- 0:00:36
406500 -- (-996.368) (-994.439) (-995.863) [-995.531] * [-996.211] (-999.916) (-1000.006) (-998.133) -- 0:00:36
407000 -- (-995.159) (-998.592) (-996.114) [-997.268] * (-999.167) [-995.187] (-996.428) (-997.455) -- 0:00:36
407500 -- (-995.952) [-994.283] (-1001.326) (-997.005) * (-995.568) [-994.968] (-999.222) (-998.284) -- 0:00:36
408000 -- (-994.037) (-994.011) [-998.937] (-1000.625) * (-995.495) (-993.770) (-998.952) [-994.719] -- 0:00:36
408500 -- (-996.421) (-997.306) [-994.608] (-998.029) * (-997.087) (-994.852) [-994.476] (-994.742) -- 0:00:36
409000 -- (-996.870) (-994.922) (-995.414) [-996.613] * (-994.895) [-994.862] (-995.857) (-994.800) -- 0:00:36
409500 -- (-996.328) (-995.189) (-999.636) [-995.818] * (-996.123) (-995.850) [-994.741] (-994.121) -- 0:00:36
410000 -- [-1001.192] (-995.236) (-997.786) (-994.406) * (-994.494) (-999.569) (-995.762) [-997.826] -- 0:00:35
Average standard deviation of split frequencies: 0.009829
410500 -- (-996.136) [-999.944] (-996.735) (-998.076) * (-995.944) (-996.905) [-995.396] (-994.464) -- 0:00:35
411000 -- (-994.457) (-995.753) (-994.533) [-997.040] * (-995.792) (-994.814) [-997.196] (-996.902) -- 0:00:35
411500 -- [-994.925] (-998.520) (-995.689) (-995.839) * (-994.933) (-996.217) [-996.530] (-995.545) -- 0:00:35
412000 -- (-994.307) [-1001.341] (-993.926) (-995.422) * [-995.116] (-996.714) (-995.661) (-1003.451) -- 0:00:35
412500 -- (-994.984) (-998.558) (-994.949) [-995.408] * [-995.571] (-996.669) (-997.426) (-1001.630) -- 0:00:35
413000 -- [-996.634] (-994.166) (-1001.208) (-994.647) * (-998.372) (-995.190) (-994.974) [-998.578] -- 0:00:35
413500 -- (-998.500) (-994.881) [-993.995] (-994.605) * (-995.667) (-996.625) [-994.465] (-998.532) -- 0:00:35
414000 -- (-996.011) (-997.654) [-994.376] (-998.352) * [-997.664] (-996.631) (-994.590) (-995.956) -- 0:00:35
414500 -- [-996.788] (-994.306) (-998.574) (-998.139) * [-996.965] (-995.588) (-996.512) (-997.920) -- 0:00:35
415000 -- [-994.641] (-998.629) (-994.009) (-999.571) * [-998.090] (-996.584) (-995.023) (-995.919) -- 0:00:35
Average standard deviation of split frequencies: 0.009292
415500 -- [-996.166] (-996.864) (-995.558) (-994.476) * [-996.558] (-993.938) (-995.900) (-995.192) -- 0:00:35
416000 -- (-996.893) (-996.197) (-997.110) [-996.763] * (-997.021) (-997.071) (-1000.860) [-996.260] -- 0:00:35
416500 -- (-996.326) (-995.451) (-994.791) [-996.810] * (-996.830) (-996.748) [-998.458] (-1002.540) -- 0:00:35
417000 -- (-995.354) (-996.206) (-994.165) [-995.344] * (-994.058) (-995.767) (-995.385) [-995.337] -- 0:00:34
417500 -- (-994.185) [-996.305] (-993.950) (-995.816) * [-994.953] (-994.704) (-995.850) (-997.302) -- 0:00:34
418000 -- (-994.298) (-998.504) [-994.594] (-995.735) * (-1000.144) [-993.878] (-997.373) (-994.155) -- 0:00:36
418500 -- (-995.474) [-996.242] (-995.209) (-995.045) * (-993.798) [-994.202] (-1000.227) (-998.621) -- 0:00:36
419000 -- (-995.914) (-1000.268) [-996.365] (-995.772) * (-994.041) (-996.585) [-995.928] (-1001.657) -- 0:00:36
419500 -- [-993.783] (-994.824) (-995.495) (-994.739) * (-995.916) [-994.009] (-996.377) (-998.117) -- 0:00:35
420000 -- [-994.890] (-994.662) (-995.243) (-997.824) * (-995.545) (-994.604) [-998.288] (-995.949) -- 0:00:35
Average standard deviation of split frequencies: 0.009563
420500 -- [-995.034] (-995.945) (-995.275) (-996.943) * [-998.592] (-994.602) (-995.924) (-996.523) -- 0:00:35
421000 -- (-994.404) [-995.759] (-994.485) (-997.055) * [-996.735] (-998.877) (-995.183) (-996.082) -- 0:00:35
421500 -- [-994.064] (-996.888) (-996.800) (-994.711) * [-995.310] (-996.546) (-995.028) (-995.562) -- 0:00:35
422000 -- (-994.569) [-994.174] (-994.876) (-995.531) * (-997.781) (-995.550) [-995.561] (-997.356) -- 0:00:35
422500 -- [-997.041] (-995.488) (-996.729) (-996.173) * (-997.159) (-994.731) [-995.508] (-994.398) -- 0:00:35
423000 -- (-996.200) [-996.544] (-993.805) (-994.991) * (-994.886) (-996.233) [-994.156] (-998.973) -- 0:00:35
423500 -- (-995.209) [-994.358] (-994.349) (-995.515) * (-994.846) (-994.868) (-994.817) [-999.286] -- 0:00:35
424000 -- [-997.868] (-994.142) (-996.448) (-995.439) * (-994.904) (-994.990) (-1000.145) [-995.815] -- 0:00:35
424500 -- [-994.551] (-993.739) (-996.506) (-993.898) * (-995.722) [-996.116] (-994.716) (-994.925) -- 0:00:35
425000 -- [-994.227] (-996.297) (-996.718) (-994.009) * (-995.943) (-1000.009) [-994.718] (-995.592) -- 0:00:35
Average standard deviation of split frequencies: 0.010098
425500 -- (-995.560) (-994.602) [-995.158] (-997.503) * (-996.063) (-999.633) [-994.585] (-997.738) -- 0:00:35
426000 -- (-998.814) [-995.155] (-995.244) (-999.562) * [-996.513] (-996.597) (-997.760) (-1001.267) -- 0:00:35
426500 -- (-996.526) (-993.883) [-995.068] (-994.532) * (-996.600) (-995.897) [-994.241] (-998.685) -- 0:00:34
427000 -- (-994.609) (-996.029) [-996.702] (-995.979) * (-995.893) (-995.419) [-994.324] (-994.392) -- 0:00:34
427500 -- [-994.027] (-995.466) (-995.302) (-995.116) * [-996.114] (-994.206) (-994.090) (-993.993) -- 0:00:34
428000 -- (-997.799) [-996.206] (-994.821) (-993.804) * (-997.055) (-996.634) (-995.116) [-995.502] -- 0:00:34
428500 -- [-996.411] (-994.943) (-995.727) (-996.735) * (-994.773) (-994.665) (-994.089) [-997.939] -- 0:00:34
429000 -- (-995.231) (-994.892) [-996.270] (-997.239) * (-996.928) [-994.225] (-997.296) (-1000.601) -- 0:00:34
429500 -- [-998.281] (-996.169) (-995.922) (-996.306) * (-995.087) [-996.473] (-999.038) (-998.543) -- 0:00:34
430000 -- (-993.736) (-999.106) (-1000.893) [-998.168] * (-995.701) (-995.348) (-996.953) [-994.240] -- 0:00:34
Average standard deviation of split frequencies: 0.009195
430500 -- [-995.004] (-999.411) (-996.596) (-995.125) * (-994.810) [-1002.018] (-995.812) (-997.325) -- 0:00:34
431000 -- (-995.210) [-995.937] (-996.185) (-996.550) * (-995.874) (-998.112) [-994.991] (-998.229) -- 0:00:34
431500 -- (-995.272) (-996.888) (-996.384) [-997.322] * (-993.801) (-995.496) [-996.999] (-997.332) -- 0:00:34
432000 -- (-995.360) (-994.358) [-998.067] (-995.663) * (-995.335) (-995.481) [-994.252] (-997.173) -- 0:00:34
432500 -- (-997.466) (-995.172) [-996.195] (-996.371) * [-995.248] (-995.067) (-994.261) (-995.123) -- 0:00:34
433000 -- (-999.412) (-1001.824) (-996.473) [-996.793] * (-995.303) (-996.011) (-995.540) [-994.857] -- 0:00:34
433500 -- [-994.449] (-1003.682) (-994.711) (-994.439) * [-994.418] (-996.369) (-994.570) (-996.339) -- 0:00:33
434000 -- (-994.614) (-1004.944) (-998.111) [-994.193] * [-994.646] (-997.694) (-994.191) (-995.757) -- 0:00:33
434500 -- (-994.491) [-998.419] (-995.095) (-998.657) * [-994.179] (-1003.084) (-995.016) (-995.518) -- 0:00:33
435000 -- [-995.073] (-995.891) (-995.451) (-996.447) * (-995.248) [-1002.176] (-994.369) (-996.146) -- 0:00:35
Average standard deviation of split frequencies: 0.008578
435500 -- (-993.639) (-995.566) [-995.952] (-997.025) * [-996.334] (-995.551) (-1000.619) (-998.045) -- 0:00:34
436000 -- [-997.600] (-998.744) (-996.927) (-997.049) * (-998.217) [-995.509] (-995.061) (-994.956) -- 0:00:34
436500 -- (-995.387) (-1002.715) (-995.042) [-997.514] * (-996.566) (-996.282) (-994.675) [-996.809] -- 0:00:34
437000 -- [-993.887] (-997.888) (-995.757) (-998.230) * (-995.054) [-993.836] (-994.551) (-1000.288) -- 0:00:34
437500 -- [-995.174] (-1001.380) (-996.897) (-997.141) * (-995.142) [-994.504] (-998.972) (-998.767) -- 0:00:34
438000 -- (-997.488) (-1001.581) [-994.290] (-994.633) * (-1001.565) (-994.241) [-994.238] (-995.129) -- 0:00:34
438500 -- [-996.554] (-997.663) (-994.995) (-994.912) * (-995.804) (-996.915) (-998.690) [-994.680] -- 0:00:34
439000 -- (-996.121) [-996.762] (-996.015) (-995.489) * (-998.810) (-998.175) (-1001.108) [-996.291] -- 0:00:34
439500 -- (-994.338) [-996.730] (-996.022) (-998.178) * (-995.022) [-998.163] (-994.038) (-1000.304) -- 0:00:34
440000 -- (-994.197) [-995.228] (-996.209) (-997.553) * (-994.988) (-999.019) [-994.860] (-997.722) -- 0:00:34
Average standard deviation of split frequencies: 0.007774
440500 -- (-993.854) (-995.755) (-999.783) [-995.867] * (-994.383) (-994.715) [-994.407] (-997.344) -- 0:00:34
441000 -- (-993.933) (-994.504) [-995.524] (-997.550) * (-994.132) [-998.537] (-995.399) (-994.065) -- 0:00:34
441500 -- (-993.618) (-999.300) [-994.257] (-997.779) * (-996.905) (-999.780) (-996.141) [-994.029] -- 0:00:34
442000 -- (-996.237) [-996.105] (-996.349) (-994.745) * (-995.442) (-998.754) (-995.397) [-995.005] -- 0:00:34
442500 -- (-995.344) (-994.554) (-993.996) [-995.184] * (-994.994) (-1001.474) [-994.023] (-994.860) -- 0:00:34
443000 -- (-996.273) (-995.951) (-994.072) [-997.210] * [-993.964] (-998.509) (-994.150) (-994.017) -- 0:00:33
443500 -- [-994.628] (-997.252) (-995.970) (-997.522) * (-995.572) (-994.027) [-998.211] (-995.198) -- 0:00:33
444000 -- (-994.251) (-994.721) [-996.514] (-996.065) * (-995.164) [-994.065] (-998.589) (-995.578) -- 0:00:33
444500 -- [-994.629] (-995.226) (-998.725) (-995.507) * (-994.495) (-993.989) (-997.936) [-995.819] -- 0:00:33
445000 -- (-995.607) (-996.759) (-995.994) [-996.245] * (-996.664) (-994.465) [-994.753] (-994.904) -- 0:00:33
Average standard deviation of split frequencies: 0.007258
445500 -- (-997.416) (-997.706) [-996.695] (-995.811) * (-994.696) (-996.380) (-998.827) [-994.868] -- 0:00:33
446000 -- (-994.534) [-994.426] (-997.909) (-999.364) * (-993.882) (-994.905) [-998.677] (-995.864) -- 0:00:33
446500 -- [-995.278] (-998.990) (-995.185) (-995.512) * [-994.587] (-994.571) (-995.308) (-994.759) -- 0:00:33
447000 -- (-995.667) (-996.807) (-994.940) [-998.885] * [-994.227] (-995.147) (-996.069) (-994.760) -- 0:00:33
447500 -- (-996.548) [-999.748] (-997.484) (-999.528) * (-994.942) [-993.964] (-996.680) (-997.086) -- 0:00:33
448000 -- (-1000.094) [-996.462] (-997.529) (-1006.277) * (-995.716) (-993.800) (-997.633) [-993.867] -- 0:00:33
448500 -- (-996.076) (-998.441) (-994.027) [-997.396] * [-998.017] (-995.837) (-996.285) (-995.710) -- 0:00:33
449000 -- (-994.667) (-996.261) [-996.028] (-996.615) * (-994.353) [-998.020] (-994.766) (-994.370) -- 0:00:33
449500 -- [-994.692] (-994.807) (-995.963) (-996.804) * (-996.466) (-996.836) (-995.295) [-997.034] -- 0:00:33
450000 -- (-995.480) (-995.776) (-998.638) [-998.194] * [-997.639] (-997.161) (-993.825) (-996.999) -- 0:00:33
Average standard deviation of split frequencies: 0.008229
450500 -- [-994.635] (-997.389) (-997.514) (-996.006) * (-996.055) (-996.216) (-994.694) [-999.754] -- 0:00:32
451000 -- [-993.903] (-1002.329) (-995.669) (-996.083) * (-994.944) [-995.341] (-994.690) (-1001.250) -- 0:00:32
451500 -- (-995.226) (-995.086) [-994.944] (-994.430) * (-996.538) [-996.702] (-996.070) (-996.925) -- 0:00:34
452000 -- (-996.012) (-994.307) [-994.034] (-994.862) * [-996.945] (-1000.226) (-994.633) (-996.270) -- 0:00:33
452500 -- (-1001.767) (-998.061) [-994.790] (-997.256) * [-995.084] (-998.885) (-995.666) (-997.822) -- 0:00:33
453000 -- [-995.530] (-1004.296) (-996.319) (-999.521) * [-998.078] (-996.180) (-997.599) (-995.393) -- 0:00:33
453500 -- (-996.851) (-999.894) [-995.610] (-1001.199) * (-995.566) (-995.767) [-994.021] (-995.986) -- 0:00:33
454000 -- (-996.464) (-998.446) (-995.619) [-995.089] * [-993.999] (-995.541) (-998.413) (-999.725) -- 0:00:33
454500 -- (-996.907) (-996.507) (-994.946) [-996.112] * (-997.188) (-995.772) (-998.550) [-995.921] -- 0:00:33
455000 -- [-994.542] (-995.533) (-997.764) (-995.051) * (-996.799) [-994.443] (-998.281) (-995.612) -- 0:00:33
Average standard deviation of split frequencies: 0.008408
455500 -- (-995.811) (-995.455) [-995.795] (-998.997) * (-995.262) [-994.247] (-998.256) (-995.561) -- 0:00:33
456000 -- (-995.295) [-994.371] (-995.647) (-995.251) * (-995.415) [-996.356] (-994.267) (-995.796) -- 0:00:33
456500 -- (-995.450) [-994.590] (-1000.589) (-994.788) * (-994.197) (-1001.214) [-999.157] (-996.119) -- 0:00:33
457000 -- [-996.027] (-995.139) (-998.114) (-1001.602) * (-995.015) (-996.616) (-996.344) [-996.223] -- 0:00:33
457500 -- (-997.653) (-998.058) [-994.712] (-995.399) * (-995.181) (-995.101) [-997.708] (-997.389) -- 0:00:33
458000 -- (-995.812) (-1000.696) [-995.347] (-995.399) * (-996.119) (-997.132) (-996.807) [-997.092] -- 0:00:33
458500 -- (-994.942) [-994.346] (-997.410) (-996.977) * (-995.268) [-996.166] (-996.342) (-1001.696) -- 0:00:33
459000 -- (-996.219) (-998.640) (-1004.127) [-999.503] * (-995.604) [-994.964] (-996.923) (-996.399) -- 0:00:33
459500 -- (-996.247) (-999.624) (-997.298) [-996.249] * [-994.674] (-999.452) (-998.044) (-996.611) -- 0:00:32
460000 -- (-994.872) (-998.313) (-996.044) [-998.131] * (-996.545) (-998.244) [-993.953] (-996.884) -- 0:00:32
Average standard deviation of split frequencies: 0.008528
460500 -- (-996.484) [-1001.612] (-997.471) (-995.314) * (-994.830) (-994.447) [-994.886] (-997.236) -- 0:00:32
461000 -- [-997.313] (-996.160) (-997.496) (-1000.908) * [-995.469] (-995.177) (-994.232) (-994.606) -- 0:00:32
461500 -- (-993.708) (-994.353) [-996.506] (-994.979) * [-995.687] (-994.997) (-997.374) (-998.581) -- 0:00:32
462000 -- (-994.650) [-995.086] (-996.362) (-994.474) * (-995.099) (-996.278) (-995.091) [-994.562] -- 0:00:32
462500 -- (-995.489) [-995.768] (-998.278) (-996.776) * [-995.953] (-994.008) (-994.935) (-994.540) -- 0:00:32
463000 -- (-997.791) (-997.992) (-994.134) [-994.172] * (-995.441) (-994.374) [-996.604] (-995.173) -- 0:00:32
463500 -- [-996.772] (-997.525) (-996.677) (-995.948) * (-994.512) (-997.127) (-996.023) [-994.528] -- 0:00:32
464000 -- (-994.554) (-996.456) (-996.258) [-997.265] * (-994.499) [-998.276] (-996.516) (-994.864) -- 0:00:32
464500 -- [-994.321] (-995.914) (-995.807) (-994.214) * (-995.097) (-996.106) (-997.571) [-995.101] -- 0:00:32
465000 -- (-994.875) (-997.250) [-997.312] (-996.189) * [-995.224] (-996.229) (-995.290) (-993.858) -- 0:00:32
Average standard deviation of split frequencies: 0.008700
465500 -- (-996.018) [-994.317] (-997.787) (-994.829) * (-995.614) (-996.472) (-996.317) [-993.815] -- 0:00:32
466000 -- (-994.210) (-995.656) [-994.546] (-998.401) * (-998.640) (-995.921) (-996.116) [-995.006] -- 0:00:32
466500 -- [-995.113] (-995.465) (-995.920) (-994.815) * [-997.325] (-997.874) (-1001.452) (-996.466) -- 0:00:32
467000 -- (-999.187) [-996.043] (-994.440) (-995.714) * (-995.224) (-994.372) (-993.906) [-994.850] -- 0:00:31
467500 -- [-997.677] (-996.076) (-994.062) (-995.474) * [-996.140] (-995.263) (-993.895) (-996.364) -- 0:00:31
468000 -- (-994.656) (-995.306) [-993.820] (-998.655) * (-997.650) (-993.971) [-996.414] (-995.415) -- 0:00:32
468500 -- (-994.970) (-995.055) [-993.646] (-993.768) * [-1001.230] (-995.771) (-997.889) (-997.710) -- 0:00:32
469000 -- [-997.714] (-996.073) (-993.728) (-996.262) * (-997.944) [-997.204] (-995.559) (-996.105) -- 0:00:32
469500 -- (-997.194) (-997.500) [-994.904] (-998.695) * (-996.209) [-995.937] (-996.305) (-999.308) -- 0:00:32
470000 -- (-993.769) [-999.283] (-997.495) (-995.687) * (-995.285) (-995.979) (-995.918) [-994.840] -- 0:00:32
Average standard deviation of split frequencies: 0.008146
470500 -- [-994.190] (-996.951) (-994.332) (-996.535) * (-996.883) [-994.311] (-996.613) (-998.587) -- 0:00:32
471000 -- [-994.953] (-995.830) (-1000.916) (-994.122) * (-994.713) (-993.817) (-995.318) [-998.896] -- 0:00:32
471500 -- (-997.139) (-993.959) [-993.886] (-994.714) * (-993.795) [-994.056] (-996.979) (-994.185) -- 0:00:32
472000 -- (-993.930) (-993.934) [-997.320] (-994.783) * (-995.351) (-994.327) (-996.084) [-996.105] -- 0:00:32
472500 -- (-994.625) [-993.749] (-995.024) (-996.235) * [-994.332] (-995.338) (-994.646) (-994.464) -- 0:00:32
473000 -- (-995.324) (-993.729) [-993.669] (-996.363) * (-995.181) (-995.955) (-998.459) [-994.568] -- 0:00:32
473500 -- [-994.925] (-994.605) (-995.270) (-997.741) * (-995.258) [-996.041] (-997.147) (-998.182) -- 0:00:32
474000 -- (-993.864) (-995.363) (-998.159) [-994.982] * (-994.299) (-998.662) (-996.957) [-997.601] -- 0:00:32
474500 -- (-996.556) [-993.939] (-1000.819) (-995.343) * [-994.113] (-996.495) (-999.091) (-996.982) -- 0:00:32
475000 -- (-994.353) (-997.799) (-996.506) [-993.774] * (-995.203) [-998.045] (-995.885) (-995.573) -- 0:00:32
Average standard deviation of split frequencies: 0.008385
475500 -- [-994.698] (-997.249) (-994.704) (-1000.518) * (-994.450) (-995.889) (-996.661) [-994.808] -- 0:00:31
476000 -- [-994.050] (-998.835) (-994.121) (-1001.239) * (-993.691) (-996.280) (-997.696) [-994.655] -- 0:00:31
476500 -- (-994.040) (-999.593) (-995.658) [-995.043] * [-993.749] (-997.666) (-998.255) (-995.574) -- 0:00:31
477000 -- (-998.446) (-994.841) (-996.758) [-996.545] * (-994.930) (-999.818) [-995.367] (-995.745) -- 0:00:31
477500 -- (-996.716) (-994.287) [-999.380] (-994.866) * (-1001.258) (-994.644) [-997.126] (-994.901) -- 0:00:31
478000 -- (-997.153) (-995.676) (-1002.242) [-994.051] * (-997.472) [-996.193] (-997.736) (-995.906) -- 0:00:31
478500 -- [-1004.031] (-996.785) (-994.293) (-996.167) * (-993.955) (-996.487) [-996.737] (-996.253) -- 0:00:31
479000 -- (-997.469) [-996.826] (-995.469) (-995.484) * [-993.693] (-995.983) (-996.688) (-994.589) -- 0:00:31
479500 -- (-997.741) [-994.298] (-994.797) (-995.943) * [-995.698] (-996.545) (-994.737) (-995.543) -- 0:00:31
480000 -- (-996.090) (-995.261) [-994.258] (-1001.458) * (-995.499) (-995.844) [-994.118] (-995.385) -- 0:00:31
Average standard deviation of split frequencies: 0.008565
480500 -- (-996.638) (-999.009) (-996.167) [-995.239] * (-995.770) [-995.665] (-994.654) (-995.516) -- 0:00:31
481000 -- [-999.208] (-996.935) (-994.709) (-995.417) * (-999.057) (-994.498) [-995.428] (-996.429) -- 0:00:31
481500 -- (-998.320) (-996.410) [-994.262] (-995.465) * (-996.677) (-996.970) (-995.430) [-997.844] -- 0:00:31
482000 -- [-996.020] (-995.394) (-995.009) (-995.061) * (-997.271) (-997.493) [-993.863] (-995.176) -- 0:00:31
482500 -- [-993.759] (-998.509) (-994.337) (-994.997) * (-997.267) (-995.724) [-994.157] (-994.250) -- 0:00:31
483000 -- (-994.245) (-994.752) (-994.827) [-995.496] * [-997.655] (-994.242) (-994.604) (-994.600) -- 0:00:31
483500 -- [-996.440] (-1000.207) (-995.995) (-1000.306) * (-995.308) [-997.978] (-993.554) (-995.741) -- 0:00:30
484000 -- (-998.950) [-1000.622] (-995.057) (-994.555) * [-995.955] (-995.395) (-995.589) (-996.111) -- 0:00:30
484500 -- (-994.380) (-999.362) [-994.551] (-996.148) * (-997.105) (-997.568) [-997.171] (-996.768) -- 0:00:31
485000 -- (-996.793) (-996.641) [-997.743] (-997.611) * (-998.420) [-995.325] (-997.672) (-996.179) -- 0:00:31
Average standard deviation of split frequencies: 0.007820
485500 -- (-994.393) [-996.117] (-999.477) (-997.845) * (-997.566) (-996.856) [-995.668] (-995.264) -- 0:00:31
486000 -- [-995.907] (-996.567) (-1000.621) (-994.765) * (-994.317) [-996.261] (-995.000) (-995.314) -- 0:00:31
486500 -- (-996.665) (-997.623) (-999.121) [-995.290] * (-994.470) (-994.535) [-994.723] (-995.652) -- 0:00:31
487000 -- [-996.925] (-995.265) (-995.867) (-995.316) * [-994.074] (-995.213) (-994.828) (-995.330) -- 0:00:31
487500 -- (-998.804) (-996.943) (-995.465) [-996.403] * [-994.504] (-994.913) (-999.292) (-995.666) -- 0:00:31
488000 -- [-995.721] (-996.811) (-994.589) (-997.967) * (-1000.473) (-996.023) (-996.861) [-996.757] -- 0:00:31
488500 -- [-995.892] (-999.059) (-994.462) (-999.056) * [-994.734] (-994.570) (-1000.128) (-996.552) -- 0:00:31
489000 -- (-994.360) (-994.634) [-1000.241] (-1000.122) * (-994.309) (-995.769) [-998.201] (-1000.042) -- 0:00:31
489500 -- (-997.781) [-995.855] (-996.791) (-1000.556) * (-995.012) (-998.382) [-995.240] (-995.641) -- 0:00:31
490000 -- (-999.337) [-994.860] (-996.610) (-998.892) * (-995.000) (-996.075) [-996.093] (-994.653) -- 0:00:31
Average standard deviation of split frequencies: 0.007045
490500 -- (-995.127) [-995.473] (-994.652) (-996.081) * [-994.372] (-996.269) (-997.412) (-996.065) -- 0:00:31
491000 -- (-996.304) [-996.988] (-998.260) (-998.520) * (-993.764) (-995.747) (-995.156) [-995.948] -- 0:00:31
491500 -- [-994.419] (-995.252) (-998.404) (-997.456) * (-994.843) (-995.278) (-996.144) [-997.864] -- 0:00:31
492000 -- [-996.697] (-1003.055) (-996.911) (-995.428) * [-994.525] (-995.960) (-995.194) (-997.003) -- 0:00:30
492500 -- [-994.442] (-995.621) (-994.965) (-994.367) * (-999.632) [-994.591] (-999.526) (-996.833) -- 0:00:30
493000 -- (-994.062) (-994.682) (-996.639) [-993.631] * (-998.705) (-1003.586) [-998.598] (-997.005) -- 0:00:30
493500 -- (-996.880) (-995.183) [-994.729] (-993.855) * [-996.727] (-996.225) (-1001.102) (-994.928) -- 0:00:30
494000 -- (-997.098) [-998.032] (-995.563) (-995.310) * (-996.718) (-993.933) (-997.766) [-997.851] -- 0:00:30
494500 -- (-997.445) (-998.366) [-995.360] (-995.248) * (-995.126) (-995.239) [-994.903] (-998.632) -- 0:00:30
495000 -- (-994.906) [-995.809] (-995.384) (-994.069) * [-997.999] (-995.511) (-997.692) (-996.499) -- 0:00:30
Average standard deviation of split frequencies: 0.007667
495500 -- (-996.057) [-995.141] (-996.326) (-993.793) * (-994.510) (-996.271) [-995.441] (-998.513) -- 0:00:30
496000 -- (-995.402) [-996.500] (-996.311) (-994.941) * (-999.225) [-996.711] (-997.173) (-998.149) -- 0:00:30
496500 -- (-995.960) (-996.528) [-996.667] (-995.659) * (-994.261) [-994.822] (-995.299) (-999.651) -- 0:00:30
497000 -- [-994.993] (-996.627) (-994.168) (-995.052) * (-995.644) (-996.839) (-998.943) [-996.334] -- 0:00:30
497500 -- (-993.748) (-995.169) [-993.900] (-994.863) * (-996.937) [-995.723] (-995.357) (-997.197) -- 0:00:30
498000 -- (-995.719) [-997.588] (-993.864) (-995.331) * (-996.688) [-994.858] (-995.926) (-995.349) -- 0:00:30
498500 -- [-996.736] (-993.827) (-994.789) (-993.593) * (-997.305) (-994.889) (-995.728) [-994.278] -- 0:00:30
499000 -- (-1001.926) (-994.242) (-995.251) [-995.571] * [-995.907] (-996.096) (-994.719) (-995.675) -- 0:00:30
499500 -- (-994.677) (-994.958) [-998.762] (-995.573) * [-994.289] (-995.442) (-993.699) (-994.764) -- 0:00:30
500000 -- (-995.068) (-994.307) (-998.623) [-994.772] * (-995.363) (-995.643) (-994.121) [-997.393] -- 0:00:30
Average standard deviation of split frequencies: 0.008097
500500 -- [-999.730] (-998.892) (-997.057) (-994.609) * [-996.882] (-996.068) (-994.654) (-994.331) -- 0:00:29
501000 -- (-993.974) (-1000.536) (-997.357) [-998.594] * (-995.103) (-998.152) (-997.586) [-994.307] -- 0:00:30
501500 -- (-997.745) (-998.553) [-995.432] (-1000.313) * (-995.471) [-995.992] (-997.010) (-994.352) -- 0:00:30
502000 -- [-1001.550] (-997.053) (-995.230) (-996.485) * [-993.978] (-994.278) (-998.203) (-996.626) -- 0:00:30
502500 -- [-995.375] (-996.088) (-995.128) (-995.639) * (-994.516) [-997.468] (-994.768) (-997.229) -- 0:00:30
503000 -- [-995.706] (-995.984) (-995.048) (-994.631) * [-996.325] (-998.422) (-993.850) (-996.838) -- 0:00:30
503500 -- [-994.226] (-995.521) (-994.850) (-995.842) * (-996.269) [-996.553] (-994.775) (-993.739) -- 0:00:30
504000 -- (-994.501) (-995.650) (-994.721) [-997.427] * (-997.067) (-994.612) (-995.948) [-995.592] -- 0:00:30
504500 -- (-995.534) [-993.885] (-1005.277) (-994.388) * (-995.658) (-995.779) (-995.098) [-995.034] -- 0:00:30
505000 -- (-995.594) (-997.877) (-996.628) [-995.305] * (-998.033) (-995.480) [-994.011] (-994.412) -- 0:00:30
Average standard deviation of split frequencies: 0.007950
505500 -- (-996.602) (-994.803) (-996.340) [-995.367] * (-999.120) (-996.979) (-993.795) [-994.852] -- 0:00:30
506000 -- (-998.196) [-997.116] (-995.956) (-994.541) * (-995.141) [-996.122] (-995.156) (-995.876) -- 0:00:30
506500 -- (-996.154) (-995.158) [-993.801] (-995.046) * (-994.580) (-995.720) (-997.853) [-997.962] -- 0:00:30
507000 -- (-994.760) (-999.463) (-995.328) [-995.583] * [-994.856] (-995.501) (-995.429) (-999.601) -- 0:00:30
507500 -- (-995.942) [-995.924] (-997.577) (-998.611) * [-995.633] (-995.033) (-997.906) (-995.910) -- 0:00:30
508000 -- (-996.602) (-995.291) [-994.205] (-994.247) * (-995.972) [-995.081] (-1000.994) (-997.127) -- 0:00:30
508500 -- (-995.503) (-995.145) [-995.201] (-999.735) * (-994.541) [-995.827] (-994.713) (-996.598) -- 0:00:29
509000 -- (-995.279) (-994.709) [-997.676] (-994.150) * (-994.232) (-995.270) (-996.316) [-993.777] -- 0:00:29
509500 -- (-996.298) (-995.820) (-994.762) [-995.286] * (-995.653) (-993.553) (-995.654) [-993.835] -- 0:00:29
510000 -- (-997.324) (-1002.178) (-996.724) [-994.512] * (-995.950) (-994.293) [-994.971] (-996.081) -- 0:00:29
Average standard deviation of split frequencies: 0.008431
510500 -- (-995.559) [-996.611] (-997.950) (-995.533) * [-995.024] (-994.982) (-994.545) (-993.726) -- 0:00:29
511000 -- (-995.742) (-996.224) (-999.662) [-997.080] * (-995.617) (-995.142) (-994.604) [-995.002] -- 0:00:29
511500 -- [-997.058] (-996.566) (-993.859) (-995.782) * (-1000.715) (-995.434) (-994.237) [-995.920] -- 0:00:29
512000 -- [-1001.528] (-994.565) (-998.288) (-997.039) * (-1000.623) (-994.905) (-994.189) [-994.188] -- 0:00:29
512500 -- (-994.636) [-997.650] (-995.543) (-995.627) * [-996.789] (-996.678) (-996.428) (-994.754) -- 0:00:29
513000 -- (-996.829) (-996.939) (-998.516) [-996.501] * [-999.818] (-1002.882) (-998.253) (-996.035) -- 0:00:29
513500 -- [-998.461] (-1000.145) (-996.106) (-997.668) * [-996.291] (-1004.347) (-997.149) (-995.993) -- 0:00:29
514000 -- (-998.904) (-1000.349) (-1001.060) [-996.535] * (-996.384) (-998.992) (-995.063) [-994.649] -- 0:00:29
514500 -- (-994.782) (-998.501) (-997.190) [-995.044] * (-996.972) [-998.027] (-997.015) (-994.362) -- 0:00:29
515000 -- (-994.806) (-1000.111) [-995.610] (-995.010) * (-997.491) (-994.681) [-994.921] (-994.272) -- 0:00:29
Average standard deviation of split frequencies: 0.008831
515500 -- (-995.720) (-995.662) [-994.050] (-994.501) * (-995.804) (-994.274) (-996.847) [-993.887] -- 0:00:29
516000 -- (-996.764) (-997.113) (-995.223) [-997.248] * (-996.362) (-995.697) (-994.952) [-993.572] -- 0:00:29
516500 -- (-1000.887) (-994.376) [-996.595] (-997.878) * (-996.204) [-995.027] (-996.339) (-993.626) -- 0:00:29
517000 -- [-996.074] (-994.073) (-995.031) (-995.277) * (-996.005) (-996.614) (-1000.794) [-993.727] -- 0:00:28
517500 -- (-995.384) (-995.912) [-994.179] (-997.364) * (-1004.288) (-995.765) (-996.288) [-997.803] -- 0:00:29
518000 -- [-994.806] (-994.857) (-993.937) (-995.000) * [-994.050] (-996.618) (-997.930) (-994.363) -- 0:00:29
518500 -- (-996.559) [-994.280] (-994.727) (-994.219) * (-994.071) [-999.506] (-996.462) (-994.918) -- 0:00:29
519000 -- (-997.716) [-995.873] (-996.890) (-994.571) * [-996.924] (-997.725) (-995.743) (-995.261) -- 0:00:29
519500 -- (-995.517) (-999.601) (-995.748) [-994.906] * (-993.929) [-999.683] (-995.388) (-998.677) -- 0:00:29
520000 -- (-997.316) [-994.409] (-995.656) (-997.974) * (-997.996) (-996.816) [-994.252] (-998.424) -- 0:00:29
Average standard deviation of split frequencies: 0.008812
520500 -- (-996.107) (-993.991) (-997.753) [-995.787] * (-996.182) (-995.929) [-997.336] (-994.718) -- 0:00:29
521000 -- (-995.718) (-995.397) (-995.955) [-996.537] * [-994.682] (-994.549) (-995.443) (-993.977) -- 0:00:29
521500 -- (-997.460) [-995.270] (-997.496) (-994.857) * (-995.604) (-994.684) (-996.956) [-994.039] -- 0:00:29
522000 -- [-995.477] (-994.723) (-995.840) (-996.911) * (-997.992) [-994.755] (-994.115) (-995.936) -- 0:00:29
522500 -- (-997.449) [-993.734] (-993.845) (-994.725) * [-999.336] (-995.487) (-995.753) (-996.267) -- 0:00:29
523000 -- (-997.452) [-994.450] (-994.799) (-996.452) * (-995.014) (-995.409) (-1000.669) [-996.074] -- 0:00:29
523500 -- (-997.084) [-995.091] (-994.398) (-993.794) * (-1000.334) [-996.564] (-997.364) (-996.628) -- 0:00:29
524000 -- (-998.680) [-996.456] (-995.596) (-994.701) * (-994.475) (-997.397) (-994.066) [-995.612] -- 0:00:29
524500 -- [-998.679] (-996.452) (-995.097) (-995.558) * [-995.483] (-997.339) (-994.125) (-994.492) -- 0:00:29
525000 -- (-1000.582) (-1001.383) [-999.836] (-997.680) * (-995.210) (-995.110) (-994.447) [-994.105] -- 0:00:28
Average standard deviation of split frequencies: 0.009380
525500 -- (-1000.194) [-999.950] (-998.860) (-998.184) * (-997.164) [-995.005] (-996.240) (-994.645) -- 0:00:28
526000 -- (-994.999) [-998.565] (-996.812) (-1000.016) * (-994.314) [-994.848] (-1000.101) (-997.267) -- 0:00:28
526500 -- (-997.363) [-996.059] (-995.935) (-997.917) * (-995.797) (-996.015) (-996.871) [-996.161] -- 0:00:28
527000 -- (-1000.713) [-994.120] (-994.101) (-1003.142) * (-995.743) [-994.789] (-994.373) (-995.838) -- 0:00:28
527500 -- (-998.064) [-995.183] (-998.436) (-996.445) * (-995.503) (-995.847) [-997.262] (-996.305) -- 0:00:28
528000 -- (-996.261) (-995.640) (-996.300) [-996.844] * [-995.032] (-997.044) (-994.752) (-996.643) -- 0:00:28
528500 -- (-995.445) (-994.401) (-994.865) [-997.384] * (-997.506) (-997.810) [-995.070] (-996.215) -- 0:00:28
529000 -- (-994.685) (-994.520) (-998.908) [-995.977] * (-997.824) [-995.652] (-994.653) (-995.116) -- 0:00:28
529500 -- (-993.942) [-994.878] (-995.124) (-995.617) * (-994.023) [-994.989] (-995.431) (-993.750) -- 0:00:28
530000 -- (-993.895) (-995.403) [-994.828] (-996.376) * (-996.397) (-995.522) (-994.060) [-993.800] -- 0:00:28
Average standard deviation of split frequencies: 0.008824
530500 -- (-993.807) (-994.953) (-996.326) [-995.602] * (-994.203) [-997.751] (-995.866) (-994.243) -- 0:00:28
531000 -- [-997.094] (-996.441) (-996.329) (-999.934) * (-999.263) (-995.598) [-994.372] (-997.692) -- 0:00:28
531500 -- (-993.924) [-995.099] (-1004.859) (-996.666) * [-998.882] (-1000.490) (-996.010) (-998.209) -- 0:00:28
532000 -- (-998.433) (-995.690) [-995.279] (-996.799) * (-996.711) (-997.203) [-995.743] (-994.408) -- 0:00:28
532500 -- (-998.708) [-994.002] (-997.255) (-1000.549) * (-996.264) (-996.156) [-997.015] (-994.759) -- 0:00:28
533000 -- [-999.864] (-996.413) (-999.711) (-994.063) * (-996.657) [-995.176] (-997.316) (-995.582) -- 0:00:28
533500 -- (-994.685) [-997.315] (-997.826) (-995.719) * [-995.144] (-996.348) (-993.957) (-995.533) -- 0:00:27
534000 -- (-994.762) [-995.776] (-996.483) (-996.029) * (-998.205) [-996.019] (-995.598) (-996.545) -- 0:00:27
534500 -- (-994.126) (-994.387) [-996.654] (-995.626) * (-995.120) (-995.512) [-995.967] (-995.214) -- 0:00:28
535000 -- [-996.378] (-994.023) (-995.581) (-996.766) * (-995.110) (-993.966) (-994.466) [-994.857] -- 0:00:28
Average standard deviation of split frequencies: 0.009205
535500 -- (-996.720) [-994.007] (-993.974) (-996.458) * (-995.375) (-994.300) (-998.113) [-995.558] -- 0:00:28
536000 -- [-997.473] (-995.883) (-995.167) (-995.903) * (-994.409) (-995.618) (-998.973) [-995.516] -- 0:00:28
536500 -- [-995.808] (-996.665) (-996.864) (-998.109) * (-996.749) (-999.025) (-997.066) [-995.068] -- 0:00:28
537000 -- (-995.223) (-997.667) (-996.330) [-998.772] * (-996.227) (-996.864) [-995.334] (-997.100) -- 0:00:28
537500 -- (-995.543) (-998.614) (-995.407) [-998.573] * (-994.089) (-996.376) [-995.024] (-995.516) -- 0:00:28
538000 -- (-999.570) (-997.846) (-996.720) [-996.628] * (-996.525) (-997.714) [-994.572] (-997.586) -- 0:00:28
538500 -- (-997.020) (-999.287) [-1000.091] (-994.869) * (-995.376) (-998.491) (-997.245) [-998.603] -- 0:00:28
539000 -- (-996.851) (-995.280) [-995.941] (-995.228) * [-993.905] (-997.771) (-995.136) (-993.600) -- 0:00:28
539500 -- (-998.026) (-996.786) (-994.879) [-995.009] * (-997.769) (-994.708) (-994.476) [-996.707] -- 0:00:28
540000 -- (-996.932) (-995.247) [-996.358] (-995.169) * (-995.527) (-1003.647) [-994.798] (-994.642) -- 0:00:28
Average standard deviation of split frequencies: 0.009242
540500 -- (-994.274) (-996.016) [-994.737] (-996.984) * (-1000.027) [-996.196] (-997.217) (-996.549) -- 0:00:28
541000 -- [-996.938] (-995.564) (-998.910) (-993.773) * (-1002.377) (-995.176) (-995.485) [-997.109] -- 0:00:27
541500 -- [-999.029] (-995.816) (-998.623) (-993.482) * (-996.920) (-994.897) (-995.650) [-996.794] -- 0:00:27
542000 -- (-996.670) (-995.669) [-994.909] (-995.885) * (-995.086) [-993.704] (-995.652) (-996.090) -- 0:00:27
542500 -- [-996.268] (-994.562) (-994.808) (-994.092) * [-995.423] (-995.742) (-995.787) (-997.473) -- 0:00:27
543000 -- (-997.011) (-994.215) [-997.582] (-994.030) * (-997.963) [-995.182] (-997.867) (-995.252) -- 0:00:27
543500 -- (-995.759) (-994.301) [-994.271] (-995.246) * (-996.814) (-995.446) (-997.900) [-996.346] -- 0:00:27
544000 -- (-997.790) (-994.807) (-995.733) [-993.921] * (-996.420) (-996.907) [-994.816] (-994.698) -- 0:00:27
544500 -- (-1001.046) (-994.355) [-996.543] (-994.730) * [-994.806] (-995.764) (-995.383) (-995.130) -- 0:00:27
545000 -- (-999.455) (-998.503) (-997.280) [-994.571] * (-997.087) (-994.850) (-995.522) [-996.096] -- 0:00:27
Average standard deviation of split frequencies: 0.009497
545500 -- (-995.801) [-994.297] (-999.792) (-994.736) * (-996.994) [-993.807] (-996.169) (-995.913) -- 0:00:27
546000 -- (-998.099) (-994.190) (-997.276) [-994.110] * (-995.407) (-995.320) [-998.890] (-993.790) -- 0:00:27
546500 -- (-999.243) (-995.200) (-995.163) [-994.275] * (-997.708) [-996.027] (-994.634) (-995.503) -- 0:00:27
547000 -- (-997.600) (-997.988) (-993.943) [-994.983] * (-996.640) (-997.124) (-995.607) [-993.624] -- 0:00:27
547500 -- (-996.206) (-995.715) (-994.151) [-995.931] * [-995.038] (-1001.599) (-995.647) (-1000.009) -- 0:00:27
548000 -- (-995.032) [-995.359] (-994.049) (-998.516) * (-996.778) (-1000.943) [-995.147] (-999.134) -- 0:00:27
548500 -- [-998.932] (-995.391) (-999.417) (-994.379) * (-995.635) [-994.034] (-995.534) (-1001.932) -- 0:00:27
549000 -- [-996.932] (-995.159) (-996.897) (-995.184) * (-994.173) (-994.834) [-996.536] (-1002.788) -- 0:00:27
549500 -- [-995.684] (-997.479) (-995.683) (-994.879) * (-994.961) (-994.228) (-996.811) [-995.864] -- 0:00:27
550000 -- (-994.467) (-999.544) (-995.510) [-994.438] * (-996.115) (-994.978) (-994.723) [-996.988] -- 0:00:27
Average standard deviation of split frequencies: 0.008789
550500 -- (-995.403) (-997.496) [-994.200] (-996.840) * (-999.430) [-994.950] (-995.098) (-994.751) -- 0:00:27
551000 -- (-994.282) (-994.769) [-995.781] (-995.312) * (-999.467) (-996.084) (-995.026) [-996.198] -- 0:00:27
551500 -- (-996.938) [-999.814] (-995.728) (-996.114) * (-995.698) (-994.577) [-997.455] (-1003.509) -- 0:00:27
552000 -- (-995.422) (-995.021) [-998.415] (-998.188) * (-999.985) (-993.927) [-997.508] (-997.842) -- 0:00:27
552500 -- (-995.955) (-994.518) [-995.007] (-994.154) * (-995.534) [-994.251] (-998.108) (-996.298) -- 0:00:27
553000 -- (-996.087) (-997.968) [-995.916] (-999.104) * (-994.868) (-995.902) [-996.202] (-995.802) -- 0:00:27
553500 -- (-996.742) [-997.362] (-998.787) (-997.687) * (-995.225) (-997.893) [-996.403] (-994.752) -- 0:00:27
554000 -- (-994.836) [-997.756] (-999.572) (-997.639) * [-995.261] (-998.374) (-994.025) (-997.890) -- 0:00:27
554500 -- [-996.117] (-996.459) (-996.045) (-995.827) * (-994.863) (-994.691) (-997.688) [-995.301] -- 0:00:27
555000 -- (-999.052) (-995.195) (-995.355) [-995.693] * (-995.582) (-996.521) (-1004.003) [-995.136] -- 0:00:27
Average standard deviation of split frequencies: 0.007744
555500 -- (-996.420) (-995.419) [-995.167] (-995.835) * [-994.757] (-996.689) (-998.254) (-995.226) -- 0:00:27
556000 -- (-995.368) [-995.072] (-994.891) (-996.805) * [-996.972] (-997.723) (-995.169) (-994.716) -- 0:00:27
556500 -- [-995.045] (-993.919) (-995.844) (-994.426) * (-995.223) [-997.960] (-995.208) (-996.078) -- 0:00:27
557000 -- (-994.545) (-994.590) (-996.376) [-996.595] * (-996.995) (-995.281) [-994.227] (-996.340) -- 0:00:27
557500 -- (-995.010) [-994.901] (-994.702) (-996.336) * (-996.074) (-998.285) [-996.142] (-998.374) -- 0:00:26
558000 -- (-995.557) [-993.962] (-994.875) (-997.287) * (-1000.634) (-997.439) [-995.908] (-995.319) -- 0:00:26
558500 -- (-994.623) [-995.905] (-994.241) (-994.819) * [-994.941] (-995.789) (-1000.022) (-997.020) -- 0:00:26
559000 -- (-993.858) (-994.817) [-994.485] (-997.299) * [-996.425] (-995.781) (-1002.810) (-997.212) -- 0:00:26
559500 -- (-995.873) [-995.321] (-993.976) (-997.269) * [-998.068] (-994.670) (-999.639) (-995.134) -- 0:00:26
560000 -- (-993.973) [-994.842] (-993.791) (-995.435) * (-996.822) [-995.669] (-994.673) (-996.887) -- 0:00:26
Average standard deviation of split frequencies: 0.007511
560500 -- [-998.613] (-994.554) (-993.707) (-1000.292) * (-996.041) (-994.929) [-996.660] (-995.003) -- 0:00:26
561000 -- (-994.111) [-995.802] (-994.289) (-996.211) * (-995.968) (-997.077) [-994.784] (-996.206) -- 0:00:26
561500 -- (-994.420) (-994.973) (-995.706) [-993.702] * (-995.309) (-995.369) (-994.295) [-994.215] -- 0:00:26
562000 -- (-997.537) (-999.224) (-995.303) [-993.756] * (-995.472) (-997.152) (-996.288) [-993.844] -- 0:00:26
562500 -- (-996.911) [-1000.262] (-995.379) (-994.349) * [-996.708] (-994.482) (-995.944) (-997.837) -- 0:00:26
563000 -- (-996.578) (-997.796) [-995.208] (-993.770) * (-997.037) [-994.443] (-994.833) (-1002.079) -- 0:00:26
563500 -- (-996.532) [-994.640] (-999.003) (-994.738) * (-999.395) (-996.615) [-994.880] (-996.151) -- 0:00:26
564000 -- [-996.196] (-997.706) (-996.529) (-994.331) * (-994.691) (-996.070) (-995.929) [-994.557] -- 0:00:26
564500 -- (-997.460) (-996.954) (-996.521) [-994.587] * (-993.732) [-996.273] (-996.142) (-995.461) -- 0:00:26
565000 -- [-1001.606] (-993.884) (-994.445) (-995.139) * (-996.004) (-997.730) (-999.746) [-994.379] -- 0:00:26
Average standard deviation of split frequencies: 0.007829
565500 -- (-995.208) [-998.540] (-993.996) (-995.507) * [-999.483] (-997.761) (-998.332) (-994.559) -- 0:00:26
566000 -- [-998.939] (-995.852) (-998.365) (-996.942) * (-1001.866) (-995.064) (-995.617) [-998.379] -- 0:00:26
566500 -- (-996.958) (-995.942) (-996.644) [-996.001] * (-994.943) (-995.396) (-996.937) [-996.168] -- 0:00:26
567000 -- [-996.863] (-995.655) (-996.415) (-996.603) * (-998.962) [-995.613] (-997.050) (-996.008) -- 0:00:25
567500 -- (-995.509) (-994.639) (-994.903) [-995.549] * (-994.881) (-995.315) (-997.075) [-995.276] -- 0:00:26
568000 -- (-1001.540) (-998.007) (-996.744) [-1000.189] * (-996.960) (-994.751) [-995.988] (-996.645) -- 0:00:26
568500 -- (-995.360) [-996.585] (-994.403) (-997.388) * [-995.741] (-995.719) (-993.890) (-1000.068) -- 0:00:26
569000 -- (-996.290) (-999.494) [-995.121] (-997.325) * (-998.506) (-995.514) [-995.821] (-998.282) -- 0:00:26
569500 -- [-995.198] (-999.810) (-996.806) (-996.693) * (-998.921) (-994.326) (-993.646) [-1005.880] -- 0:00:26
570000 -- (-997.022) [-995.634] (-995.587) (-996.105) * (-999.386) [-997.048] (-995.822) (-997.549) -- 0:00:26
Average standard deviation of split frequencies: 0.007930
570500 -- (-996.408) (-995.395) (-995.781) [-996.336] * (-997.703) (-997.277) (-995.378) [-995.146] -- 0:00:26
571000 -- (-995.896) [-995.344] (-995.258) (-993.830) * (-996.762) (-996.759) [-994.157] (-996.397) -- 0:00:26
571500 -- (-995.936) (-994.119) (-995.253) [-993.656] * (-993.910) (-995.397) [-993.815] (-998.829) -- 0:00:26
572000 -- [-997.703] (-1000.422) (-995.352) (-995.576) * (-999.365) (-1000.166) (-994.571) [-993.825] -- 0:00:26
572500 -- (-994.731) [-996.739] (-996.011) (-995.668) * [-998.185] (-997.373) (-997.622) (-993.825) -- 0:00:26
573000 -- [-997.504] (-996.447) (-995.589) (-998.944) * (-994.931) (-996.795) (-994.652) [-993.790] -- 0:00:26
573500 -- [-996.724] (-995.663) (-994.769) (-996.671) * (-995.920) [-994.914] (-994.653) (-995.436) -- 0:00:26
574000 -- [-995.386] (-996.396) (-995.928) (-995.210) * (-997.943) [-994.335] (-994.919) (-997.732) -- 0:00:25
574500 -- (-996.708) [-996.349] (-998.044) (-995.717) * [-993.856] (-996.394) (-998.086) (-999.476) -- 0:00:25
575000 -- (-996.154) (-997.463) (-998.019) [-994.430] * (-996.928) (-995.880) [-995.234] (-996.100) -- 0:00:25
Average standard deviation of split frequencies: 0.007420
575500 -- (-999.966) (-999.498) (-999.390) [-996.944] * (-997.427) (-997.525) [-994.721] (-995.340) -- 0:00:25
576000 -- (-998.026) [-994.163] (-997.015) (-996.227) * (-997.460) (-996.866) [-995.070] (-994.767) -- 0:00:25
576500 -- (-993.983) [-994.949] (-996.050) (-994.636) * (-997.636) [-993.924] (-998.269) (-999.264) -- 0:00:25
577000 -- (-999.906) (-995.000) (-994.656) [-996.633] * (-996.778) [-997.825] (-995.974) (-1002.380) -- 0:00:25
577500 -- [-995.450] (-994.672) (-994.164) (-996.592) * (-1001.714) [-993.777] (-996.062) (-995.003) -- 0:00:25
578000 -- [-996.417] (-994.833) (-996.413) (-994.131) * (-997.302) [-995.310] (-997.787) (-997.611) -- 0:00:25
578500 -- [-999.727] (-998.295) (-997.662) (-994.963) * (-1001.677) (-995.991) (-995.792) [-994.087] -- 0:00:25
579000 -- (-995.901) (-994.520) (-997.707) [-995.663] * (-997.051) (-995.247) (-998.306) [-995.036] -- 0:00:25
579500 -- [-994.466] (-994.142) (-1000.687) (-994.250) * (-998.004) [-993.896] (-997.794) (-997.059) -- 0:00:25
580000 -- [-994.078] (-994.478) (-998.344) (-995.767) * (-997.494) [-996.063] (-995.531) (-997.439) -- 0:00:25
Average standard deviation of split frequencies: 0.008118
580500 -- (-997.715) [-998.928] (-997.233) (-996.472) * (-996.144) (-997.763) [-993.729] (-997.760) -- 0:00:25
581000 -- (-998.775) (-994.444) (-996.323) [-994.922] * (-999.678) [-995.664] (-995.451) (-994.786) -- 0:00:25
581500 -- (-998.170) (-1002.010) [-995.277] (-1003.741) * (-995.908) [-993.938] (-997.155) (-996.390) -- 0:00:25
582000 -- [-995.142] (-995.854) (-996.428) (-994.715) * [-996.021] (-997.137) (-994.138) (-1000.536) -- 0:00:25
582500 -- (-995.247) (-1002.955) (-997.237) [-994.808] * [-994.322] (-996.484) (-995.091) (-997.697) -- 0:00:25
583000 -- (-994.229) [-995.536] (-994.394) (-993.860) * (-996.484) (-994.175) [-994.381] (-997.031) -- 0:00:25
583500 -- (-995.024) [-994.283] (-994.728) (-996.976) * (-998.046) [-994.899] (-997.275) (-996.821) -- 0:00:24
584000 -- (-995.828) [-994.075] (-996.032) (-994.827) * (-996.514) (-997.463) (-996.174) [-996.235] -- 0:00:25
584500 -- (-1001.342) [-999.391] (-994.957) (-997.429) * (-994.970) (-996.218) (-995.487) [-995.796] -- 0:00:25
585000 -- [-995.945] (-1001.044) (-998.028) (-996.163) * [-994.319] (-996.938) (-994.053) (-996.939) -- 0:00:25
Average standard deviation of split frequencies: 0.008296
585500 -- (-995.910) (-1001.609) (-998.922) [-996.439] * (-995.498) (-1003.719) [-995.263] (-997.308) -- 0:00:25
586000 -- (-1002.944) (-995.357) [-994.919] (-995.925) * (-997.678) (-995.108) [-994.546] (-996.043) -- 0:00:25
586500 -- (-994.885) [-996.861] (-998.810) (-995.913) * [-997.813] (-994.978) (-998.334) (-996.147) -- 0:00:25
587000 -- (-995.161) [-994.513] (-996.929) (-995.852) * [-995.688] (-995.558) (-996.723) (-995.913) -- 0:00:25
587500 -- (-995.950) (-993.654) [-993.884] (-995.619) * (-998.324) (-994.664) (-995.373) [-996.011] -- 0:00:25
588000 -- (-995.758) [-993.645] (-994.808) (-994.599) * (-994.832) [-995.302] (-995.463) (-994.294) -- 0:00:25
588500 -- (-996.134) (-994.228) (-1000.129) [-995.365] * (-996.636) (-996.256) (-996.960) [-994.772] -- 0:00:25
589000 -- (-997.692) (-995.349) [-996.631] (-994.857) * (-997.800) (-994.995) [-994.071] (-995.843) -- 0:00:25
589500 -- (-996.270) (-994.546) [-997.778] (-998.057) * (-996.494) (-995.626) (-994.436) [-994.819] -- 0:00:25
590000 -- (-997.812) (-996.178) (-995.174) [-994.513] * [-994.367] (-997.401) (-995.778) (-995.212) -- 0:00:25
Average standard deviation of split frequencies: 0.008031
590500 -- (-994.662) [-994.882] (-995.073) (-996.456) * [-994.293] (-1000.787) (-996.427) (-993.552) -- 0:00:24
591000 -- (-996.499) (-997.423) (-994.501) [-996.811] * (-994.642) (-996.716) (-994.106) [-996.158] -- 0:00:24
591500 -- (-994.858) (-997.319) (-993.819) [-998.309] * (-995.339) (-996.388) (-993.637) [-994.094] -- 0:00:24
592000 -- [-995.456] (-996.113) (-993.996) (-995.749) * [-996.897] (-1001.160) (-1001.136) (-993.863) -- 0:00:24
592500 -- (-996.673) (-994.965) (-993.840) [-997.616] * (-996.489) (-999.201) (-995.054) [-993.863] -- 0:00:24
593000 -- (-994.760) (-993.936) (-994.520) [-994.765] * (-994.983) (-995.524) [-993.559] (-994.225) -- 0:00:24
593500 -- (-998.149) [-994.143] (-998.197) (-998.314) * (-995.016) [-995.811] (-995.331) (-998.021) -- 0:00:24
594000 -- [-997.102] (-995.010) (-995.587) (-995.488) * (-995.252) (-996.164) (-995.507) [-994.468] -- 0:00:24
594500 -- (-994.835) (-995.172) [-993.937] (-994.023) * (-995.782) (-994.865) [-996.125] (-993.793) -- 0:00:24
595000 -- (-997.158) (-995.051) (-1004.696) [-996.701] * (-994.496) (-994.904) [-995.018] (-993.891) -- 0:00:24
Average standard deviation of split frequencies: 0.008305
595500 -- (-997.016) (-997.575) (-1001.954) [-996.502] * [-996.706] (-995.457) (-994.403) (-998.683) -- 0:00:24
596000 -- (-999.358) (-1000.962) (-995.990) [-996.650] * (-997.196) (-995.412) [-996.018] (-998.368) -- 0:00:24
596500 -- (-996.236) (-1002.635) (-997.906) [-996.217] * (-995.207) (-995.041) [-996.577] (-994.254) -- 0:00:24
597000 -- [-996.549] (-995.831) (-998.144) (-995.440) * (-995.106) (-999.237) (-998.831) [-995.640] -- 0:00:24
597500 -- (-997.507) (-995.107) [-994.064] (-997.324) * (-998.681) [-996.338] (-995.394) (-999.034) -- 0:00:24
598000 -- (-996.170) (-995.526) [-994.820] (-996.464) * [-1002.920] (-996.481) (-995.107) (-995.965) -- 0:00:24
598500 -- [-995.145] (-997.026) (-994.490) (-1001.040) * (-998.748) [-1000.137] (-995.525) (-997.447) -- 0:00:24
599000 -- [-995.062] (-994.528) (-993.609) (-996.855) * (-997.234) [-995.504] (-995.439) (-996.831) -- 0:00:24
599500 -- [-995.160] (-996.681) (-998.053) (-996.231) * (-995.829) (-995.643) [-996.861] (-998.333) -- 0:00:24
600000 -- (-1000.159) [-995.690] (-998.774) (-994.160) * [-997.894] (-995.385) (-994.154) (-996.302) -- 0:00:24
Average standard deviation of split frequencies: 0.008780
600500 -- (-1000.776) [-994.999] (-994.708) (-997.537) * (-995.396) (-997.027) (-996.496) [-996.057] -- 0:00:24
601000 -- (-995.386) [-996.610] (-997.221) (-994.655) * (-995.664) [-995.418] (-997.292) (-996.733) -- 0:00:24
601500 -- (-993.809) (-996.251) [-996.292] (-997.146) * [-998.776] (-995.700) (-999.216) (-995.918) -- 0:00:24
602000 -- (-997.743) (-998.895) [-995.181] (-996.030) * (-998.366) [-1001.128] (-994.032) (-997.100) -- 0:00:24
602500 -- [-994.917] (-998.551) (-995.562) (-1003.632) * (-993.475) (-1001.701) (-996.235) [-995.994] -- 0:00:24
603000 -- (-998.897) (-999.028) [-996.494] (-1001.008) * (-995.928) (-994.278) [-1000.697] (-995.891) -- 0:00:24
603500 -- (-995.984) (-997.390) (-997.387) [-994.973] * [-995.205] (-997.341) (-995.929) (-995.281) -- 0:00:24
604000 -- (-994.406) (-996.579) [-995.099] (-995.041) * (-996.551) (-999.423) [-996.660] (-994.597) -- 0:00:24
604500 -- [-995.215] (-995.138) (-1001.238) (-994.681) * (-994.491) [-994.516] (-995.087) (-994.950) -- 0:00:24
605000 -- (-995.612) [-995.610] (-994.702) (-996.725) * (-994.163) (-996.248) [-995.268] (-994.840) -- 0:00:24
Average standard deviation of split frequencies: 0.008654
605500 -- (-994.020) (-995.822) (-994.672) [-996.590] * [-995.015] (-994.500) (-996.591) (-995.403) -- 0:00:24
606000 -- [-995.072] (-995.466) (-1000.762) (-998.380) * (-993.878) [-996.513] (-1005.847) (-996.096) -- 0:00:24
606500 -- (-993.684) (-996.115) [-998.403] (-994.656) * (-995.075) (-996.163) [-999.511] (-996.535) -- 0:00:24
607000 -- (-993.986) (-1001.707) (-999.497) [-996.216] * (-996.646) (-996.042) (-996.748) [-994.974] -- 0:00:23
607500 -- (-995.549) (-998.824) [-996.049] (-994.244) * (-995.869) (-998.896) [-995.351] (-995.578) -- 0:00:23
608000 -- [-996.982] (-995.103) (-996.229) (-996.462) * (-995.256) [-995.226] (-997.421) (-995.773) -- 0:00:23
608500 -- (-996.594) [-995.126] (-995.179) (-995.697) * [-994.158] (-999.830) (-993.756) (-997.473) -- 0:00:23
609000 -- (-995.173) (-1002.886) (-994.370) [-997.681] * (-994.089) (-995.626) [-995.124] (-994.634) -- 0:00:23
609500 -- (-995.693) (-996.720) [-994.659] (-997.462) * (-994.760) [-994.977] (-996.432) (-995.063) -- 0:00:23
610000 -- (-995.482) (-995.750) (-996.129) [-995.558] * (-997.420) [-994.578] (-1001.569) (-996.896) -- 0:00:23
Average standard deviation of split frequencies: 0.008183
610500 -- (-999.245) [-997.115] (-994.998) (-995.565) * (-1000.915) (-998.270) [-997.365] (-996.661) -- 0:00:23
611000 -- [-996.473] (-995.508) (-995.127) (-996.752) * (-1000.773) (-997.822) (-995.279) [-996.907] -- 0:00:23
611500 -- (-994.091) [-994.666] (-994.991) (-996.647) * (-995.587) (-997.949) (-997.493) [-995.444] -- 0:00:23
612000 -- (-999.946) [-999.926] (-998.657) (-995.268) * (-996.352) (-996.506) (-999.130) [-995.927] -- 0:00:23
612500 -- [-994.743] (-995.513) (-995.692) (-994.591) * [-994.004] (-996.065) (-996.020) (-998.874) -- 0:00:23
613000 -- [-994.906] (-994.342) (-994.517) (-993.615) * (-994.262) (-994.702) [-995.046] (-1003.915) -- 0:00:23
613500 -- (-994.925) [-997.108] (-996.070) (-1001.356) * [-1000.278] (-994.827) (-997.189) (-1001.134) -- 0:00:23
614000 -- (-994.371) (-997.050) (-997.624) [-995.443] * (-996.501) [-995.007] (-995.461) (-995.019) -- 0:00:23
614500 -- [-994.607] (-995.857) (-999.501) (-997.396) * [-998.431] (-998.231) (-999.427) (-995.320) -- 0:00:23
615000 -- (-995.126) (-996.450) [-999.039] (-994.090) * [-994.775] (-999.757) (-997.292) (-995.680) -- 0:00:23
Average standard deviation of split frequencies: 0.007398
615500 -- (-996.780) [-994.492] (-994.282) (-993.739) * (-995.740) (-997.597) [-995.093] (-997.836) -- 0:00:23
616000 -- (-995.180) (-994.412) [-997.200] (-996.434) * (-998.126) (-995.460) [-996.322] (-997.422) -- 0:00:23
616500 -- [-994.579] (-996.123) (-996.868) (-995.654) * (-994.775) [-994.521] (-995.177) (-995.217) -- 0:00:23
617000 -- [-994.831] (-995.930) (-996.931) (-994.797) * (-998.420) [-996.446] (-994.218) (-999.062) -- 0:00:23
617500 -- (-995.903) (-997.342) (-994.849) [-996.321] * (-995.629) (-998.377) [-995.492] (-996.791) -- 0:00:23
618000 -- (-996.844) (-1001.717) [-993.882] (-996.200) * (-1004.640) (-996.071) [-995.566] (-995.677) -- 0:00:23
618500 -- (-995.985) (-1002.027) (-994.299) [-994.607] * (-996.060) (-995.744) [-995.613] (-994.799) -- 0:00:23
619000 -- (-995.278) [-997.258] (-995.325) (-993.606) * (-994.586) [-993.636] (-997.653) (-995.026) -- 0:00:23
619500 -- (-995.725) [-995.621] (-995.580) (-997.812) * (-994.919) [-995.040] (-997.196) (-995.463) -- 0:00:23
620000 -- [-996.257] (-994.133) (-995.600) (-996.379) * [-995.756] (-996.414) (-997.096) (-996.053) -- 0:00:23
Average standard deviation of split frequencies: 0.007089
620500 -- (-994.112) (-993.909) [-996.063] (-996.192) * [-993.983] (-996.477) (-997.654) (-995.947) -- 0:00:23
621000 -- (-994.672) [-998.010] (-999.038) (-1000.583) * (-994.428) (-994.605) (-995.162) [-998.386] -- 0:00:23
621500 -- [-996.631] (-994.858) (-996.093) (-997.784) * (-999.303) (-996.346) (-995.867) [-995.380] -- 0:00:23
622000 -- (-993.584) (-996.492) (-999.595) [-996.865] * (-997.865) (-996.293) (-996.889) [-995.867] -- 0:00:23
622500 -- (-994.490) (-994.628) (-999.573) [-994.336] * (-997.885) (-997.569) [-993.796] (-996.109) -- 0:00:23
623000 -- (-993.975) (-995.057) (-994.508) [-996.771] * (-994.809) [-997.050] (-994.236) (-998.177) -- 0:00:22
623500 -- (-995.606) (-996.835) (-996.763) [-994.370] * (-994.879) (-996.725) [-997.948] (-995.301) -- 0:00:22
624000 -- (-994.522) [-996.707] (-995.661) (-996.158) * (-998.335) [-995.586] (-994.487) (-995.609) -- 0:00:22
624500 -- (-994.192) [-996.863] (-996.787) (-999.456) * (-997.647) (-996.811) (-993.879) [-996.966] -- 0:00:22
625000 -- (-997.801) [-996.502] (-994.988) (-999.715) * (-997.272) [-994.844] (-994.046) (-995.758) -- 0:00:22
Average standard deviation of split frequencies: 0.007380
625500 -- [-997.351] (-995.258) (-995.816) (-994.266) * (-999.540) (-995.148) [-993.903] (-994.667) -- 0:00:22
626000 -- (-994.735) [-993.974] (-998.345) (-995.014) * (-996.807) [-993.703] (-993.774) (-995.211) -- 0:00:22
626500 -- (-1000.831) [-995.160] (-997.155) (-999.777) * (-994.329) (-998.210) [-999.530] (-995.559) -- 0:00:22
627000 -- [-996.468] (-994.762) (-995.849) (-998.308) * (-1000.782) (-998.024) (-998.370) [-997.413] -- 0:00:22
627500 -- (-996.216) (-995.891) (-996.102) [-994.960] * [-996.883] (-996.024) (-997.130) (-996.919) -- 0:00:22
628000 -- (-994.705) (-995.103) (-995.118) [-997.134] * (-996.147) (-995.022) [-997.888] (-993.711) -- 0:00:22
628500 -- (-994.870) [-994.544] (-996.054) (-995.306) * (-993.632) (-994.083) [-995.499] (-995.778) -- 0:00:22
629000 -- (-995.750) (-994.544) [-999.311] (-994.409) * (-994.079) [-993.644] (-995.900) (-995.609) -- 0:00:22
629500 -- (-998.149) (-994.544) (-994.276) [-994.668] * (-994.081) (-993.737) [-997.157] (-998.108) -- 0:00:22
630000 -- (-995.289) (-994.984) [-994.300] (-996.712) * (-994.060) (-994.145) (-997.363) [-997.697] -- 0:00:22
Average standard deviation of split frequencies: 0.007674
630500 -- (-999.263) (-1000.850) (-994.283) [-998.983] * (-995.802) (-994.730) [-994.332] (-996.848) -- 0:00:22
631000 -- (-994.245) (-998.196) (-999.281) [-994.099] * [-996.113] (-996.731) (-993.984) (-996.013) -- 0:00:22
631500 -- [-996.305] (-1000.237) (-995.029) (-997.627) * [-995.585] (-994.681) (-994.078) (-999.082) -- 0:00:22
632000 -- [-996.502] (-995.794) (-996.658) (-994.082) * (-996.938) (-997.129) [-995.924] (-996.957) -- 0:00:22
632500 -- (-997.944) (-999.809) [-1000.523] (-996.714) * (-994.893) [-995.992] (-996.586) (-996.425) -- 0:00:22
633000 -- (-995.599) (-995.053) [-996.253] (-996.564) * (-1000.123) (-995.093) (-996.463) [-997.649] -- 0:00:22
633500 -- (-997.505) (-995.037) (-996.070) [-994.000] * (-995.682) (-1001.007) (-995.824) [-998.472] -- 0:00:22
634000 -- (-996.643) (-997.110) [-995.112] (-994.383) * [-995.578] (-999.054) (-996.414) (-998.197) -- 0:00:22
634500 -- (-1000.571) (-997.358) (-999.268) [-995.950] * (-996.078) [-995.219] (-998.417) (-994.589) -- 0:00:22
635000 -- (-995.204) (-994.196) (-1000.138) [-994.305] * (-994.303) (-999.263) (-995.183) [-995.058] -- 0:00:22
Average standard deviation of split frequencies: 0.008339
635500 -- (-998.486) [-994.338] (-998.100) (-994.071) * (-995.420) (-997.973) (-996.787) [-994.534] -- 0:00:22
636000 -- (-1001.837) [-996.841] (-996.708) (-995.104) * (-996.368) (-996.142) (-997.684) [-994.733] -- 0:00:22
636500 -- [-999.348] (-996.449) (-995.130) (-997.140) * (-995.947) (-996.878) (-995.738) [-994.884] -- 0:00:22
637000 -- (-997.548) [-998.423] (-995.412) (-995.909) * (-995.680) [-994.338] (-994.156) (-993.972) -- 0:00:22
637500 -- (-997.536) [-995.320] (-994.920) (-994.677) * (-995.999) (-998.597) [-994.853] (-994.254) -- 0:00:22
638000 -- (-996.381) [-994.795] (-994.947) (-995.896) * (-994.995) (-995.970) (-994.601) [-994.212] -- 0:00:22
638500 -- (-999.170) (-994.738) [-994.385] (-997.259) * (-996.891) (-995.512) [-995.992] (-995.817) -- 0:00:22
639000 -- (-997.516) (-995.193) [-996.432] (-995.763) * (-993.836) (-996.927) [-996.452] (-996.725) -- 0:00:22
639500 -- (-998.305) (-997.718) (-995.462) [-994.278] * [-994.438] (-998.154) (-997.136) (-998.355) -- 0:00:21
640000 -- (-997.681) (-995.835) (-995.429) [-995.655] * (-995.861) [-994.686] (-996.609) (-995.596) -- 0:00:21
Average standard deviation of split frequencies: 0.008692
640500 -- (-995.443) (-995.106) (-997.602) [-995.384] * (-994.197) [-996.232] (-994.692) (-998.930) -- 0:00:21
641000 -- (-994.903) (-994.131) (-994.586) [-995.340] * [-996.775] (-995.663) (-996.698) (-997.009) -- 0:00:21
641500 -- (-994.596) [-995.621] (-995.782) (-994.148) * (-997.054) (-995.465) [-996.393] (-998.522) -- 0:00:21
642000 -- (-995.935) [-994.430] (-994.713) (-997.390) * (-994.752) (-995.058) (-994.018) [-998.192] -- 0:00:21
642500 -- (-995.743) (-994.342) [-996.593] (-995.384) * (-994.753) [-994.490] (-998.335) (-997.597) -- 0:00:21
643000 -- (-996.195) (-994.702) (-997.725) [-995.946] * (-1002.055) (-996.420) [-997.694] (-997.477) -- 0:00:21
643500 -- [-997.046] (-995.719) (-998.292) (-1001.269) * (-996.786) (-1000.705) (-993.922) [-994.195] -- 0:00:21
644000 -- (-998.256) [-997.734] (-998.837) (-995.275) * (-994.593) (-999.186) [-994.802] (-995.242) -- 0:00:21
644500 -- [-993.966] (-999.009) (-994.766) (-1001.256) * [-994.616] (-996.991) (-993.991) (-995.515) -- 0:00:21
645000 -- [-998.883] (-995.858) (-994.543) (-998.110) * (-994.325) (-995.965) [-994.536] (-994.884) -- 0:00:21
Average standard deviation of split frequencies: 0.008620
645500 -- [-998.652] (-998.161) (-994.489) (-995.067) * (-993.902) (-996.037) (-997.136) [-994.162] -- 0:00:21
646000 -- (-995.201) [-997.509] (-994.243) (-994.519) * [-993.654] (-995.971) (-995.655) (-993.934) -- 0:00:21
646500 -- (-996.882) (-997.621) [-995.937] (-995.333) * (-993.760) [-994.308] (-999.705) (-995.798) -- 0:00:21
647000 -- (-1004.136) (-998.203) [-996.234] (-994.958) * (-993.780) (-996.186) [-995.714] (-1001.695) -- 0:00:21
647500 -- (-999.344) (-998.004) (-996.963) [-995.959] * (-996.083) (-998.537) (-998.009) [-994.325] -- 0:00:21
648000 -- [-998.680] (-997.561) (-999.548) (-995.655) * (-996.977) (-994.582) (-995.756) [-994.689] -- 0:00:21
648500 -- (-1003.146) (-996.860) (-996.103) [-995.565] * [-996.775] (-995.978) (-995.189) (-995.773) -- 0:00:21
649000 -- (-994.273) [-997.026] (-997.205) (-997.507) * [-996.616] (-995.152) (-995.305) (-996.282) -- 0:00:21
649500 -- [-995.698] (-994.602) (-995.275) (-997.744) * (-996.339) (-994.723) [-997.493] (-996.366) -- 0:00:21
650000 -- (-998.420) [-995.740] (-997.604) (-996.005) * [-995.100] (-993.910) (-996.508) (-995.780) -- 0:00:21
Average standard deviation of split frequencies: 0.008784
650500 -- (-996.451) [-995.181] (-996.248) (-997.453) * [-995.247] (-995.361) (-995.016) (-997.895) -- 0:00:21
651000 -- (-994.906) [-994.310] (-995.842) (-995.049) * [-995.131] (-995.762) (-996.741) (-994.610) -- 0:00:21
651500 -- [-995.273] (-997.395) (-997.832) (-995.730) * (-995.118) [-994.838] (-995.915) (-995.569) -- 0:00:21
652000 -- (-995.342) [-994.212] (-996.281) (-994.301) * (-996.173) (-995.535) (-995.351) [-995.883] -- 0:00:21
652500 -- (-1001.946) (-998.063) (-997.867) [-995.278] * [-1001.444] (-994.321) (-995.374) (-996.865) -- 0:00:21
653000 -- (-994.077) (-996.251) (-999.074) [-994.409] * [-995.518] (-995.287) (-994.501) (-998.290) -- 0:00:21
653500 -- [-993.765] (-994.211) (-999.085) (-994.695) * [-994.777] (-997.361) (-993.969) (-995.571) -- 0:00:21
654000 -- (-994.036) (-995.822) [-998.141] (-994.857) * (-996.615) [-996.635] (-994.329) (-994.354) -- 0:00:21
654500 -- (-996.164) (-996.795) [-996.767] (-995.287) * [-994.524] (-999.162) (-995.563) (-994.120) -- 0:00:21
655000 -- (-994.954) (-996.221) (-996.468) [-995.307] * [-998.558] (-996.854) (-994.952) (-996.113) -- 0:00:21
Average standard deviation of split frequencies: 0.008893
655500 -- [-996.437] (-997.888) (-997.432) (-995.802) * (-1004.606) (-998.191) [-994.688] (-993.998) -- 0:00:21
656000 -- (-998.138) (-995.913) (-996.310) [-995.532] * (-996.167) (-997.425) (-999.458) [-995.470] -- 0:00:20
656500 -- (-994.843) (-996.027) (-995.576) [-995.183] * (-997.237) (-996.553) [-999.441] (-995.280) -- 0:00:20
657000 -- (-995.974) (-994.067) (-995.725) [-994.273] * (-996.183) [-996.585] (-1000.202) (-998.707) -- 0:00:20
657500 -- (-994.274) [-995.646] (-994.985) (-997.640) * [-994.699] (-994.431) (-996.346) (-995.076) -- 0:00:20
658000 -- (-1001.369) [-1001.748] (-996.583) (-995.444) * (-996.528) (-998.982) (-997.205) [-996.733] -- 0:00:20
658500 -- (-996.428) [-996.740] (-998.027) (-995.311) * (-996.181) (-998.967) [-997.662] (-1002.112) -- 0:00:20
659000 -- (-995.933) (-998.583) (-997.384) [-996.815] * (-994.618) (-995.411) (-996.965) [-1002.261] -- 0:00:20
659500 -- (-999.559) [-995.279] (-997.180) (-998.205) * [-994.832] (-995.244) (-997.515) (-1000.522) -- 0:00:20
660000 -- [-994.153] (-995.438) (-1000.249) (-995.647) * (-996.079) [-994.437] (-998.501) (-995.014) -- 0:00:20
Average standard deviation of split frequencies: 0.008607
660500 -- [-1000.001] (-996.453) (-1002.681) (-994.857) * (-995.348) [-996.273] (-996.820) (-993.658) -- 0:00:20
661000 -- [-995.918] (-999.870) (-996.382) (-994.769) * (-994.126) [-994.627] (-997.303) (-999.179) -- 0:00:20
661500 -- (-997.999) (-994.275) (-995.923) [-994.397] * (-995.335) (-994.998) [-996.215] (-995.885) -- 0:00:20
662000 -- (-995.413) (-996.635) [-996.823] (-995.660) * (-995.451) (-995.000) (-997.722) [-999.473] -- 0:00:20
662500 -- (-995.984) (-996.086) (-997.957) [-997.444] * (-994.010) (-997.714) (-994.125) [-994.499] -- 0:00:20
663000 -- (-996.449) [-997.796] (-994.963) (-999.039) * (-997.089) [-995.222] (-995.527) (-994.741) -- 0:00:20
663500 -- (-1000.114) (-998.303) [-993.629] (-996.282) * (-999.469) [-995.810] (-996.583) (-994.636) -- 0:00:20
664000 -- (-997.642) [-997.696] (-994.683) (-994.253) * (-996.764) (-996.432) (-999.107) [-995.700] -- 0:00:20
664500 -- (-996.960) [-995.895] (-997.562) (-995.676) * (-994.081) (-999.582) (-997.887) [-995.670] -- 0:00:20
665000 -- (-994.364) (-995.995) (-995.611) [-995.577] * (-997.400) [-995.069] (-998.651) (-996.080) -- 0:00:20
Average standard deviation of split frequencies: 0.008538
665500 -- [-994.621] (-994.741) (-996.908) (-997.106) * (-999.439) (-996.319) (-996.454) [-994.180] -- 0:00:20
666000 -- (-993.908) (-997.421) [-995.120] (-995.206) * (-998.175) [-999.008] (-997.112) (-996.617) -- 0:00:20
666500 -- (-993.834) (-995.187) (-998.743) [-997.962] * (-998.119) [-997.194] (-996.094) (-996.722) -- 0:00:20
667000 -- (-996.031) (-994.862) [-994.140] (-995.689) * (-995.792) (-994.205) (-996.758) [-994.138] -- 0:00:20
667500 -- (-995.658) (-995.946) (-995.843) [-995.486] * (-996.980) [-995.856] (-997.826) (-995.901) -- 0:00:20
668000 -- (-995.479) (-1000.648) (-996.897) [-996.223] * (-995.743) [-996.046] (-997.598) (-996.146) -- 0:00:20
668500 -- (-993.944) (-994.564) [-994.443] (-996.132) * [-997.671] (-999.715) (-1001.965) (-994.949) -- 0:00:20
669000 -- (-994.275) [-995.469] (-995.550) (-999.005) * (-996.147) [-998.106] (-999.920) (-998.219) -- 0:00:20
669500 -- [-993.915] (-994.808) (-1000.007) (-994.970) * [-995.641] (-997.295) (-999.062) (-999.163) -- 0:00:20
670000 -- [-993.587] (-995.754) (-999.444) (-994.963) * (-997.893) (-993.824) (-997.936) [-1001.496] -- 0:00:20
Average standard deviation of split frequencies: 0.008523
670500 -- (-995.134) (-994.362) [-997.672] (-996.754) * (-995.775) [-995.020] (-998.045) (-996.223) -- 0:00:20
671000 -- (-994.035) (-994.548) (-996.763) [-995.497] * (-998.242) (-995.339) [-995.252] (-996.036) -- 0:00:20
671500 -- (-997.292) (-994.039) (-994.597) [-995.064] * (-996.483) (-995.484) [-995.223] (-994.983) -- 0:00:20
672000 -- [-996.010] (-995.618) (-993.871) (-995.799) * (-996.453) [-994.669] (-997.869) (-995.777) -- 0:00:20
672500 -- (-996.248) [-993.777] (-994.117) (-996.931) * (-997.815) (-994.192) [-997.096] (-996.670) -- 0:00:19
673000 -- (-1000.203) [-994.558] (-995.496) (-995.175) * (-995.925) (-993.736) [-995.742] (-995.200) -- 0:00:19
673500 -- (-996.414) (-995.417) (-996.321) [-997.730] * (-995.513) (-993.984) (-994.808) [-997.130] -- 0:00:19
674000 -- [-994.274] (-996.453) (-996.979) (-995.689) * (-994.263) (-996.947) (-995.568) [-995.175] -- 0:00:19
674500 -- (-993.898) [-995.724] (-993.803) (-996.647) * (-996.992) (-997.191) [-996.399] (-995.679) -- 0:00:19
675000 -- (-1000.424) [-994.383] (-997.505) (-997.454) * (-994.375) [-995.041] (-997.715) (-997.288) -- 0:00:19
Average standard deviation of split frequencies: 0.007758
675500 -- (-996.308) [-995.523] (-994.597) (-995.524) * (-998.371) (-995.511) [-998.193] (-995.889) -- 0:00:19
676000 -- (-996.610) (-995.687) [-997.816] (-997.106) * (-997.624) (-997.814) (-998.539) [-996.638] -- 0:00:19
676500 -- (-998.386) (-997.648) (-996.085) [-996.718] * (-995.731) [-994.446] (-995.617) (-999.111) -- 0:00:19
677000 -- (-999.158) (-998.866) [-995.220] (-994.262) * (-996.611) [-993.513] (-996.650) (-1003.520) -- 0:00:19
677500 -- [-995.037] (-998.524) (-996.243) (-996.797) * (-995.096) (-998.368) [-995.325] (-998.244) -- 0:00:19
678000 -- (-997.621) (-996.144) (-996.859) [-995.416] * [-995.027] (-996.821) (-995.641) (-995.351) -- 0:00:19
678500 -- [-996.784] (-995.062) (-995.608) (-995.178) * [-995.659] (-1000.435) (-994.811) (-997.398) -- 0:00:19
679000 -- (-995.532) (-1000.133) [-998.460] (-995.352) * (-996.673) (-997.315) (-996.439) [-996.029] -- 0:00:19
679500 -- (-994.813) (-996.084) (-996.238) [-993.857] * (-997.300) (-997.382) (-999.336) [-1001.410] -- 0:00:19
680000 -- (-994.588) (-996.004) [-995.058] (-998.415) * (-997.103) (-997.613) [-994.545] (-998.069) -- 0:00:19
Average standard deviation of split frequencies: 0.007618
680500 -- (-995.770) (-1002.350) (-996.772) [-995.308] * (-998.385) (-995.943) [-996.169] (-995.709) -- 0:00:19
681000 -- (-996.267) [-997.302] (-994.711) (-994.745) * (-994.059) (-996.468) (-996.384) [-996.503] -- 0:00:19
681500 -- (-997.076) (-999.314) [-995.283] (-996.175) * (-995.175) (-999.719) (-997.392) [-994.900] -- 0:00:19
682000 -- [-995.301] (-993.777) (-996.754) (-995.727) * (-995.359) (-995.490) [-994.897] (-994.709) -- 0:00:19
682500 -- (-996.096) [-993.937] (-994.181) (-995.346) * [-995.694] (-1001.076) (-996.046) (-994.750) -- 0:00:19
683000 -- (-995.825) [-993.980] (-997.871) (-994.775) * (-997.747) (-998.098) [-996.723] (-995.325) -- 0:00:19
683500 -- (-995.094) (-993.943) (-993.635) [-994.732] * (-997.254) (-996.366) [-999.967] (-993.644) -- 0:00:19
684000 -- [-996.195] (-994.507) (-997.589) (-996.540) * [-998.748] (-994.647) (-995.996) (-994.989) -- 0:00:19
684500 -- (-995.993) (-993.894) (-996.818) [-995.125] * [-994.283] (-995.109) (-997.196) (-997.670) -- 0:00:19
685000 -- (-995.481) (-993.570) (-996.969) [-993.747] * (-997.986) (-995.526) [-996.410] (-994.869) -- 0:00:19
Average standard deviation of split frequencies: 0.007731
685500 -- (-1000.702) (-997.521) (-994.108) [-995.692] * [-997.761] (-997.292) (-994.795) (-995.223) -- 0:00:19
686000 -- [-997.689] (-998.388) (-994.213) (-997.537) * (-994.659) (-995.739) (-996.134) [-997.369] -- 0:00:19
686500 -- (-997.001) [-999.198] (-994.682) (-998.803) * (-996.257) [-995.556] (-995.777) (-996.526) -- 0:00:19
687000 -- (-997.220) [-997.329] (-994.494) (-999.813) * [-1002.394] (-1001.059) (-997.992) (-998.684) -- 0:00:19
687500 -- (-994.656) (-1001.416) [-997.855] (-993.973) * (-997.315) (-994.792) [-995.955] (-995.802) -- 0:00:19
688000 -- (-994.729) (-1001.630) (-996.635) [-997.904] * [-997.721] (-994.792) (-995.727) (-996.244) -- 0:00:19
688500 -- (-994.628) (-1000.437) [-995.808] (-996.726) * (-1000.477) [-995.038] (-996.965) (-995.041) -- 0:00:19
689000 -- [-994.757] (-997.787) (-994.349) (-1000.651) * (-998.466) [-999.804] (-1001.091) (-995.441) -- 0:00:18
689500 -- [-995.841] (-996.106) (-995.343) (-995.874) * (-999.046) (-997.858) (-996.507) [-998.112] -- 0:00:18
690000 -- (-995.585) (-996.111) [-996.022] (-1000.112) * [-995.392] (-993.766) (-994.276) (-996.207) -- 0:00:18
Average standard deviation of split frequencies: 0.007337
690500 -- (-996.225) (-995.860) [-995.007] (-1000.941) * [-1000.875] (-994.590) (-996.283) (-997.039) -- 0:00:18
691000 -- (-994.808) (-996.255) (-994.027) [-997.435] * (-994.373) (-994.995) (-997.262) [-996.278] -- 0:00:18
691500 -- (-996.380) (-998.474) (-994.617) [-997.017] * [-994.477] (-994.805) (-996.778) (-997.678) -- 0:00:18
692000 -- (-995.946) (-997.092) (-994.849) [-995.762] * (-995.034) (-996.201) (-1001.077) [-994.201] -- 0:00:18
692500 -- (-995.674) (-999.367) (-996.960) [-994.288] * (-999.490) [-995.598] (-997.142) (-994.098) -- 0:00:18
693000 -- (-994.746) (-997.291) (-997.137) [-995.514] * (-999.457) (-994.499) (-998.417) [-994.314] -- 0:00:18
693500 -- (-995.793) (-994.968) (-997.589) [-994.568] * (-995.373) [-995.638] (-996.395) (-996.046) -- 0:00:18
694000 -- (-997.329) [-994.923] (-1002.023) (-995.581) * (-996.496) (-999.755) (-995.626) [-996.207] -- 0:00:18
694500 -- (-1000.804) [-999.722] (-995.510) (-994.028) * (-996.262) (-995.286) [-995.008] (-995.519) -- 0:00:18
695000 -- (-997.539) [-995.087] (-994.838) (-996.241) * (-993.882) (-999.819) (-994.730) [-994.672] -- 0:00:18
Average standard deviation of split frequencies: 0.007493
695500 -- [-996.365] (-994.955) (-995.741) (-998.045) * (-993.979) (-997.243) [-994.445] (-996.509) -- 0:00:18
696000 -- (-995.993) [-995.404] (-999.553) (-995.174) * (-995.261) [-995.041] (-997.335) (-997.719) -- 0:00:18
696500 -- (-995.368) [-995.898] (-996.332) (-994.936) * [-995.256] (-995.522) (-994.363) (-996.414) -- 0:00:18
697000 -- [-994.723] (-1002.253) (-997.409) (-996.615) * (-995.308) [-999.198] (-994.290) (-996.057) -- 0:00:18
697500 -- [-995.980] (-995.132) (-997.238) (-994.769) * (-994.986) [-994.575] (-996.412) (-995.046) -- 0:00:18
698000 -- (-994.035) (-996.310) [-998.064] (-994.326) * (-996.735) (-995.420) [-995.465] (-999.020) -- 0:00:18
698500 -- (-994.600) (-997.522) [-996.779] (-993.866) * (-995.618) (-997.371) [-997.030] (-995.386) -- 0:00:18
699000 -- (-997.859) (-995.207) [-994.186] (-994.898) * (-998.671) (-999.392) (-996.100) [-995.348] -- 0:00:18
699500 -- (-997.009) (-996.814) (-994.113) [-995.940] * [-995.244] (-994.374) (-995.217) (-994.827) -- 0:00:18
700000 -- (-994.352) [-999.094] (-996.249) (-995.697) * (-996.917) (-999.345) (-998.672) [-993.910] -- 0:00:18
Average standard deviation of split frequencies: 0.007569
700500 -- (-993.594) [-997.061] (-997.559) (-995.223) * (-994.855) (-995.755) (-1000.401) [-995.873] -- 0:00:18
701000 -- (-996.192) (-997.516) [-997.714] (-996.445) * [-995.404] (-997.319) (-997.658) (-995.607) -- 0:00:18
701500 -- (-998.621) [-997.256] (-997.504) (-996.010) * [-995.654] (-994.450) (-994.988) (-993.852) -- 0:00:18
702000 -- (-1000.518) (-996.860) (-996.249) [-997.060] * (-995.829) (-996.193) (-996.279) [-995.144] -- 0:00:18
702500 -- (-997.932) (-994.987) (-995.465) [-996.948] * [-995.104] (-997.429) (-996.462) (-995.325) -- 0:00:18
703000 -- [-996.067] (-995.846) (-995.583) (-998.579) * [-997.013] (-998.143) (-994.814) (-996.747) -- 0:00:18
703500 -- (-994.033) (-997.015) (-997.014) [-998.740] * (-999.791) (-998.751) [-994.171] (-997.096) -- 0:00:18
704000 -- [-995.925] (-997.294) (-996.799) (-998.906) * (-997.203) [-999.309] (-994.921) (-996.016) -- 0:00:18
704500 -- (-997.288) (-1000.057) [-995.005] (-999.589) * (-1000.856) [-997.492] (-994.092) (-995.253) -- 0:00:18
705000 -- (-996.284) (-1000.173) [-994.564] (-1002.798) * (-997.236) (-995.631) [-994.127] (-996.005) -- 0:00:17
Average standard deviation of split frequencies: 0.007345
705500 -- (-996.370) [-994.485] (-998.436) (-995.957) * [-995.298] (-997.591) (-994.782) (-995.999) -- 0:00:17
706000 -- (-997.493) (-1001.332) (-997.316) [-998.882] * (-993.669) [-994.646] (-993.719) (-994.493) -- 0:00:17
706500 -- (-997.470) (-997.438) (-998.895) [-997.213] * [-996.123] (-997.371) (-993.993) (-998.452) -- 0:00:17
707000 -- (-999.108) [-996.743] (-998.041) (-994.421) * (-996.240) (-994.890) [-995.100] (-995.795) -- 0:00:17
707500 -- [-995.139] (-997.682) (-996.485) (-997.177) * (-994.541) (-994.388) (-995.058) [-994.954] -- 0:00:17
708000 -- (-996.884) [-998.250] (-997.033) (-995.428) * (-994.358) [-996.794] (-994.905) (-994.830) -- 0:00:17
708500 -- (-997.142) (-996.813) [-994.374] (-999.336) * [-994.778] (-997.647) (-994.909) (-998.166) -- 0:00:17
709000 -- (-999.052) (-997.135) [-994.630] (-995.219) * (-994.543) (-994.485) (-996.036) [-995.304] -- 0:00:17
709500 -- [-994.564] (-996.741) (-997.153) (-995.612) * (-994.316) [-995.576] (-995.703) (-994.999) -- 0:00:17
710000 -- [-997.432] (-997.200) (-994.991) (-995.056) * (-996.828) (-997.953) (-995.600) [-995.987] -- 0:00:17
Average standard deviation of split frequencies: 0.007048
710500 -- [-995.878] (-996.466) (-997.665) (-995.217) * (-993.860) (-994.496) (-998.486) [-994.387] -- 0:00:17
711000 -- (-998.915) (-995.505) (-994.092) [-997.629] * (-994.948) (-993.864) (-996.038) [-993.827] -- 0:00:17
711500 -- (-997.024) (-999.155) [-993.473] (-996.670) * (-994.243) [-994.465] (-995.451) (-994.758) -- 0:00:17
712000 -- [-995.592] (-997.148) (-994.043) (-994.824) * (-995.679) [-994.074] (-996.209) (-995.257) -- 0:00:17
712500 -- [-994.868] (-996.735) (-1000.343) (-996.614) * (-996.848) (-998.959) [-994.541] (-994.609) -- 0:00:17
713000 -- [-997.661] (-996.853) (-996.787) (-995.395) * (-997.792) (-996.699) (-994.469) [-994.069] -- 0:00:17
713500 -- [-994.816] (-997.252) (-999.027) (-994.087) * (-995.485) (-997.417) (-997.110) [-994.766] -- 0:00:17
714000 -- (-997.420) (-996.750) (-997.955) [-995.325] * (-994.788) [-998.606] (-995.952) (-995.456) -- 0:00:17
714500 -- (-995.803) [-1000.288] (-997.497) (-999.370) * (-995.505) (-995.720) (-997.732) [-995.851] -- 0:00:17
715000 -- (-996.525) [-998.441] (-999.988) (-998.375) * [-995.112] (-996.211) (-996.321) (-997.981) -- 0:00:17
Average standard deviation of split frequencies: 0.007160
715500 -- (-996.249) [-994.825] (-995.291) (-997.424) * (-993.967) (-1000.524) [-996.497] (-996.753) -- 0:00:17
716000 -- (-996.142) (-998.921) [-996.648] (-998.253) * [-994.676] (-1000.794) (-996.852) (-993.894) -- 0:00:17
716500 -- (-994.006) (-995.299) (-996.890) [-995.254] * [-995.196] (-995.251) (-994.207) (-996.758) -- 0:00:17
717000 -- (-997.254) (-994.706) [-999.279] (-994.068) * (-994.777) [-997.322] (-994.973) (-994.534) -- 0:00:17
717500 -- [-995.595] (-995.755) (-998.580) (-995.891) * (-996.786) [-996.486] (-994.596) (-995.226) -- 0:00:17
718000 -- [-993.993] (-999.277) (-996.240) (-995.474) * [-998.854] (-994.243) (-996.592) (-995.811) -- 0:00:17
718500 -- (-997.156) [-995.876] (-994.608) (-994.175) * (-1000.489) [-996.024] (-996.442) (-995.527) -- 0:00:17
719000 -- [-997.849] (-997.373) (-994.510) (-994.588) * (-1000.194) (-995.837) [-994.805] (-996.459) -- 0:00:17
719500 -- (-994.902) [-996.476] (-994.972) (-995.564) * (-996.799) (-997.126) (-994.523) [-996.434] -- 0:00:17
720000 -- [-998.059] (-995.147) (-996.436) (-998.476) * (-995.654) (-997.115) [-995.253] (-996.682) -- 0:00:17
Average standard deviation of split frequencies: 0.007154
720500 -- (-997.952) [-997.236] (-994.097) (-993.726) * (-994.038) [-997.264] (-994.657) (-994.154) -- 0:00:17
721000 -- (-996.451) (-995.238) [-994.104] (-993.925) * (-995.825) [-997.508] (-997.686) (-995.899) -- 0:00:17
721500 -- [-995.671] (-995.996) (-995.517) (-999.467) * [-995.502] (-997.466) (-994.102) (-997.143) -- 0:00:16
722000 -- (-993.687) [-999.475] (-998.526) (-994.161) * (-995.454) [-994.348] (-995.093) (-995.733) -- 0:00:16
722500 -- (-997.045) [-995.123] (-995.114) (-994.837) * (-994.523) (-995.387) [-994.081] (-998.335) -- 0:00:16
723000 -- (-998.399) (-995.303) (-994.371) [-997.269] * (-994.276) (-994.246) (-994.201) [-995.684] -- 0:00:16
723500 -- [-994.099] (-995.752) (-995.207) (-996.794) * [-994.210] (-998.232) (-998.756) (-994.520) -- 0:00:16
724000 -- (-994.842) (-999.631) [-995.148] (-994.613) * (-994.043) [-996.109] (-996.395) (-994.520) -- 0:00:16
724500 -- (-994.520) (-998.054) (-998.195) [-994.376] * (-995.806) (-994.961) (-994.022) [-996.717] -- 0:00:16
725000 -- (-994.502) (-998.144) (-996.696) [-995.779] * (-997.278) (-996.617) (-997.895) [-995.835] -- 0:00:16
Average standard deviation of split frequencies: 0.006899
725500 -- (-997.377) (-997.175) [-998.626] (-996.822) * (-996.024) (-999.936) (-994.484) [-994.776] -- 0:00:16
726000 -- (-994.032) (-994.235) (-996.692) [-995.353] * (-997.378) (-997.647) [-995.157] (-996.774) -- 0:00:16
726500 -- [-997.400] (-994.959) (-996.022) (-996.960) * (-1000.074) (-999.577) [-994.434] (-994.692) -- 0:00:16
727000 -- [-998.597] (-995.872) (-995.113) (-994.869) * (-994.894) (-997.375) [-994.711] (-993.766) -- 0:00:16
727500 -- (-994.970) [-995.071] (-997.399) (-995.159) * [-996.711] (-996.303) (-997.020) (-994.346) -- 0:00:16
728000 -- (-994.608) (-997.801) [-995.784] (-995.382) * (-997.972) (-1000.875) [-994.285] (-996.336) -- 0:00:16
728500 -- [-996.962] (-994.857) (-997.335) (-995.663) * (-995.558) (-995.522) [-996.158] (-996.137) -- 0:00:16
729000 -- (-995.493) [-994.325] (-996.080) (-995.596) * (-995.052) [-995.422] (-995.452) (-998.070) -- 0:00:16
729500 -- (-995.011) [-995.665] (-997.724) (-995.940) * (-993.761) (-994.164) [-995.087] (-998.033) -- 0:00:16
730000 -- (-993.859) (-997.667) (-997.391) [-998.365] * (-996.177) (-994.832) [-995.272] (-993.855) -- 0:00:16
Average standard deviation of split frequencies: 0.006613
730500 -- (-996.011) (-997.678) [-994.514] (-996.081) * (-994.539) [-995.608] (-997.242) (-997.512) -- 0:00:16
731000 -- [-994.228] (-997.707) (-996.568) (-996.233) * (-998.837) [-997.647] (-997.537) (-997.406) -- 0:00:16
731500 -- (-994.995) (-999.039) [-994.362] (-996.479) * (-994.674) [-995.104] (-995.181) (-993.510) -- 0:00:16
732000 -- (-994.849) (-999.575) [-995.573] (-997.430) * (-994.674) [-994.346] (-995.269) (-996.393) -- 0:00:16
732500 -- (-995.301) (-996.369) (-995.575) [-1000.791] * (-996.366) (-994.376) (-995.056) [-996.531] -- 0:00:16
733000 -- (-996.010) [-996.093] (-995.626) (-996.000) * (-996.880) [-994.321] (-997.366) (-997.240) -- 0:00:16
733500 -- (-995.164) (-996.907) [-994.757] (-994.755) * (-994.556) [-994.828] (-995.985) (-994.440) -- 0:00:16
734000 -- (-995.659) (-996.073) [-995.492] (-995.281) * [-998.916] (-994.746) (-994.459) (-994.635) -- 0:00:16
734500 -- (-998.776) (-996.949) (-996.934) [-995.851] * (-996.412) [-993.714] (-995.656) (-995.246) -- 0:00:16
735000 -- (-997.429) (-994.917) (-998.052) [-995.684] * (-994.884) [-997.817] (-997.241) (-997.404) -- 0:00:16
Average standard deviation of split frequencies: 0.006845
735500 -- (-994.214) [-997.265] (-996.417) (-994.877) * (-994.948) (-997.869) [-995.686] (-999.308) -- 0:00:16
736000 -- (-997.999) (-996.428) [-995.360] (-997.187) * (-994.465) (-996.564) (-994.685) [-998.872] -- 0:00:16
736500 -- [-1002.417] (-995.299) (-999.725) (-997.489) * (-995.142) [-994.907] (-994.792) (-1001.955) -- 0:00:16
737000 -- [-995.054] (-995.868) (-995.445) (-996.060) * (-997.366) (-995.092) (-994.897) [-997.453] -- 0:00:16
737500 -- (-999.493) (-994.797) [-994.776] (-994.689) * (-999.050) (-995.579) [-996.306] (-996.035) -- 0:00:16
738000 -- (-998.495) (-1000.978) [-993.711] (-994.595) * [-997.789] (-994.807) (-995.117) (-998.603) -- 0:00:15
738500 -- (-996.710) [-997.296] (-995.095) (-995.190) * (-994.702) (-997.437) [-994.498] (-997.577) -- 0:00:15
739000 -- (-995.522) [-993.697] (-996.333) (-994.890) * (-994.966) (-999.652) [-996.472] (-1000.638) -- 0:00:15
739500 -- [-993.857] (-993.548) (-995.089) (-994.788) * [-993.908] (-996.658) (-995.911) (-999.639) -- 0:00:15
740000 -- [-994.864] (-994.181) (-995.529) (-994.821) * [-997.041] (-996.265) (-994.946) (-997.151) -- 0:00:15
Average standard deviation of split frequencies: 0.006961
740500 -- (-994.259) (-994.759) (-998.736) [-994.784] * (-994.901) (-997.811) [-995.000] (-995.349) -- 0:00:15
741000 -- (-995.385) (-994.936) (-995.193) [-995.311] * (-996.479) [-998.521] (-995.979) (-994.782) -- 0:00:15
741500 -- [-996.538] (-998.184) (-995.665) (-997.878) * (-994.136) [-997.383] (-993.993) (-994.679) -- 0:00:15
742000 -- (-996.140) (-994.365) [-1000.525] (-997.078) * (-995.356) (-997.995) (-996.337) [-996.931] -- 0:00:15
742500 -- [-993.663] (-994.646) (-997.657) (-996.495) * (-994.295) (-999.914) [-994.353] (-999.676) -- 0:00:15
743000 -- [-994.714] (-995.418) (-998.346) (-995.420) * (-995.995) [-997.411] (-1000.251) (-994.588) -- 0:00:15
743500 -- (-995.021) (-997.538) [-995.356] (-994.986) * (-995.849) (-996.317) [-996.669] (-996.425) -- 0:00:15
744000 -- (-998.405) (-996.689) (-995.744) [-994.976] * (-997.423) (-995.100) [-996.803] (-995.266) -- 0:00:15
744500 -- [-994.324] (-995.172) (-1000.840) (-997.118) * (-997.944) (-995.070) (-997.646) [-994.128] -- 0:00:15
745000 -- (-994.728) (-996.403) (-996.141) [-993.911] * [-994.331] (-995.215) (-996.830) (-997.921) -- 0:00:15
Average standard deviation of split frequencies: 0.006912
745500 -- (-997.084) [-996.206] (-997.196) (-994.835) * [-994.955] (-993.624) (-995.840) (-995.151) -- 0:00:15
746000 -- (-998.655) (-994.962) (-999.322) [-997.124] * (-996.169) (-994.592) (-994.455) [-995.956] -- 0:00:15
746500 -- (-1000.871) (-997.145) (-997.192) [-995.377] * [-994.136] (-995.088) (-994.942) (-994.602) -- 0:00:15
747000 -- (-999.827) (-995.546) (-996.211) [-996.236] * (-995.886) [-995.540] (-996.256) (-994.391) -- 0:00:15
747500 -- [-994.918] (-997.185) (-993.775) (-995.447) * (-999.840) (-993.661) (-994.129) [-996.037] -- 0:00:15
748000 -- [-994.623] (-997.754) (-993.986) (-997.831) * (-995.939) (-1000.061) [-994.431] (-993.900) -- 0:00:15
748500 -- (-995.745) [-997.546] (-995.226) (-995.080) * (-996.635) (-997.233) (-995.164) [-993.868] -- 0:00:15
749000 -- (-998.515) (-997.411) [-996.834] (-995.676) * [-996.013] (-995.576) (-998.258) (-996.478) -- 0:00:15
749500 -- (-998.644) [-994.957] (-996.245) (-995.857) * (-995.563) (-994.578) [-997.345] (-996.578) -- 0:00:15
750000 -- (-998.421) [-995.857] (-995.223) (-994.324) * [-995.286] (-994.401) (-998.581) (-994.740) -- 0:00:15
Average standard deviation of split frequencies: 0.007300
750500 -- [-997.507] (-998.123) (-995.928) (-994.281) * (-994.991) [-996.115] (-997.811) (-994.668) -- 0:00:15
751000 -- (-997.870) (-996.101) (-996.129) [-996.686] * (-994.967) [-994.028] (-994.547) (-995.192) -- 0:00:15
751500 -- (-994.865) (-994.015) (-995.360) [-996.537] * [-996.699] (-996.942) (-1001.020) (-999.563) -- 0:00:15
752000 -- (-995.863) (-994.671) [-994.978] (-994.114) * (-995.866) (-999.257) (-999.081) [-997.778] -- 0:00:15
752500 -- (-995.029) (-998.252) [-993.866] (-999.438) * (-995.736) [-995.470] (-996.490) (-994.858) -- 0:00:15
753000 -- [-997.363] (-995.694) (-994.068) (-997.332) * (-997.680) (-995.254) [-995.460] (-996.166) -- 0:00:15
753500 -- (-994.883) (-995.415) (-993.873) [-1000.672] * (-997.646) (-994.179) (-996.838) [-999.433] -- 0:00:15
754000 -- (-995.138) (-995.848) [-993.612] (-1003.784) * (-997.831) [-995.818] (-994.207) (-997.487) -- 0:00:15
754500 -- [-999.212] (-995.439) (-995.704) (-994.948) * (-996.588) [-994.295] (-996.502) (-1000.271) -- 0:00:14
755000 -- [-995.449] (-994.309) (-996.213) (-995.598) * (-996.460) [-995.501] (-998.142) (-1000.830) -- 0:00:14
Average standard deviation of split frequencies: 0.006651
755500 -- (-997.070) (-994.125) [-994.964] (-996.988) * [-994.158] (-997.282) (-996.082) (-998.456) -- 0:00:14
756000 -- [-994.066] (-995.729) (-996.297) (-995.134) * (-993.552) (-996.068) (-995.332) [-997.208] -- 0:00:14
756500 -- (-993.887) (-993.567) [-1000.134] (-995.019) * (-995.228) [-998.288] (-996.780) (-998.178) -- 0:00:14
757000 -- (-994.428) (-994.529) (-997.275) [-994.850] * (-994.941) (-998.269) (-995.594) [-995.365] -- 0:00:14
757500 -- (-994.527) (-996.194) [-997.706] (-995.088) * [-997.234] (-996.617) (-995.561) (-996.773) -- 0:00:14
758000 -- (-994.633) (-994.214) (-998.324) [-995.952] * (-996.650) [-997.271] (-994.829) (-995.792) -- 0:00:14
758500 -- (-997.279) (-994.536) (-998.780) [-995.948] * (-1002.912) (-995.184) [-994.829] (-998.487) -- 0:00:14
759000 -- (-995.267) (-994.686) (-996.725) [-994.550] * (-1000.008) (-994.521) [-994.675] (-996.448) -- 0:00:14
759500 -- [-994.603] (-997.475) (-996.353) (-997.462) * [-998.397] (-995.126) (-999.128) (-995.375) -- 0:00:14
760000 -- [-994.371] (-999.302) (-995.008) (-997.312) * (-1004.697) (-995.691) (-994.500) [-997.421] -- 0:00:14
Average standard deviation of split frequencies: 0.006652
760500 -- (-996.548) [-995.997] (-995.636) (-997.478) * (-999.430) (-995.345) (-997.602) [-996.724] -- 0:00:14
761000 -- (-996.542) [-998.096] (-1000.226) (-995.876) * (-1000.742) (-1000.731) [-995.034] (-995.647) -- 0:00:14
761500 -- (-993.463) [-995.596] (-999.924) (-994.708) * (-995.105) [-995.866] (-993.968) (-998.938) -- 0:00:14
762000 -- (-996.952) (-997.257) (-995.314) [-994.951] * (-993.642) [-995.660] (-994.311) (-996.695) -- 0:00:14
762500 -- (-995.352) [-996.001] (-998.995) (-996.068) * (-994.554) (-995.217) (-994.025) [-995.227] -- 0:00:14
763000 -- (-996.501) [-996.380] (-1000.844) (-994.519) * (-994.506) (-998.034) (-996.299) [-995.761] -- 0:00:14
763500 -- (-1002.348) (-998.940) (-998.883) [-994.433] * (-996.440) [-998.973] (-996.926) (-993.748) -- 0:00:14
764000 -- (-1003.222) (-999.274) (-996.927) [-997.011] * (-995.834) (-998.888) [-997.218] (-993.751) -- 0:00:14
764500 -- (-995.121) (-995.021) [-994.989] (-996.541) * [-996.598] (-997.978) (-994.973) (-993.522) -- 0:00:14
765000 -- [-999.035] (-998.375) (-994.776) (-1001.294) * (-994.323) (-995.954) [-996.864] (-996.038) -- 0:00:14
Average standard deviation of split frequencies: 0.006441
765500 -- (-997.533) (-997.941) [-994.253] (-996.177) * (-997.085) [-993.982] (-998.070) (-994.084) -- 0:00:14
766000 -- (-996.949) (-998.824) [-993.862] (-999.260) * (-996.403) (-997.921) [-995.130] (-994.764) -- 0:00:14
766500 -- (-995.045) (-999.771) (-995.711) [-1002.032] * (-995.920) [-993.896] (-998.062) (-996.607) -- 0:00:14
767000 -- (-996.647) (-994.488) [-996.956] (-995.085) * (-1000.615) (-993.458) [-996.991] (-996.259) -- 0:00:14
767500 -- [-998.096] (-996.927) (-997.290) (-996.887) * (-1000.207) (-996.308) (-996.333) [-993.745] -- 0:00:14
768000 -- [-995.982] (-997.480) (-994.547) (-998.797) * (-998.365) (-996.562) [-994.799] (-996.211) -- 0:00:14
768500 -- [-996.281] (-995.155) (-996.819) (-994.612) * (-996.342) [-996.414] (-993.923) (-993.987) -- 0:00:14
769000 -- (-996.697) [-994.579] (-995.962) (-996.905) * (-999.776) (-996.873) [-993.382] (-995.691) -- 0:00:14
769500 -- (-998.831) [-995.056] (-995.040) (-998.595) * [-999.533] (-997.251) (-997.498) (-996.227) -- 0:00:14
770000 -- (-998.850) [-995.120] (-1008.118) (-994.892) * [-994.994] (-996.079) (-994.408) (-994.229) -- 0:00:14
Average standard deviation of split frequencies: 0.006810
770500 -- (-994.726) (-995.274) (-998.552) [-996.101] * (-996.990) (-996.528) [-995.065] (-994.060) -- 0:00:13
771000 -- (-994.471) (-995.708) [-995.514] (-996.947) * (-997.781) [-995.435] (-996.080) (-996.662) -- 0:00:13
771500 -- (-994.434) (-995.820) [-995.125] (-1001.702) * (-995.804) (-995.907) [-996.978] (-994.504) -- 0:00:13
772000 -- [-995.026] (-994.647) (-1003.897) (-997.567) * (-994.727) [-994.849] (-996.053) (-993.767) -- 0:00:13
772500 -- [-993.627] (-995.939) (-995.099) (-997.784) * [-996.682] (-993.653) (-997.880) (-994.768) -- 0:00:13
773000 -- [-993.880] (-999.690) (-997.015) (-996.044) * (-994.721) [-995.053] (-996.146) (-994.657) -- 0:00:13
773500 -- [-995.825] (-996.523) (-995.377) (-996.576) * [-995.823] (-995.766) (-997.566) (-994.427) -- 0:00:13
774000 -- (-997.517) (-995.192) [-996.237] (-996.410) * (-995.563) (-995.033) (-997.031) [-994.969] -- 0:00:13
774500 -- (-996.258) [-993.550] (-996.812) (-999.863) * (-993.892) [-995.522] (-1000.182) (-996.686) -- 0:00:13
775000 -- [-997.548] (-994.227) (-994.483) (-1000.656) * (-994.895) [-998.882] (-997.814) (-1000.603) -- 0:00:13
Average standard deviation of split frequencies: 0.006844
775500 -- (-999.266) (-996.263) [-995.133] (-997.324) * (-995.756) [-996.773] (-997.124) (-997.016) -- 0:00:13
776000 -- (-994.716) [-996.429] (-996.691) (-998.356) * (-994.992) (-997.853) [-997.071] (-997.434) -- 0:00:13
776500 -- (-994.672) (-1004.213) (-997.150) [-996.427] * [-994.768] (-997.013) (-995.909) (-995.783) -- 0:00:13
777000 -- (-994.661) (-996.096) [-994.745] (-994.571) * (-996.953) (-995.011) (-1000.013) [-996.720] -- 0:00:13
777500 -- (-997.151) (-994.584) [-993.829] (-994.746) * (-996.068) (-998.961) (-995.607) [-999.481] -- 0:00:13
778000 -- (-996.016) [-996.887] (-998.918) (-995.524) * (-999.148) (-996.004) [-995.176] (-996.073) -- 0:00:13
778500 -- (-994.411) (-999.176) [-996.032] (-996.535) * (-995.526) (-996.167) [-994.164] (-995.413) -- 0:00:13
779000 -- (-995.885) (-997.459) [-996.822] (-997.505) * [-998.214] (-998.249) (-994.931) (-995.249) -- 0:00:13
779500 -- [-995.856] (-997.067) (-995.203) (-998.046) * [-1000.084] (-995.645) (-994.684) (-998.626) -- 0:00:13
780000 -- [-994.848] (-995.861) (-1000.542) (-996.021) * (-996.040) (-999.310) (-997.155) [-995.827] -- 0:00:13
Average standard deviation of split frequencies: 0.006602
780500 -- [-994.565] (-999.865) (-1000.569) (-996.097) * (-996.101) [-995.511] (-994.011) (-994.492) -- 0:00:13
781000 -- [-996.129] (-997.248) (-1001.234) (-993.910) * (-998.710) [-995.497] (-996.231) (-996.871) -- 0:00:13
781500 -- (-996.046) (-994.776) (-997.222) [-996.871] * [-995.404] (-995.382) (-995.648) (-994.448) -- 0:00:13
782000 -- (-997.017) (-994.065) (-995.893) [-994.366] * (-995.272) (-997.716) (-1000.496) [-994.491] -- 0:00:13
782500 -- (-996.441) [-995.009] (-996.332) (-995.166) * (-995.066) (-995.436) (-994.717) [-994.080] -- 0:00:13
783000 -- [-995.366] (-993.852) (-995.988) (-996.726) * (-994.947) (-996.751) [-996.595] (-994.133) -- 0:00:13
783500 -- (-1002.751) (-994.821) [-995.493] (-995.705) * [-995.511] (-999.790) (-996.168) (-997.498) -- 0:00:13
784000 -- (-995.944) [-994.182] (-998.419) (-994.498) * [-995.125] (-994.595) (-996.276) (-1002.069) -- 0:00:13
784500 -- (-999.152) (-996.300) (-995.401) [-994.445] * [-997.223] (-994.877) (-995.575) (-996.401) -- 0:00:13
785000 -- [-996.503] (-994.876) (-997.457) (-994.877) * (-1001.119) [-994.901] (-1007.204) (-994.820) -- 0:00:13
Average standard deviation of split frequencies: 0.007077
785500 -- (-995.027) (-995.045) (-996.002) [-995.625] * (-1000.597) (-995.746) [-996.968] (-994.640) -- 0:00:13
786000 -- (-996.668) [-993.699] (-996.916) (-994.811) * (-997.017) (-993.554) [-995.331] (-993.750) -- 0:00:13
786500 -- [-998.417] (-994.223) (-996.196) (-996.826) * (-996.695) (-996.871) (-994.200) [-998.401] -- 0:00:13
787000 -- (-999.086) (-995.777) (-997.489) [-993.852] * (-997.449) [-999.853] (-994.507) (-996.382) -- 0:00:12
787500 -- (-998.497) (-997.327) (-997.891) [-996.839] * (-997.278) (-997.362) [-995.363] (-995.333) -- 0:00:12
788000 -- [-996.383] (-999.933) (-1001.412) (-994.347) * (-999.488) (-993.940) [-998.789] (-995.837) -- 0:00:12
788500 -- [-995.609] (-1000.058) (-999.194) (-996.126) * [-997.105] (-995.223) (-998.467) (-1001.767) -- 0:00:12
789000 -- (-994.481) (-995.735) [-995.577] (-999.699) * (-996.682) [-993.898] (-1000.988) (-1001.758) -- 0:00:12
789500 -- (-994.251) (-995.534) [-994.241] (-998.620) * (-996.413) [-994.203] (-994.698) (-996.606) -- 0:00:12
790000 -- (-994.251) [-998.602] (-995.739) (-995.671) * (-997.411) (-993.902) (-994.381) [-995.535] -- 0:00:12
Average standard deviation of split frequencies: 0.007234
790500 -- (-994.677) [-997.721] (-998.615) (-997.504) * [-996.243] (-995.612) (-994.349) (-1000.055) -- 0:00:12
791000 -- (-994.460) (-995.552) (-996.845) [-999.240] * (-1001.794) (-995.379) [-995.737] (-996.194) -- 0:00:12
791500 -- (-993.968) [-998.825] (-996.828) (-994.619) * [-998.269] (-997.464) (-996.209) (-995.405) -- 0:00:12
792000 -- (-1001.801) (-994.846) (-995.614) [-998.078] * (-996.723) (-995.542) (-997.217) [-996.930] -- 0:00:12
792500 -- [-994.586] (-995.113) (-995.153) (-995.401) * (-995.897) (-994.082) (-994.179) [-995.837] -- 0:00:12
793000 -- (-998.132) (-995.070) (-994.171) [-994.297] * (-995.895) (-995.623) [-994.288] (-994.244) -- 0:00:12
793500 -- (-995.570) (-994.857) [-994.255] (-995.468) * (-995.357) (-997.459) [-996.732] (-995.623) -- 0:00:12
794000 -- (-996.930) (-999.601) [-994.147] (-994.688) * (-998.199) (-996.262) (-996.179) [-993.755] -- 0:00:12
794500 -- [-996.484] (-1000.394) (-996.360) (-996.232) * (-997.318) (-995.245) (-996.038) [-994.228] -- 0:00:12
795000 -- [-993.718] (-999.972) (-995.661) (-996.942) * [-993.927] (-995.244) (-994.446) (-994.245) -- 0:00:12
Average standard deviation of split frequencies: 0.007265
795500 -- (-993.526) [-993.815] (-996.552) (-996.302) * [-993.702] (-995.631) (-994.089) (-994.126) -- 0:00:12
796000 -- (-997.872) (-995.519) (-995.006) [-994.594] * (-998.031) (-996.792) [-996.101] (-996.237) -- 0:00:12
796500 -- (-994.692) (-994.885) [-994.385] (-994.742) * [-995.016] (-996.873) (-993.567) (-996.299) -- 0:00:12
797000 -- (-994.563) (-995.618) (-995.561) [-994.565] * (-994.724) (-998.647) [-996.051] (-995.706) -- 0:00:12
797500 -- (-993.705) [-995.440] (-994.144) (-995.720) * (-994.224) (-994.427) [-1000.083] (-996.145) -- 0:00:12
798000 -- (-997.155) (-994.426) [-994.077] (-995.998) * [-995.286] (-995.394) (-1001.409) (-1005.465) -- 0:00:12
798500 -- (-995.323) [-994.624] (-995.944) (-994.723) * (-997.033) (-994.481) (-1000.433) [-997.636] -- 0:00:12
799000 -- (-996.796) (-995.918) (-998.022) [-994.706] * (-995.431) [-994.750] (-997.028) (-996.972) -- 0:00:12
799500 -- (-995.676) (-996.881) [-995.578] (-994.367) * [-996.559] (-996.087) (-995.800) (-997.352) -- 0:00:12
800000 -- (-996.439) (-997.234) [-996.480] (-994.664) * (-997.241) (-996.149) (-997.267) [-997.982] -- 0:00:12
Average standard deviation of split frequencies: 0.007536
800500 -- (-995.598) (-996.666) (-994.701) [-993.775] * (-995.243) [-994.943] (-994.301) (-994.988) -- 0:00:12
801000 -- (-999.118) [-994.173] (-995.942) (-997.460) * (-996.138) (-994.994) [-995.169] (-995.014) -- 0:00:12
801500 -- [-993.755] (-996.699) (-995.587) (-997.210) * [-1001.323] (-996.941) (-997.341) (-997.390) -- 0:00:12
802000 -- (-995.397) (-998.968) [-996.329] (-995.904) * (-993.719) (-997.560) [-995.359] (-993.750) -- 0:00:12
802500 -- (-996.506) (-997.108) (-1001.540) [-998.379] * [-993.741] (-995.746) (-997.069) (-998.115) -- 0:00:12
803000 -- (-996.119) (-996.711) [-1002.213] (-997.331) * [-996.321] (-994.360) (-995.457) (-994.363) -- 0:00:12
803500 -- [-995.180] (-996.975) (-995.981) (-1006.382) * (-997.679) (-995.573) [-995.338] (-994.105) -- 0:00:11
804000 -- (-995.939) [-995.942] (-996.791) (-995.973) * (-996.743) [-997.023] (-998.843) (-996.987) -- 0:00:11
804500 -- (-995.170) [-994.995] (-996.298) (-998.026) * [-996.562] (-995.700) (-998.684) (-998.755) -- 0:00:11
805000 -- (-996.370) (-995.642) [-996.528] (-996.937) * (-994.110) [-996.060] (-999.079) (-995.325) -- 0:00:11
Average standard deviation of split frequencies: 0.007369
805500 -- [-994.363] (-995.872) (-997.942) (-998.309) * (-996.998) (-997.794) (-996.313) [-994.907] -- 0:00:11
806000 -- (-994.612) (-994.390) [-995.489] (-998.821) * (-994.402) (-997.531) [-996.631] (-996.938) -- 0:00:11
806500 -- (-994.226) (-993.753) [-995.679] (-996.977) * (-994.086) (-994.859) (-996.598) [-993.790] -- 0:00:11
807000 -- [-994.007] (-997.752) (-998.243) (-1000.925) * [-994.424] (-994.503) (-995.219) (-996.200) -- 0:00:11
807500 -- [-995.696] (-998.134) (-994.260) (-1001.253) * (-996.690) [-997.075] (-995.389) (-996.173) -- 0:00:11
808000 -- [-994.629] (-997.099) (-996.356) (-996.628) * [-998.365] (-996.643) (-997.144) (-995.788) -- 0:00:11
808500 -- (-996.806) (-996.063) (-995.585) [-996.612] * (-1001.774) [-996.780] (-996.747) (-997.998) -- 0:00:11
809000 -- [-994.542] (-995.870) (-995.762) (-997.276) * [-997.126] (-995.196) (-995.048) (-996.301) -- 0:00:11
809500 -- (-996.802) (-998.632) (-996.347) [-996.922] * [-995.682] (-995.041) (-997.192) (-994.516) -- 0:00:11
810000 -- (-994.279) (-996.108) (-999.740) [-995.051] * (-996.470) [-994.855] (-993.960) (-994.908) -- 0:00:11
Average standard deviation of split frequencies: 0.007172
810500 -- (-997.907) (-993.945) [-995.411] (-995.910) * (-997.165) (-996.235) (-995.679) [-995.397] -- 0:00:11
811000 -- (-997.237) (-996.269) (-997.288) [-998.849] * (-997.343) (-995.052) (-994.492) [-995.717] -- 0:00:11
811500 -- (-996.795) (-997.844) (-997.789) [-996.193] * (-998.087) (-994.892) [-995.426] (-999.693) -- 0:00:11
812000 -- (-995.999) (-997.122) (-998.553) [-994.101] * [-994.432] (-995.725) (-995.824) (-995.578) -- 0:00:11
812500 -- (-995.380) (-995.927) [-996.411] (-994.231) * (-1001.384) (-994.257) (-994.744) [-994.093] -- 0:00:11
813000 -- (-994.974) [-1001.006] (-995.649) (-994.680) * (-997.565) (-996.346) (-995.434) [-996.345] -- 0:00:11
813500 -- (-994.744) (-997.965) (-997.646) [-995.416] * (-995.944) (-994.540) [-997.653] (-996.606) -- 0:00:11
814000 -- (-997.346) (-997.061) [-995.594] (-996.914) * (-997.862) (-996.707) (-998.466) [-994.642] -- 0:00:11
814500 -- (-996.389) (-995.569) [-994.059] (-999.420) * [-995.731] (-995.109) (-997.140) (-996.305) -- 0:00:11
815000 -- [-995.277] (-995.991) (-994.676) (-996.261) * (-995.636) (-995.383) [-994.834] (-997.358) -- 0:00:11
Average standard deviation of split frequencies: 0.007241
815500 -- (-999.095) (-995.323) [-996.368] (-997.941) * [-995.115] (-996.281) (-994.712) (-995.815) -- 0:00:11
816000 -- (-999.784) (-995.153) [-995.379] (-997.084) * [-995.570] (-995.857) (-1001.463) (-994.775) -- 0:00:11
816500 -- [-995.630] (-994.674) (-996.530) (-994.857) * (-994.794) (-996.334) (-996.643) [-994.579] -- 0:00:11
817000 -- (-994.289) [-994.240] (-995.154) (-1000.754) * [-995.349] (-997.620) (-997.035) (-996.001) -- 0:00:11
817500 -- (-993.509) (-997.162) (-996.258) [-998.413] * (-995.855) (-995.787) (-998.254) [-996.773] -- 0:00:11
818000 -- [-994.178] (-999.049) (-996.997) (-997.855) * (-997.366) (-995.017) (-996.589) [-993.979] -- 0:00:11
818500 -- (-994.504) (-995.749) [-994.679] (-996.913) * (-998.735) (-996.351) (-998.204) [-995.183] -- 0:00:11
819000 -- (-999.771) (-1005.747) (-994.342) [-998.115] * [-995.529] (-995.468) (-996.666) (-993.875) -- 0:00:11
819500 -- (-994.867) [-997.790] (-998.267) (-996.606) * [-996.325] (-1000.016) (-998.096) (-993.992) -- 0:00:11
820000 -- (-997.944) [-997.389] (-994.769) (-997.641) * (-996.255) (-997.477) [-995.499] (-996.168) -- 0:00:10
Average standard deviation of split frequencies: 0.006970
820500 -- (-995.566) (-994.830) (-997.680) [-996.257] * (-994.488) (-996.756) (-995.383) [-995.272] -- 0:00:10
821000 -- (-996.000) (-995.932) (-998.443) [-995.847] * (-994.739) (-996.739) [-995.795] (-998.804) -- 0:00:10
821500 -- (-996.249) [-996.145] (-994.497) (-995.465) * [-997.227] (-999.198) (-995.091) (-1001.297) -- 0:00:10
822000 -- (-994.599) (-997.322) (-995.492) [-996.093] * [-993.978] (-996.817) (-994.004) (-996.158) -- 0:00:10
822500 -- (-993.853) [-996.502] (-994.886) (-996.125) * (-993.900) (-996.838) [-994.096] (-997.086) -- 0:00:10
823000 -- [-994.453] (-996.200) (-995.526) (-996.702) * [-996.826] (-996.245) (-994.349) (-995.587) -- 0:00:10
823500 -- (-994.901) (-997.288) [-993.726] (-993.524) * (-996.827) (-998.147) [-997.786] (-993.817) -- 0:00:10
824000 -- [-996.266] (-994.226) (-994.767) (-998.909) * (-995.927) (-995.774) [-994.911] (-997.911) -- 0:00:10
824500 -- (-995.484) [-997.030] (-994.311) (-996.987) * [-994.750] (-995.897) (-996.965) (-995.237) -- 0:00:10
825000 -- [-995.690] (-1000.138) (-994.325) (-995.346) * [-994.442] (-997.224) (-994.868) (-999.284) -- 0:00:10
Average standard deviation of split frequencies: 0.007001
825500 -- (-996.994) (-996.854) (-997.843) [-995.240] * [-995.316] (-996.061) (-995.778) (-999.006) -- 0:00:10
826000 -- (-1000.275) (-996.191) [-993.961] (-997.247) * (-996.069) (-994.340) [-995.889] (-999.168) -- 0:00:10
826500 -- [-997.633] (-994.431) (-994.031) (-996.171) * [-993.850] (-994.728) (-996.243) (-1005.775) -- 0:00:10
827000 -- (-993.961) (-994.871) (-995.911) [-995.529] * (-997.421) (-996.618) (-996.632) [-998.748] -- 0:00:10
827500 -- (-994.833) (-995.193) [-995.898] (-995.490) * (-995.702) [-997.113] (-994.651) (-993.881) -- 0:00:10
828000 -- (-994.268) [-997.770] (-995.986) (-995.476) * (-995.143) [-994.828] (-996.133) (-993.955) -- 0:00:10
828500 -- [-998.107] (-995.619) (-995.256) (-998.780) * (-994.172) [-997.257] (-994.327) (-994.576) -- 0:00:10
829000 -- [-995.899] (-996.780) (-993.968) (-1000.266) * (-996.802) [-994.855] (-997.753) (-993.644) -- 0:00:10
829500 -- [-995.519] (-994.255) (-993.786) (-995.925) * (-995.004) [-996.561] (-997.907) (-994.615) -- 0:00:10
830000 -- (-994.754) (-1000.561) (-995.314) [-997.434] * (-994.977) [-995.699] (-996.058) (-996.271) -- 0:00:10
Average standard deviation of split frequencies: 0.006772
830500 -- (-994.481) (-995.991) (-996.696) [-996.422] * (-997.283) [-996.880] (-994.382) (-997.377) -- 0:00:10
831000 -- (-994.167) (-996.663) [-996.733] (-996.598) * (-996.095) [-993.727] (-997.021) (-998.957) -- 0:00:10
831500 -- [-996.000] (-994.610) (-996.855) (-1003.589) * [-996.028] (-993.895) (-995.174) (-993.855) -- 0:00:10
832000 -- (-998.052) [-994.563] (-996.028) (-1000.226) * (-995.275) (-993.894) [-995.079] (-996.851) -- 0:00:10
832500 -- (-995.537) [-997.434] (-995.487) (-993.924) * [-995.549] (-996.249) (-996.297) (-996.169) -- 0:00:10
833000 -- (-995.960) [-998.461] (-994.948) (-995.426) * (-995.188) [-994.969] (-995.921) (-995.092) -- 0:00:10
833500 -- (-995.283) (-994.570) (-995.678) [-994.445] * (-994.578) [-994.670] (-996.770) (-995.376) -- 0:00:10
834000 -- (-995.618) [-995.950] (-995.482) (-996.363) * [-993.535] (-996.146) (-998.300) (-994.702) -- 0:00:10
834500 -- [-998.615] (-997.358) (-1001.206) (-996.149) * (-993.964) [-998.022] (-993.510) (-996.282) -- 0:00:10
835000 -- (-998.529) (-998.170) (-996.498) [-996.146] * [-994.818] (-995.718) (-993.903) (-999.586) -- 0:00:10
Average standard deviation of split frequencies: 0.007180
835500 -- (-994.742) [-995.373] (-997.187) (-997.231) * (-993.826) [-996.641] (-994.436) (-995.638) -- 0:00:10
836000 -- (-996.637) [-995.204] (-998.431) (-997.564) * (-993.852) (-994.003) (-994.247) [-994.870] -- 0:00:10
836500 -- [-995.085] (-995.080) (-998.994) (-999.694) * (-996.171) (-997.693) (-995.279) [-995.663] -- 0:00:09
837000 -- (-994.768) [-996.426] (-1001.025) (-996.361) * [-999.353] (-995.237) (-996.253) (-994.918) -- 0:00:09
837500 -- (-996.916) (-999.469) [-994.737] (-996.499) * (-998.202) (-996.590) [-998.810] (-994.386) -- 0:00:09
838000 -- (-998.524) [-998.184] (-994.808) (-995.219) * (-999.386) (-999.223) [-998.675] (-1001.646) -- 0:00:09
838500 -- (-993.859) (-996.954) [-995.789] (-996.775) * (-995.725) [-995.244] (-998.546) (-995.219) -- 0:00:09
839000 -- (-996.109) (-997.403) (-994.580) [-995.979] * (-996.656) (-997.730) [-998.112] (-996.168) -- 0:00:09
839500 -- [-994.889] (-998.436) (-994.775) (-994.419) * (-995.324) (-996.889) [-999.925] (-994.291) -- 0:00:09
840000 -- (-996.433) (-995.064) (-995.211) [-997.244] * (-996.420) (-995.241) (-995.483) [-993.797] -- 0:00:09
Average standard deviation of split frequencies: 0.006916
840500 -- (-994.754) (-998.030) (-996.194) [-996.020] * [-994.784] (-997.299) (-1001.975) (-995.422) -- 0:00:09
841000 -- [-994.713] (-995.076) (-996.961) (-995.672) * (-994.983) (-995.242) [-994.658] (-994.655) -- 0:00:09
841500 -- (-994.704) (-994.450) (-994.641) [-996.982] * (-995.741) (-995.378) [-994.903] (-995.684) -- 0:00:09
842000 -- (-994.961) [-996.599] (-1002.062) (-997.310) * (-993.918) [-996.503] (-996.298) (-995.553) -- 0:00:09
842500 -- [-995.698] (-998.013) (-999.304) (-997.220) * (-995.138) [-1000.244] (-996.416) (-994.934) -- 0:00:09
843000 -- (-997.494) [-996.150] (-997.016) (-995.415) * (-997.012) (-998.807) [-995.290] (-997.954) -- 0:00:09
843500 -- (-1000.243) (-997.029) (-995.723) [-996.028] * (-997.254) [-995.227] (-996.115) (-1000.582) -- 0:00:09
844000 -- (-995.487) (-998.309) [-995.092] (-993.526) * [-996.111] (-996.205) (-997.869) (-1000.594) -- 0:00:09
844500 -- [-994.714] (-994.881) (-995.147) (-993.526) * (-995.414) (-995.993) [-994.278] (-995.171) -- 0:00:09
845000 -- (-998.795) (-995.065) (-995.631) [-999.594] * (-996.411) (-997.635) [-994.326] (-994.754) -- 0:00:09
Average standard deviation of split frequencies: 0.006947
845500 -- (-1000.977) (-995.022) (-994.920) [-994.256] * (-997.110) (-995.272) [-994.290] (-994.168) -- 0:00:09
846000 -- [-993.443] (-994.987) (-996.430) (-994.652) * (-999.063) (-999.818) (-997.769) [-996.044] -- 0:00:09
846500 -- (-999.478) [-996.090] (-996.494) (-999.439) * (-997.328) (-994.831) [-999.187] (-995.364) -- 0:00:09
847000 -- (-995.592) [-998.151] (-996.347) (-995.060) * (-994.313) [-999.373] (-1001.497) (-994.267) -- 0:00:09
847500 -- (-996.141) [-994.448] (-995.715) (-995.243) * (-994.648) (-996.209) [-999.708] (-994.244) -- 0:00:09
848000 -- (-996.736) [-997.166] (-996.121) (-999.868) * [-998.472] (-994.640) (-996.639) (-994.845) -- 0:00:09
848500 -- [-996.981] (-997.475) (-997.103) (-998.298) * (-995.163) (-996.037) [-996.185] (-996.622) -- 0:00:09
849000 -- (-995.071) [-997.932] (-998.288) (-995.728) * [-999.309] (-995.893) (-995.830) (-998.321) -- 0:00:09
849500 -- (-995.881) (-993.914) (-994.129) [-994.337] * [-995.367] (-998.177) (-995.249) (-997.995) -- 0:00:09
850000 -- (-995.651) [-994.285] (-998.043) (-994.843) * [-993.998] (-996.512) (-995.184) (-997.625) -- 0:00:09
Average standard deviation of split frequencies: 0.007093
850500 -- (-994.383) (-995.086) (-998.466) [-994.665] * [-993.982] (-997.614) (-995.903) (-1000.528) -- 0:00:09
851000 -- (-994.262) (-996.623) [-995.494] (-997.098) * [-996.932] (-995.344) (-994.796) (-996.419) -- 0:00:09
851500 -- (-997.156) (-996.084) (-996.254) [-995.183] * (-995.713) (-994.246) (-994.767) [-994.203] -- 0:00:09
852000 -- (-997.157) [-993.979] (-997.376) (-995.345) * (-996.545) [-996.061] (-994.228) (-994.946) -- 0:00:09
852500 -- (-995.116) (-1005.492) [-998.022] (-994.157) * [-995.750] (-995.902) (-994.629) (-995.751) -- 0:00:08
853000 -- (-993.960) (-994.402) (-995.002) [-995.318] * [-994.821] (-998.519) (-997.321) (-998.678) -- 0:00:08
853500 -- [-994.412] (-994.097) (-996.130) (-997.154) * (-996.072) (-999.956) [-998.845] (-995.641) -- 0:00:08
854000 -- (-995.452) [-995.020] (-996.076) (-999.210) * [-996.072] (-996.124) (-1000.972) (-997.973) -- 0:00:08
854500 -- (-998.000) (-993.624) (-995.396) [-994.827] * (-995.729) (-994.639) [-1000.323] (-997.758) -- 0:00:08
855000 -- (-1004.159) (-998.751) (-998.475) [-994.916] * (-997.118) (-999.548) [-995.520] (-994.653) -- 0:00:08
Average standard deviation of split frequencies: 0.007049
855500 -- [-996.768] (-996.035) (-995.124) (-995.575) * (-998.110) [-996.728] (-995.426) (-996.970) -- 0:00:08
856000 -- (-998.140) [-995.913] (-995.047) (-1001.274) * (-996.438) [-996.333] (-994.727) (-995.630) -- 0:00:08
856500 -- (-997.529) (-998.321) [-995.787] (-998.611) * [-995.264] (-993.717) (-993.768) (-993.705) -- 0:00:08
857000 -- (-997.049) (-994.629) [-995.110] (-999.559) * (-994.494) (-994.152) [-994.498] (-994.455) -- 0:00:08
857500 -- (-995.493) [-993.839] (-997.048) (-995.189) * (-996.210) (-997.577) [-995.026] (-994.934) -- 0:00:08
858000 -- (-994.491) (-994.243) (-997.324) [-994.957] * [-995.186] (-997.816) (-997.328) (-995.387) -- 0:00:08
858500 -- (-995.405) (-994.951) (-996.306) [-997.758] * (-998.300) (-998.184) [-996.421] (-997.415) -- 0:00:08
859000 -- (-993.993) (-996.314) [-997.524] (-995.463) * (-996.908) [-994.681] (-995.290) (-1000.505) -- 0:00:08
859500 -- [-994.693] (-998.444) (-995.568) (-1003.074) * (-995.573) (-995.841) (-996.304) [-998.185] -- 0:00:08
860000 -- (-995.114) [-997.527] (-994.312) (-997.194) * [-997.466] (-994.905) (-996.024) (-994.393) -- 0:00:08
Average standard deviation of split frequencies: 0.007193
860500 -- (-993.642) (-994.089) (-994.245) [-995.370] * (-1000.410) [-996.528] (-995.334) (-993.625) -- 0:00:08
861000 -- [-993.875] (-999.957) (-999.812) (-997.352) * (-1000.360) (-998.806) [-994.415] (-994.627) -- 0:00:08
861500 -- (-996.553) [-996.864] (-995.374) (-997.176) * (-998.945) [-994.400] (-996.642) (-995.013) -- 0:00:08
862000 -- (-996.929) (-995.453) (-997.150) [-993.739] * (-994.587) (-995.131) (-994.827) [-994.097] -- 0:00:08
862500 -- (-995.776) (-997.832) [-995.259] (-993.589) * [-995.988] (-996.228) (-997.804) (-994.839) -- 0:00:08
863000 -- (-997.730) (-997.364) (-993.869) [-995.175] * [-995.084] (-995.497) (-996.048) (-995.024) -- 0:00:08
863500 -- (-996.803) (-995.791) [-993.628] (-995.806) * (-997.123) [-995.799] (-994.854) (-995.911) -- 0:00:08
864000 -- (-995.397) (-997.043) [-993.527] (-997.955) * (-995.365) (-995.104) [-994.837] (-997.457) -- 0:00:08
864500 -- (-996.781) (-994.799) (-994.583) [-994.693] * (-994.783) (-998.273) [-994.427] (-997.195) -- 0:00:08
865000 -- (-997.409) (-997.094) (-994.953) [-996.178] * (-997.055) (-999.325) [-995.157] (-996.195) -- 0:00:08
Average standard deviation of split frequencies: 0.007077
865500 -- (-997.215) (-998.101) [-996.047] (-996.547) * (-995.920) (-997.606) (-997.219) [-995.270] -- 0:00:08
866000 -- (-996.369) [-994.939] (-998.058) (-994.454) * [-993.912] (-996.800) (-994.569) (-995.155) -- 0:00:08
866500 -- (-999.274) [-994.286] (-995.429) (-997.558) * [-996.850] (-996.765) (-996.478) (-1002.411) -- 0:00:08
867000 -- [-994.413] (-994.808) (-995.827) (-994.448) * (-996.507) (-996.775) [-997.616] (-994.541) -- 0:00:08
867500 -- (-996.210) [-995.696] (-995.801) (-994.777) * [-994.555] (-994.746) (-998.921) (-996.448) -- 0:00:08
868000 -- (-995.255) (-996.002) [-997.899] (-997.240) * (-996.191) (-998.804) (-994.955) [-997.824] -- 0:00:08
868500 -- (-997.289) (-995.446) [-1000.252] (-995.383) * (-994.216) (-996.887) [-995.991] (-998.169) -- 0:00:08
869000 -- (-998.740) (-994.215) [-993.828] (-995.116) * (-994.952) (-995.400) (-996.714) [-995.378] -- 0:00:07
869500 -- (-998.646) (-1002.547) (-996.947) [-994.822] * (-996.578) (-995.192) (-996.027) [-994.834] -- 0:00:07
870000 -- (-994.401) [-996.805] (-997.895) (-995.777) * (-995.066) (-994.764) (-993.756) [-996.111] -- 0:00:07
Average standard deviation of split frequencies: 0.006894
870500 -- (-994.179) [-995.831] (-994.498) (-994.525) * (-994.536) [-996.867] (-994.665) (-996.050) -- 0:00:07
871000 -- [-994.686] (-994.924) (-997.703) (-994.179) * (-994.914) (-997.380) [-995.333] (-994.867) -- 0:00:07
871500 -- (-995.267) (-996.830) [-997.246] (-996.392) * (-996.677) (-995.294) [-998.613] (-997.013) -- 0:00:07
872000 -- (-995.264) (-994.952) [-995.641] (-996.719) * (-999.142) (-995.023) [-996.843] (-995.639) -- 0:00:07
872500 -- (-994.037) (-1000.021) (-994.428) [-1001.574] * (-995.310) [-995.059] (-999.370) (-994.321) -- 0:00:07
873000 -- (-999.469) [-995.876] (-1000.557) (-995.314) * (-993.878) (-994.695) (-996.070) [-993.846] -- 0:00:07
873500 -- (-1000.635) [-996.144] (-1000.713) (-994.042) * (-996.579) [-995.139] (-1001.094) (-993.854) -- 0:00:07
874000 -- [-994.927] (-995.746) (-998.090) (-994.893) * [-996.723] (-994.519) (-998.192) (-997.086) -- 0:00:07
874500 -- (-996.526) [-995.277] (-994.718) (-997.400) * (-996.792) [-1000.221] (-998.128) (-999.080) -- 0:00:07
875000 -- (-995.541) [-996.928] (-994.648) (-996.877) * (-994.777) (-997.338) [-994.302] (-1000.356) -- 0:00:07
Average standard deviation of split frequencies: 0.007103
875500 -- [-996.738] (-998.603) (-993.681) (-996.157) * (-994.715) (-1001.254) [-993.859] (-995.215) -- 0:00:07
876000 -- (-997.260) (-998.342) (-994.954) [-997.145] * [-995.193] (-995.751) (-997.146) (-998.044) -- 0:00:07
876500 -- (-996.772) (-996.345) [-995.300] (-997.839) * (-994.991) [-994.940] (-997.644) (-995.120) -- 0:00:07
877000 -- [-995.089] (-998.409) (-995.830) (-996.091) * [-993.985] (-994.756) (-996.853) (-994.519) -- 0:00:07
877500 -- [-993.790] (-996.966) (-994.967) (-998.440) * (-994.813) (-996.344) (-997.964) [-998.253] -- 0:00:07
878000 -- (-995.119) [-995.813] (-998.803) (-994.777) * (-995.789) (-996.875) [-994.917] (-1001.721) -- 0:00:07
878500 -- (-997.667) (-1001.978) [-997.725] (-996.012) * (-998.027) [-995.874] (-995.632) (-995.355) -- 0:00:07
879000 -- (-998.367) [-999.123] (-998.312) (-994.402) * (-997.020) (-995.378) [-995.138] (-997.122) -- 0:00:07
879500 -- (-996.526) (-996.863) (-994.162) [-993.749] * (-994.943) (-996.878) [-995.989] (-996.121) -- 0:00:07
880000 -- (-995.863) [-995.163] (-994.709) (-997.501) * [-995.647] (-1001.317) (-995.682) (-994.216) -- 0:00:07
Average standard deviation of split frequencies: 0.006923
880500 -- (-995.584) [-993.675] (-994.540) (-998.191) * (-997.131) (-997.824) [-994.634] (-993.811) -- 0:00:07
881000 -- (-1000.049) (-994.252) (-996.007) [-996.199] * (-996.647) (-997.438) (-994.119) [-994.548] -- 0:00:07
881500 -- (-996.503) (-993.984) [-1003.268] (-996.804) * (-995.651) (-998.833) (-995.047) [-996.752] -- 0:00:07
882000 -- [-994.826] (-993.967) (-995.277) (-995.768) * [-996.884] (-996.164) (-994.695) (-996.695) -- 0:00:07
882500 -- [-994.607] (-993.809) (-994.683) (-996.683) * (-995.060) (-997.366) (-995.309) [-997.732] -- 0:00:07
883000 -- (-999.918) (-997.339) (-996.380) [-995.447] * [-995.639] (-995.440) (-995.136) (-994.896) -- 0:00:07
883500 -- (-995.840) (-998.132) (-995.111) [-994.163] * (-996.600) (-996.396) (-994.076) [-996.911] -- 0:00:07
884000 -- [-995.472] (-995.490) (-995.407) (-1000.634) * [-997.713] (-997.739) (-995.905) (-997.828) -- 0:00:07
884500 -- (-997.048) (-993.963) (-995.462) [-996.412] * (-995.473) (-999.983) (-996.995) [-997.979] -- 0:00:07
885000 -- (-995.459) (-994.398) (-998.509) [-994.854] * (-994.687) (-994.507) [-998.818] (-996.694) -- 0:00:07
Average standard deviation of split frequencies: 0.006810
885500 -- [-994.336] (-994.566) (-998.796) (-993.988) * (-996.042) (-996.555) [-995.235] (-996.842) -- 0:00:06
886000 -- [-995.768] (-994.100) (-995.483) (-995.788) * (-998.573) [-993.965] (-1001.852) (-995.712) -- 0:00:06
886500 -- (-998.633) [-994.750] (-994.975) (-999.780) * (-996.299) (-995.648) (-996.411) [-997.169] -- 0:00:06
887000 -- (-994.688) [-996.638] (-993.987) (-995.670) * (-995.712) [-995.848] (-995.554) (-996.332) -- 0:00:06
887500 -- (-998.802) (-998.190) (-994.756) [-996.314] * (-995.837) (-998.340) [-995.388] (-995.844) -- 0:00:06
888000 -- (-1002.202) (-996.810) (-995.918) [-998.858] * [-996.087] (-994.780) (-994.571) (-996.877) -- 0:00:06
888500 -- [-999.152] (-996.565) (-1000.952) (-994.750) * (-993.948) (-994.842) [-995.018] (-996.791) -- 0:00:06
889000 -- [-1003.400] (-998.358) (-998.371) (-994.073) * [-994.601] (-995.968) (-996.729) (-995.350) -- 0:00:06
889500 -- (-996.437) [-995.976] (-994.922) (-997.299) * (-994.454) (-995.539) (-995.717) [-994.852] -- 0:00:06
890000 -- (-997.075) [-994.967] (-995.315) (-995.283) * (-993.563) (-998.169) [-995.223] (-994.424) -- 0:00:06
Average standard deviation of split frequencies: 0.006739
890500 -- (-995.994) (-994.574) (-999.413) [-993.842] * (-993.966) (-997.235) (-994.303) [-994.544] -- 0:00:06
891000 -- (-995.476) (-995.210) (-994.653) [-994.966] * (-995.573) (-995.665) (-998.799) [-994.458] -- 0:00:06
891500 -- (-995.652) (-998.390) [-994.952] (-996.666) * (-998.048) (-996.139) (-997.431) [-997.335] -- 0:00:06
892000 -- [-995.254] (-1003.024) (-1000.867) (-995.125) * (-1001.349) (-998.234) (-995.018) [-994.928] -- 0:00:06
892500 -- (-1001.060) (-1003.923) (-998.106) [-993.753] * (-996.242) (-998.289) (-998.460) [-993.810] -- 0:00:06
893000 -- (-997.233) (-1004.991) [-1001.064] (-994.564) * (-997.217) [-995.968] (-999.473) (-996.081) -- 0:00:06
893500 -- (-994.468) (-1002.413) [-995.522] (-998.706) * (-997.725) (-994.706) (-999.479) [-995.540] -- 0:00:06
894000 -- (-994.343) [-1000.906] (-993.968) (-994.237) * [-998.486] (-994.611) (-997.308) (-997.505) -- 0:00:06
894500 -- [-993.811] (-1000.669) (-993.985) (-994.249) * (-998.464) [-996.373] (-995.965) (-995.093) -- 0:00:06
895000 -- (-997.291) (-995.520) [-993.868] (-993.790) * (-998.037) [-994.588] (-996.219) (-994.286) -- 0:00:06
Average standard deviation of split frequencies: 0.006629
895500 -- (-994.926) (-995.970) (-995.464) [-994.120] * (-996.490) [-993.995] (-995.298) (-996.391) -- 0:00:06
896000 -- (-997.994) (-998.677) (-994.691) [-993.668] * (-996.325) [-995.399] (-996.530) (-997.295) -- 0:00:06
896500 -- [-993.870] (-994.049) (-994.411) (-993.975) * (-994.401) [-995.582] (-994.928) (-994.787) -- 0:00:06
897000 -- (-995.189) (-997.037) (-996.099) [-993.858] * (-997.126) (-995.817) (-996.040) [-996.857] -- 0:00:06
897500 -- (-996.554) (-999.637) (-1000.922) [-996.108] * [-996.193] (-997.056) (-997.188) (-1003.061) -- 0:00:06
898000 -- (-998.302) (-995.432) (-1003.812) [-995.594] * [-994.014] (-995.995) (-1003.475) (-997.435) -- 0:00:06
898500 -- [-994.743] (-997.603) (-998.375) (-997.731) * (-994.107) (-994.593) [-994.511] (-999.632) -- 0:00:06
899000 -- [-994.555] (-995.681) (-998.593) (-993.931) * [-996.416] (-996.709) (-997.489) (-996.628) -- 0:00:06
899500 -- (-993.821) (-995.419) (-995.091) [-995.198] * (-996.708) [-995.471] (-1004.164) (-999.133) -- 0:00:06
900000 -- (-996.126) [-996.729] (-997.289) (-996.103) * (-995.528) [-994.941] (-999.100) (-995.280) -- 0:00:06
Average standard deviation of split frequencies: 0.006455
900500 -- (-997.238) (-995.243) [-998.160] (-997.064) * [-995.441] (-995.755) (-999.676) (-994.750) -- 0:00:06
901000 -- (-998.100) (-995.254) (-994.555) [-995.940] * (-995.326) [-994.701] (-994.595) (-995.582) -- 0:00:06
901500 -- (-996.294) (-994.831) (-999.249) [-994.902] * (-995.831) [-993.838] (-993.927) (-995.485) -- 0:00:06
902000 -- (-995.730) [-994.243] (-997.045) (-996.139) * (-995.797) (-995.841) (-994.055) [-994.563] -- 0:00:05
902500 -- (-996.594) (-996.707) (-998.089) [-994.713] * [-995.436] (-995.939) (-994.287) (-995.240) -- 0:00:05
903000 -- (-994.715) [-997.161] (-995.829) (-997.497) * (-994.253) (-995.927) (-994.667) [-998.064] -- 0:00:05
903500 -- (-995.336) [-994.542] (-996.003) (-997.595) * (-995.358) (-999.688) (-994.424) [-997.896] -- 0:00:05
904000 -- (-998.985) [-994.344] (-998.687) (-999.980) * [-994.111] (-999.637) (-994.763) (-997.960) -- 0:00:05
904500 -- [-997.119] (-994.763) (-1000.690) (-999.026) * (-994.098) [-994.423] (-994.347) (-995.103) -- 0:00:05
905000 -- (-994.145) (-995.652) (-995.905) [-999.348] * (-995.590) (-996.889) [-997.085] (-996.029) -- 0:00:05
Average standard deviation of split frequencies: 0.006903
905500 -- (-997.120) (-999.212) (-996.748) [-998.502] * [-995.562] (-996.035) (-995.723) (-995.550) -- 0:00:05
906000 -- (-996.152) [-996.095] (-995.875) (-998.329) * (-996.092) (-996.821) [-994.176] (-999.361) -- 0:00:05
906500 -- (-995.579) [-998.532] (-995.841) (-996.923) * (-998.392) (-999.911) [-994.662] (-999.577) -- 0:00:05
907000 -- (-996.586) (-997.410) [-996.043] (-996.917) * (-997.607) (-995.211) (-994.878) [-996.155] -- 0:00:05
907500 -- (-994.525) [-995.968] (-994.912) (-994.244) * (-996.453) [-993.922] (-994.032) (-994.397) -- 0:00:05
908000 -- (-995.019) (-994.779) (-994.796) [-996.028] * (-995.020) (-994.543) (-995.994) [-998.179] -- 0:00:05
908500 -- (-994.908) (-999.414) (-994.428) [-996.139] * (-996.051) (-993.690) [-996.956] (-996.895) -- 0:00:05
909000 -- (-996.399) (-994.138) [-995.246] (-997.484) * (-1003.195) (-993.704) (-997.766) [-995.459] -- 0:00:05
909500 -- (-997.099) (-995.994) (-995.969) [-998.100] * [-995.653] (-996.652) (-995.595) (-995.179) -- 0:00:05
910000 -- (-999.364) [-998.803] (-996.487) (-994.483) * [-994.768] (-994.438) (-993.972) (-996.255) -- 0:00:05
Average standard deviation of split frequencies: 0.006557
910500 -- (-996.821) [-996.795] (-993.914) (-995.617) * (-994.339) [-995.532] (-994.361) (-995.727) -- 0:00:05
911000 -- (-997.006) (-995.203) (-996.855) [-994.316] * (-994.707) (-995.029) [-994.392] (-996.617) -- 0:00:05
911500 -- (-1000.460) [-998.675] (-994.851) (-995.217) * (-996.355) (-994.108) (-1007.412) [-995.201] -- 0:00:05
912000 -- (-996.641) [-994.364] (-994.768) (-994.399) * [-996.814] (-997.118) (-1002.225) (-997.462) -- 0:00:05
912500 -- (-996.304) (-994.333) [-995.306] (-994.966) * (-996.432) (-994.503) [-995.404] (-998.029) -- 0:00:05
913000 -- (-995.520) (-994.813) (-997.141) [-997.028] * [-995.648] (-999.046) (-995.950) (-997.126) -- 0:00:05
913500 -- (-994.811) [-995.359] (-995.944) (-997.532) * (-998.906) (-999.811) (-996.384) [-998.879] -- 0:00:05
914000 -- (-995.767) (-995.304) (-999.525) [-995.613] * [-996.827] (-999.985) (-994.637) (-996.796) -- 0:00:05
914500 -- (-996.178) (-995.637) [-996.810] (-995.348) * (-998.835) (-1004.651) [-995.753] (-998.282) -- 0:00:05
915000 -- (-996.603) (-997.758) [-996.653] (-995.261) * [-995.767] (-997.321) (-995.105) (-999.221) -- 0:00:05
Average standard deviation of split frequencies: 0.006450
915500 -- (-993.650) (-999.351) [-995.062] (-996.864) * (-995.342) (-995.664) [-995.324] (-997.253) -- 0:00:05
916000 -- [-996.704] (-995.274) (-994.384) (-994.272) * (-995.015) (-996.012) [-995.477] (-995.836) -- 0:00:05
916500 -- [-994.135] (-995.710) (-996.434) (-995.089) * (-993.798) [-996.405] (-996.542) (-996.030) -- 0:00:05
917000 -- (-994.199) (-996.472) (-995.983) [-994.414] * (-994.185) (-995.240) (-1001.184) [-996.330] -- 0:00:05
917500 -- (-997.854) [-996.149] (-996.130) (-997.716) * (-994.407) (-996.332) (-996.416) [-998.452] -- 0:00:05
918000 -- (-1002.094) [-996.661] (-996.793) (-993.971) * [-994.109] (-994.815) (-996.383) (-994.671) -- 0:00:05
918500 -- (-994.408) [-995.313] (-995.441) (-996.256) * (-994.149) [-994.761] (-993.832) (-997.813) -- 0:00:04
919000 -- [-994.635] (-995.772) (-997.265) (-995.595) * (-994.846) (-995.452) [-993.815] (-997.661) -- 0:00:04
919500 -- [-996.185] (-998.411) (-997.515) (-995.404) * (-998.218) (-994.929) [-994.900] (-994.022) -- 0:00:04
920000 -- [-995.245] (-996.588) (-995.125) (-995.725) * (-996.084) (-994.857) [-994.652] (-995.525) -- 0:00:04
Average standard deviation of split frequencies: 0.006827
920500 -- (-993.568) (-995.913) (-994.954) [-993.934] * (-994.334) [-994.230] (-994.782) (-997.669) -- 0:00:04
921000 -- (-993.896) (-994.933) (-994.698) [-993.850] * (-994.500) (-998.661) (-996.849) [-1000.974] -- 0:00:04
921500 -- [-994.676] (-995.261) (-995.992) (-995.731) * (-995.319) [-996.685] (-995.288) (-999.697) -- 0:00:04
922000 -- (-996.507) (-995.394) (-997.732) [-995.932] * (-994.861) (-996.315) (-996.621) [-999.437] -- 0:00:04
922500 -- (-1000.090) [-996.326] (-994.720) (-997.144) * [-996.731] (-994.611) (-999.667) (-998.128) -- 0:00:04
923000 -- (-998.958) (-995.743) (-996.905) [-995.426] * [-994.479] (-996.196) (-1000.837) (-996.350) -- 0:00:04
923500 -- (-995.085) (-997.333) [-996.911] (-994.708) * (-996.555) [-997.135] (-995.973) (-995.678) -- 0:00:04
924000 -- (-997.065) (-998.697) (-999.163) [-996.301] * (-995.574) [-998.305] (-997.400) (-998.418) -- 0:00:04
924500 -- (-995.520) (-995.909) (-995.794) [-995.315] * (-996.392) (-996.313) (-995.308) [-995.492] -- 0:00:04
925000 -- (-997.261) (-995.634) [-996.274] (-994.804) * [-996.524] (-995.439) (-995.965) (-995.070) -- 0:00:04
Average standard deviation of split frequencies: 0.006788
925500 -- (-1001.078) [-995.735] (-994.228) (-995.099) * [-995.733] (-995.183) (-994.962) (-996.177) -- 0:00:04
926000 -- (-994.603) (-1000.429) (-994.360) [-994.210] * (-994.767) (-995.339) (-994.940) [-998.321] -- 0:00:04
926500 -- (-998.404) [-994.799] (-994.332) (-996.813) * [-998.115] (-999.134) (-1000.888) (-994.143) -- 0:00:04
927000 -- (-994.635) [-997.309] (-995.579) (-995.104) * (-994.400) [-1000.601] (-997.142) (-994.165) -- 0:00:04
927500 -- (-995.204) (-999.094) (-994.843) [-996.501] * (-997.079) (-998.875) (-996.651) [-995.550] -- 0:00:04
928000 -- (-994.861) (-995.203) (-998.579) [-995.095] * (-995.553) (-996.382) [-994.731] (-997.357) -- 0:00:04
928500 -- [-997.085] (-997.242) (-996.518) (-996.119) * (-996.330) [-1000.466] (-994.673) (-995.228) -- 0:00:04
929000 -- [-994.498] (-994.672) (-995.699) (-997.260) * (-997.354) (-998.235) [-993.846] (-993.635) -- 0:00:04
929500 -- (-995.366) [-994.798] (-995.000) (-1001.827) * [-997.103] (-995.480) (-997.464) (-995.981) -- 0:00:04
930000 -- (-994.751) (-994.358) [-995.795] (-996.645) * (-994.356) [-995.269] (-996.382) (-994.350) -- 0:00:04
Average standard deviation of split frequencies: 0.006686
930500 -- (-994.083) (-996.689) [-995.422] (-998.240) * (-995.468) (-997.084) [-995.549] (-995.909) -- 0:00:04
931000 -- (-996.838) [-999.107] (-996.009) (-997.565) * (-994.433) (-994.923) (-996.350) [-999.078] -- 0:00:04
931500 -- (-996.198) [-995.206] (-997.497) (-994.367) * [-997.720] (-996.178) (-996.683) (-1001.496) -- 0:00:04
932000 -- [-995.931] (-995.091) (-995.099) (-995.104) * (-994.543) (-996.514) [-994.543] (-1003.212) -- 0:00:04
932500 -- (-996.990) (-994.448) (-999.158) [-995.595] * (-994.554) [-996.024] (-995.589) (-996.926) -- 0:00:04
933000 -- [-996.840] (-998.332) (-998.806) (-994.686) * [-996.164] (-994.476) (-995.472) (-1000.015) -- 0:00:04
933500 -- (-1001.553) [-996.046] (-995.492) (-996.163) * [-994.838] (-995.519) (-995.838) (-997.469) -- 0:00:04
934000 -- (-999.781) (-996.465) (-996.021) [-995.467] * (-996.761) (-995.381) [-995.169] (-995.577) -- 0:00:04
934500 -- (-994.137) (-996.157) [-995.243] (-994.827) * [-997.944] (-993.714) (-998.430) (-998.384) -- 0:00:03
935000 -- [-995.527] (-995.557) (-995.658) (-996.717) * (-998.384) (-1000.995) [-999.550] (-999.019) -- 0:00:03
Average standard deviation of split frequencies: 0.006614
935500 -- [-995.083] (-998.178) (-998.173) (-997.559) * (-996.834) [-996.608] (-995.779) (-994.987) -- 0:00:03
936000 -- (-997.182) (-997.610) [-998.052] (-998.297) * (-995.869) (-995.297) [-996.381] (-997.047) -- 0:00:03
936500 -- (-994.651) (-996.474) [-997.089] (-997.217) * (-996.417) (-995.975) [-997.255] (-996.898) -- 0:00:03
937000 -- (-995.365) (-994.905) (-998.511) [-998.441] * (-994.150) (-994.532) [-996.690] (-996.215) -- 0:00:03
937500 -- (-994.712) [-995.968] (-995.955) (-996.782) * (-994.377) (-994.672) [-999.090] (-996.965) -- 0:00:03
938000 -- (-994.440) (-1000.400) (-995.894) [-996.608] * [-994.441] (-996.867) (-998.261) (-995.295) -- 0:00:03
938500 -- [-995.384] (-995.825) (-995.019) (-996.538) * [-993.558] (-996.313) (-999.731) (-993.935) -- 0:00:03
939000 -- (-996.466) [-995.325] (-995.048) (-995.395) * (-995.519) (-994.403) [-998.278] (-1000.008) -- 0:00:03
939500 -- (-996.052) [-995.393] (-995.757) (-997.518) * (-997.583) (-993.774) (-996.028) [-993.727] -- 0:00:03
940000 -- [-993.538] (-998.616) (-995.869) (-995.365) * (-995.716) [-994.110] (-995.989) (-995.609) -- 0:00:03
Average standard deviation of split frequencies: 0.006749
940500 -- (-994.065) (-995.086) [-994.618] (-996.185) * (-996.450) [-995.004] (-995.661) (-996.714) -- 0:00:03
941000 -- (-997.699) (-995.290) [-994.434] (-994.386) * (-1000.970) (-994.639) (-995.849) [-998.191] -- 0:00:03
941500 -- (-996.717) (-994.212) [-995.691] (-995.065) * (-999.137) [-994.869] (-996.004) (-995.760) -- 0:00:03
942000 -- (-1000.697) [-994.573] (-994.351) (-994.236) * (-997.222) [-995.963] (-997.693) (-995.790) -- 0:00:03
942500 -- (-996.028) (-996.614) (-995.269) [-994.086] * (-996.613) (-996.332) [-994.101] (-994.769) -- 0:00:03
943000 -- (-996.857) (-996.439) [-997.023] (-996.913) * [-995.476] (-997.708) (-999.583) (-1000.092) -- 0:00:03
943500 -- (-995.685) [-995.656] (-998.034) (-999.393) * (-996.012) (-996.586) [-997.223] (-995.322) -- 0:00:03
944000 -- (-994.863) [-995.510] (-995.307) (-999.492) * (-996.461) [-996.371] (-995.127) (-996.025) -- 0:00:03
944500 -- (-995.063) [-995.726] (-994.769) (-1002.505) * (-995.759) (-995.836) [-996.453] (-996.466) -- 0:00:03
945000 -- (-1000.225) (-1000.281) (-997.178) [-994.163] * (-995.552) (-994.566) (-1000.468) [-999.901] -- 0:00:03
Average standard deviation of split frequencies: 0.006844
945500 -- (-997.217) (-995.903) (-994.305) [-993.777] * [-993.760] (-994.718) (-996.692) (-996.355) -- 0:00:03
946000 -- (-996.406) (-996.826) (-994.680) [-994.184] * (-993.761) (-994.031) (-994.276) [-996.601] -- 0:00:03
946500 -- (-995.671) (-995.335) [-995.269] (-996.449) * (-994.391) (-994.639) (-994.076) [-996.830] -- 0:00:03
947000 -- (-995.691) (-998.642) [-996.931] (-997.267) * (-1000.458) [-996.274] (-994.725) (-994.590) -- 0:00:03
947500 -- [-993.905] (-994.522) (-995.074) (-995.635) * (-995.205) (-996.204) (-996.634) [-995.161] -- 0:00:03
948000 -- (-993.880) (-995.676) [-995.805] (-999.470) * [-995.865] (-995.280) (-998.125) (-994.376) -- 0:00:03
948500 -- (-994.974) [-997.280] (-999.208) (-996.293) * (-994.096) (-997.439) [-995.983] (-994.167) -- 0:00:03
949000 -- (-995.205) (-996.059) (-995.577) [-997.078] * [-995.561] (-998.770) (-994.744) (-993.689) -- 0:00:03
949500 -- (-998.566) (-997.308) [-995.267] (-994.421) * (-995.852) (-998.573) (-993.752) [-996.402] -- 0:00:03
950000 -- (-996.246) [-995.274] (-995.824) (-998.784) * [-996.073] (-995.613) (-995.573) (-994.853) -- 0:00:03
Average standard deviation of split frequencies: 0.006612
950500 -- [-995.578] (-999.688) (-995.520) (-996.051) * (-993.837) (-994.228) [-995.591] (-994.495) -- 0:00:03
951000 -- (-999.122) (-995.104) (-994.392) [-994.830] * (-993.899) [-993.860] (-996.771) (-995.550) -- 0:00:02
951500 -- (-994.150) [-994.435] (-995.761) (-994.288) * [-994.783] (-994.110) (-996.749) (-997.996) -- 0:00:02
952000 -- (-997.147) [-997.521] (-995.219) (-997.642) * (-996.410) (-997.724) (-994.199) [-995.641] -- 0:00:02
952500 -- (-994.266) (-996.079) [-994.496] (-1000.140) * (-996.806) (-994.926) (-994.583) [-993.599] -- 0:00:02
953000 -- [-994.552] (-996.747) (-995.179) (-994.225) * (-999.931) (-996.619) [-997.116] (-994.356) -- 0:00:02
953500 -- (-994.760) [-995.783] (-995.137) (-995.138) * (-996.764) (-994.785) (-995.969) [-995.208] -- 0:00:02
954000 -- (-995.091) (-996.109) [-995.719] (-996.250) * (-995.016) (-995.246) (-997.365) [-995.844] -- 0:00:02
954500 -- (-996.373) (-994.402) (-1002.045) [-998.584] * (-995.563) (-999.222) [-995.117] (-997.588) -- 0:00:02
955000 -- (-994.899) (-994.223) (-997.400) [-995.420] * (-994.358) [-996.278] (-998.123) (-995.637) -- 0:00:02
Average standard deviation of split frequencies: 0.006575
955500 -- [-995.657] (-996.762) (-997.250) (-994.891) * (-994.912) (-997.437) [-995.003] (-994.455) -- 0:00:02
956000 -- (-1001.755) (-997.346) (-994.746) [-994.443] * (-997.354) (-997.086) [-993.990] (-994.611) -- 0:00:02
956500 -- (-994.122) (-999.101) [-995.996] (-996.506) * (-996.800) (-997.320) [-993.557] (-995.468) -- 0:00:02
957000 -- (-996.724) (-996.690) [-994.644] (-996.411) * (-996.215) (-995.101) [-997.941] (-995.864) -- 0:00:02
957500 -- (-996.585) [-996.469] (-996.175) (-994.435) * (-994.542) [-993.982] (-997.534) (-995.404) -- 0:00:02
958000 -- (-998.521) [-994.476] (-994.899) (-994.861) * (-995.411) (-995.101) (-1001.840) [-995.197] -- 0:00:02
958500 -- (-994.731) [-995.483] (-995.107) (-995.717) * [-994.262] (-997.827) (-1002.547) (-995.229) -- 0:00:02
959000 -- (-994.074) (-995.444) (-994.891) [-996.991] * (-996.234) (-995.480) [-996.973] (-998.049) -- 0:00:02
959500 -- (-994.333) (-997.905) (-999.158) [-996.892] * (-998.148) (-996.381) [-994.128] (-1000.776) -- 0:00:02
960000 -- (-994.056) (-996.906) (-994.380) [-998.502] * (-996.781) [-995.154] (-994.915) (-994.483) -- 0:00:02
Average standard deviation of split frequencies: 0.006510
960500 -- (-995.626) (-995.930) (-995.889) [-996.336] * (-995.760) (-995.002) (-997.311) [-999.630] -- 0:00:02
961000 -- (-994.922) (-998.807) (-994.330) [-995.644] * (-995.523) (-995.917) [-996.316] (-996.854) -- 0:00:02
961500 -- (-998.328) (-996.264) (-994.574) [-994.214] * (-994.970) (-997.115) (-996.367) [-993.859] -- 0:00:02
962000 -- (-996.507) (-994.214) (-995.298) [-994.515] * [-994.380] (-997.015) (-998.909) (-994.818) -- 0:00:02
962500 -- (-997.103) (-995.272) (-996.244) [-999.594] * (-994.760) [-994.310] (-995.375) (-994.483) -- 0:00:02
963000 -- (-994.636) [-996.179] (-995.406) (-998.308) * (-996.104) [-995.182] (-993.985) (-994.232) -- 0:00:02
963500 -- [-994.166] (-996.492) (-995.181) (-995.062) * (-999.075) (-995.676) [-994.396] (-993.989) -- 0:00:02
964000 -- [-994.863] (-996.348) (-994.249) (-1000.806) * (-996.808) (-997.465) [-994.419] (-996.096) -- 0:00:02
964500 -- (-1001.740) (-996.824) [-994.521] (-999.310) * [-995.505] (-994.327) (-994.208) (-995.929) -- 0:00:02
965000 -- (-997.966) (-997.303) (-994.455) [-996.393] * [-994.474] (-994.104) (-996.031) (-996.225) -- 0:00:02
Average standard deviation of split frequencies: 0.006832
965500 -- [-996.476] (-996.325) (-998.575) (-996.195) * (-995.891) [-993.821] (-998.001) (-995.468) -- 0:00:02
966000 -- (-996.901) [-994.539] (-995.656) (-995.732) * (-996.048) (-996.476) (-994.744) [-995.261] -- 0:00:02
966500 -- [-997.985] (-995.950) (-996.690) (-997.052) * [-996.083] (-995.141) (-996.259) (-994.807) -- 0:00:02
967000 -- (-999.172) [-997.197] (-996.865) (-995.604) * (-995.875) [-995.671] (-995.495) (-998.685) -- 0:00:02
967500 -- (-996.255) (-995.490) [-998.610] (-996.387) * [-996.271] (-995.593) (-994.137) (-995.389) -- 0:00:01
968000 -- (-997.431) (-997.398) (-999.557) [-997.098] * (-993.608) [-996.900] (-994.828) (-994.959) -- 0:00:01
968500 -- [-995.931] (-996.419) (-995.667) (-997.151) * (-996.437) (-994.253) [-995.988] (-998.186) -- 0:00:01
969000 -- [-994.994] (-996.533) (-994.773) (-995.244) * (-996.213) [-994.117] (-996.423) (-998.051) -- 0:00:01
969500 -- (-994.367) (-996.487) [-995.067] (-1002.634) * (-997.406) (-994.851) (-999.141) [-994.748] -- 0:00:01
970000 -- (-996.383) (-995.292) [-996.886] (-994.051) * (-996.492) [-999.192] (-995.911) (-995.127) -- 0:00:01
Average standard deviation of split frequencies: 0.006929
970500 -- (-994.529) [-994.602] (-997.420) (-995.640) * [-995.720] (-998.440) (-995.949) (-994.116) -- 0:00:01
971000 -- [-994.009] (-995.178) (-997.866) (-994.902) * (-995.411) [-994.553] (-994.368) (-996.818) -- 0:00:01
971500 -- (-994.321) (-994.883) [-996.130] (-994.132) * (-996.633) (-997.202) [-995.047] (-998.166) -- 0:00:01
972000 -- (-994.087) [-996.879] (-995.217) (-996.753) * (-996.451) (-995.301) (-994.361) [-997.560] -- 0:00:01
972500 -- (-995.990) (-995.461) (-996.946) [-997.705] * (-995.139) (-995.203) [-996.037] (-996.633) -- 0:00:01
973000 -- (-996.240) (-994.692) [-994.131] (-998.133) * [-996.812] (-995.765) (-994.855) (-994.198) -- 0:00:01
973500 -- (-995.831) [-997.184] (-996.082) (-997.018) * [-995.694] (-995.599) (-994.823) (-993.919) -- 0:00:01
974000 -- (-995.928) (-994.480) [-993.596] (-996.175) * [-993.915] (-995.402) (-998.546) (-995.844) -- 0:00:01
974500 -- (-999.685) [-996.978] (-994.854) (-995.080) * [-993.915] (-995.050) (-998.143) (-995.024) -- 0:00:01
975000 -- [-994.478] (-995.372) (-996.172) (-995.682) * [-995.410] (-995.765) (-997.013) (-999.238) -- 0:00:01
Average standard deviation of split frequencies: 0.007052
975500 -- (-995.077) (-993.995) [-997.391] (-996.681) * (-995.082) (-996.357) (-997.710) [-996.557] -- 0:00:01
976000 -- [-994.761] (-995.490) (-996.113) (-994.381) * (-994.984) (-999.134) (-994.680) [-995.021] -- 0:00:01
976500 -- (-994.317) (-995.301) (-996.814) [-996.242] * (-1003.043) (-996.529) [-1001.521] (-996.331) -- 0:00:01
977000 -- (-995.052) (-993.908) (-997.420) [-996.039] * (-998.444) [-995.231] (-996.871) (-995.813) -- 0:00:01
977500 -- [-995.544] (-998.246) (-995.683) (-994.495) * (-996.122) (-996.557) (-997.321) [-997.441] -- 0:00:01
978000 -- (-995.579) [-995.214] (-997.094) (-994.029) * (-1000.594) (-997.696) (-996.388) [-996.237] -- 0:00:01
978500 -- (-994.771) (-995.100) (-994.535) [-1002.790] * (-995.153) [-998.673] (-996.097) (-996.247) -- 0:00:01
979000 -- (-994.890) (-997.144) (-996.143) [-998.314] * (-995.817) [-994.370] (-996.629) (-996.982) -- 0:00:01
979500 -- (-996.052) [-994.038] (-996.562) (-994.571) * (-996.305) (-994.520) (-997.609) [-995.057] -- 0:00:01
980000 -- (-995.317) [-997.571] (-997.787) (-997.736) * [-995.371] (-994.685) (-996.448) (-994.115) -- 0:00:01
Average standard deviation of split frequencies: 0.007435
980500 -- (-997.293) (-998.914) (-997.322) [-994.593] * (-994.668) (-994.662) [-996.649] (-994.260) -- 0:00:01
981000 -- (-998.068) [-998.666] (-994.652) (-993.725) * (-998.101) [-995.047] (-997.530) (-996.997) -- 0:00:01
981500 -- (-996.643) (-1001.370) [-994.612] (-997.448) * [-997.327] (-994.202) (-998.465) (-996.279) -- 0:00:01
982000 -- (-997.333) (-998.505) (-994.682) [-993.805] * [-994.520] (-996.234) (-995.337) (-995.055) -- 0:00:01
982500 -- (-994.980) (-998.347) [-994.285] (-995.026) * (-995.385) (-998.399) (-994.494) [-996.026] -- 0:00:01
983000 -- (-995.532) [-994.713] (-996.047) (-997.633) * (-995.209) (-995.319) [-995.030] (-996.260) -- 0:00:01
983500 -- (-995.529) (-994.485) (-995.259) [-994.177] * [-994.601] (-997.483) (-998.218) (-994.285) -- 0:00:01
984000 -- (-995.796) [-996.161] (-994.879) (-994.178) * (-995.054) (-994.062) (-994.614) [-994.997] -- 0:00:00
984500 -- (-998.478) [-995.711] (-995.743) (-996.673) * (-995.203) (-994.326) [-995.392] (-995.956) -- 0:00:00
985000 -- (-997.480) (-998.124) (-993.918) [-995.914] * (-998.077) (-995.798) [-994.011] (-997.890) -- 0:00:00
Average standard deviation of split frequencies: 0.007586
985500 -- [-994.107] (-998.754) (-995.901) (-996.969) * [-996.537] (-995.945) (-994.660) (-997.235) -- 0:00:00
986000 -- (-994.404) (-997.735) (-995.007) [-995.584] * [-994.226] (-995.044) (-997.841) (-995.581) -- 0:00:00
986500 -- (-996.970) (-997.155) [-996.325] (-996.106) * (-999.100) (-997.011) [-995.500] (-996.867) -- 0:00:00
987000 -- (-995.626) (-993.614) [-994.233] (-995.728) * (-999.234) [-995.185] (-996.202) (-997.313) -- 0:00:00
987500 -- (-997.200) [-999.136] (-996.097) (-994.291) * (-996.440) (-996.359) [-995.335] (-994.063) -- 0:00:00
988000 -- (-994.608) (-997.262) (-994.769) [-995.277] * (-993.891) (-994.740) (-997.979) [-994.245] -- 0:00:00
988500 -- (-994.128) [-995.649] (-995.059) (-994.246) * (-995.118) (-993.819) (-996.524) [-997.508] -- 0:00:00
989000 -- (-994.101) (-1001.965) [-996.116] (-994.319) * (-994.425) (-997.141) (-995.149) [-995.079] -- 0:00:00
989500 -- (-995.469) (-1002.581) [-994.792] (-995.265) * (-995.453) (-1000.054) (-996.024) [-995.890] -- 0:00:00
990000 -- (-999.493) [-995.791] (-996.895) (-998.772) * (-995.990) (-995.384) (-995.994) [-994.237] -- 0:00:00
Average standard deviation of split frequencies: 0.007550
990500 -- (-997.679) [-995.872] (-995.840) (-995.813) * (-993.933) (-996.276) [-994.609] (-999.370) -- 0:00:00
991000 -- (-999.249) (-994.577) (-995.919) [-994.926] * (-996.493) [-996.191] (-998.826) (-998.532) -- 0:00:00
991500 -- (-997.874) (-997.790) [-997.215] (-999.204) * (-996.713) (-998.297) [-993.722] (-996.554) -- 0:00:00
992000 -- (-995.775) (-994.072) (-995.520) [-998.896] * (-996.412) (-996.617) [-994.991] (-995.763) -- 0:00:00
992500 -- (-995.463) (-996.912) [-996.283] (-1000.364) * [-999.104] (-998.816) (-997.160) (-995.606) -- 0:00:00
993000 -- (-995.501) (-995.407) [-997.238] (-993.958) * (-997.683) [-999.122] (-995.645) (-995.586) -- 0:00:00
993500 -- [-996.073] (-998.081) (-993.630) (-995.285) * (-994.842) (-994.581) [-998.680] (-997.562) -- 0:00:00
994000 -- [-995.779] (-996.884) (-995.941) (-996.970) * (-995.037) (-994.163) [-996.313] (-1000.556) -- 0:00:00
994500 -- (-994.798) (-995.228) (-997.571) [-998.174] * (-997.584) (-994.636) [-999.418] (-997.655) -- 0:00:00
995000 -- (-993.782) [-997.439] (-995.617) (-996.299) * (-996.478) (-995.695) [-996.575] (-996.700) -- 0:00:00
Average standard deviation of split frequencies: 0.007667
995500 -- (-994.307) (-994.691) (-995.173) [-997.320] * [-997.111] (-997.060) (-995.308) (-998.318) -- 0:00:00
996000 -- [-994.733] (-997.761) (-995.175) (-1000.513) * (-996.153) (-998.702) (-999.308) [-996.771] -- 0:00:00
996500 -- (-996.218) (-995.695) (-996.906) [-995.413] * (-994.879) (-998.950) [-993.894] (-996.592) -- 0:00:00
997000 -- (-998.708) (-996.206) [-996.024] (-996.531) * (-997.801) (-996.701) (-994.504) [-997.954] -- 0:00:00
997500 -- (-994.046) (-996.940) [-998.220] (-995.560) * [-994.439] (-995.016) (-997.139) (-994.673) -- 0:00:00
998000 -- (-994.476) [-994.027] (-1001.440) (-996.013) * (-998.465) (-994.889) (-995.346) [-994.834] -- 0:00:00
998500 -- [-995.395] (-993.570) (-996.815) (-996.026) * (-996.627) [-995.222] (-996.480) (-997.004) -- 0:00:00
999000 -- (-997.963) (-993.739) [-996.774] (-994.762) * (-996.091) (-996.894) [-994.341] (-996.719) -- 0:00:00
999500 -- (-994.362) (-995.046) (-996.922) [-994.378] * [-1001.687] (-997.199) (-997.952) (-996.856) -- 0:00:00
1000000 -- (-994.521) (-995.578) (-998.231) [-996.660] * (-1001.516) (-994.977) (-996.331) [-996.364] -- 0:00:00
Average standard deviation of split frequencies: 0.007726
Analysis completed in 1 mins 1 seconds
Analysis used 59.26 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -993.42
Likelihood of best state for "cold" chain of run 2 was -993.42
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 80 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.2 % ( 34 %) Dirichlet(Pi{all})
29.7 % ( 24 %) Slider(Pi{all})
78.7 % ( 60 %) Multiplier(Alpha{1,2})
78.0 % ( 56 %) Multiplier(Alpha{3})
20.3 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.4 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 68 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
27.2 % ( 24 %) Dirichlet(Pi{all})
29.2 % ( 32 %) Slider(Pi{all})
78.9 % ( 49 %) Multiplier(Alpha{1,2})
78.5 % ( 59 %) Multiplier(Alpha{3})
21.2 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.2 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.1 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166743 0.82 0.66
3 | 166099 166879 0.84
4 | 167136 166480 166663
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166290 0.82 0.67
3 | 167155 166239 0.84
4 | 166780 166792 166744
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -995.10
| 2 |
| 2 |
| 2 1 2 1 2 122 |
| 1 1 2 2 2 1 2 2 |
| 1 22 1 11 1 |
| 1 2 1 * 2 1 1 11 2 2 2 1 |
| 2 2 1 2 2 22 1 2 2 1 21 211 * |
| 2 1 1 * 22 2 2 1 1 221 2 |
| 1 12 2 11 1 2 1 1 * 21 1 1 1 |
| 1 1 11 2 * 1 |
|2 12 1 2 *|
| 2 22 1 2 2 1 1 1 |
| 1 2 2 |
|1 1 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -996.79
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -995.12 -998.49
2 -995.09 -999.01
--------------------------------------
TOTAL -995.10 -998.78
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894883 0.091536 0.385920 1.510580 0.850727 1432.06 1466.53 1.000
r(A<->C){all} 0.156341 0.017032 0.000218 0.415406 0.121576 239.63 244.78 1.001
r(A<->G){all} 0.168980 0.021811 0.000057 0.471032 0.127915 347.21 422.01 1.001
r(A<->T){all} 0.167197 0.020962 0.000033 0.457504 0.121908 133.28 210.16 1.004
r(C<->G){all} 0.178584 0.021602 0.000226 0.481386 0.142206 201.65 206.27 1.000
r(C<->T){all} 0.169340 0.020376 0.000072 0.455916 0.132560 213.35 222.12 1.005
r(G<->T){all} 0.159557 0.018012 0.000025 0.425931 0.123547 242.23 290.01 1.005
pi(A){all} 0.205751 0.000218 0.177695 0.235018 0.205248 1274.95 1318.46 1.000
pi(C){all} 0.328057 0.000303 0.294854 0.361295 0.328159 1302.69 1308.52 1.000
pi(G){all} 0.274378 0.000252 0.244234 0.305897 0.274435 1256.78 1290.74 1.000
pi(T){all} 0.191814 0.000222 0.163564 0.221633 0.191422 791.18 1072.77 1.000
alpha{1,2} 0.410627 0.199828 0.000113 1.362898 0.248713 1145.47 1246.88 1.000
alpha{3} 0.457259 0.238771 0.000104 1.422236 0.302238 1194.73 1195.22 1.000
pinvar{all} 0.997862 0.000006 0.992951 0.999999 0.998664 1155.30 1168.86 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..****
8 -- ....**
9 -- .*..*.
10 -- .*.*..
11 -- ..**..
12 -- ..*.*.
13 -- ...*.*
14 -- .****.
15 -- .**.**
16 -- .***.*
17 -- ...**.
18 -- ..*..*
19 -- .*...*
20 -- .*.***
21 -- .**...
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 466 0.155230 0.001884 0.153897 0.156562 2
8 458 0.152565 0.011306 0.144570 0.160560 2
9 455 0.151566 0.007066 0.146569 0.156562 2
10 453 0.150899 0.009893 0.143904 0.157895 2
11 448 0.149234 0.006595 0.144570 0.153897 2
12 442 0.147235 0.007537 0.141905 0.152565 2
13 440 0.146569 0.023555 0.129913 0.163225 2
14 438 0.145903 0.006595 0.141239 0.150566 2
15 428 0.142572 0.003769 0.139907 0.145237 2
16 419 0.139574 0.000471 0.139241 0.139907 2
17 416 0.138574 0.014133 0.128581 0.148568 2
18 415 0.138241 0.000471 0.137908 0.138574 2
19 401 0.133578 0.002355 0.131912 0.135243 2
20 398 0.132578 0.010364 0.125250 0.139907 2
21 383 0.127582 0.009893 0.120586 0.134577 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098819 0.009691 0.000031 0.303252 0.069281 1.000 2
length{all}[2] 0.100432 0.010385 0.000024 0.292406 0.071081 1.000 2
length{all}[3] 0.101134 0.010273 0.000040 0.298499 0.070349 1.000 2
length{all}[4] 0.098413 0.010220 0.000009 0.301124 0.066225 1.000 2
length{all}[5] 0.096810 0.009555 0.000000 0.293539 0.066185 1.001 2
length{all}[6] 0.099326 0.009700 0.000145 0.298007 0.070897 1.000 2
length{all}[7] 0.100538 0.009353 0.000122 0.303738 0.075206 0.998 2
length{all}[8] 0.103753 0.010346 0.000015 0.308807 0.070146 1.000 2
length{all}[9] 0.090694 0.008604 0.000266 0.254255 0.061809 1.004 2
length{all}[10] 0.096477 0.010386 0.000038 0.295608 0.064315 1.003 2
length{all}[11] 0.099112 0.008618 0.000413 0.288635 0.071180 0.998 2
length{all}[12] 0.096927 0.010628 0.000078 0.283390 0.063119 0.999 2
length{all}[13] 0.099657 0.009412 0.000167 0.307199 0.066525 0.998 2
length{all}[14] 0.099779 0.009364 0.000082 0.275671 0.070261 1.003 2
length{all}[15] 0.107868 0.013764 0.000019 0.322917 0.072257 0.998 2
length{all}[16] 0.103021 0.010619 0.000092 0.303216 0.071742 0.998 2
length{all}[17] 0.107532 0.010906 0.000739 0.311310 0.078138 1.000 2
length{all}[18] 0.093940 0.008935 0.000096 0.286478 0.068121 1.003 2
length{all}[19] 0.105041 0.009938 0.000557 0.309809 0.073730 0.998 2
length{all}[20] 0.101950 0.010034 0.000517 0.295928 0.067075 1.000 2
length{all}[21] 0.101426 0.013109 0.000374 0.358335 0.065158 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007726
Maximum standard deviation of split frequencies = 0.023555
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 729
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 57 patterns at 243 / 243 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 57 patterns at 243 / 243 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
55632 bytes for conP
5016 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.036376 0.071619 0.048111 0.106732 0.062497 0.046312 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1059.913176
Iterating by ming2
Initial: fx= 1059.913176
x= 0.03638 0.07162 0.04811 0.10673 0.06250 0.04631 0.30000 1.30000
1 h-m-p 0.0000 0.0002 584.3108 ++ 1007.922386 m 0.0002 13 | 1/8
2 h-m-p 0.0011 0.0057 56.5168 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 536.2727 ++ 995.965079 m 0.0000 44 | 2/8
4 h-m-p 0.0005 0.0092 37.6815 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 480.0473 ++ 994.231245 m 0.0000 75 | 3/8
6 h-m-p 0.0001 0.0116 30.0960 ---------.. | 3/8
7 h-m-p 0.0000 0.0001 415.2830 ++ 983.816408 m 0.0001 104 | 4/8
8 h-m-p 0.0009 0.0155 22.7986 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 339.3962 ++ 979.400844 m 0.0000 135 | 5/8
10 h-m-p 0.0006 0.0247 14.7267 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 239.6354 ++ 970.855505 m 0.0001 166 | 6/8
12 h-m-p 1.0031 8.0000 0.0000 ++ 970.855505 m 8.0000 177 | 6/8
13 h-m-p 0.0161 8.0000 0.0029 ------Y 970.855505 0 0.0000 196 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
15 h-m-p 0.0160 8.0000 0.0000 +++++ 970.855505 m 8.0000 236 | 6/8
16 h-m-p 0.0160 8.0000 1.9949 ---------Y 970.855505 0 0.0000 258 | 6/8
17 h-m-p 0.0160 8.0000 0.0008 +++++ 970.855505 m 8.0000 272 | 6/8
18 h-m-p 0.0160 8.0000 0.4451 --------C 970.855505 0 0.0000 293 | 6/8
19 h-m-p 0.0160 8.0000 0.0000 -----------Y 970.855505 0 0.0000 317 | 6/8
20 h-m-p 0.0160 8.0000 0.0000 --------C 970.855505 0 0.0000 338
Out..
lnL = -970.855505
339 lfun, 339 eigenQcodon, 2034 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068294 0.024575 0.061316 0.068812 0.061516 0.037686 0.296424 0.568455 0.244250
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.652060
np = 9
lnL0 = -1045.334045
Iterating by ming2
Initial: fx= 1045.334045
x= 0.06829 0.02457 0.06132 0.06881 0.06152 0.03769 0.29642 0.56845 0.24425
1 h-m-p 0.0000 0.0001 545.5087 ++ 1012.147758 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0003 243.6715 ++ 996.679977 m 0.0003 26 | 2/9
3 h-m-p 0.0000 0.0000 7268.2345 ++ 974.512825 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 313.8666 ++ 974.354114 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 2066.3711 ++ 972.596180 m 0.0000 62 | 5/9
6 h-m-p 0.0031 0.0355 8.1622 ------------.. | 5/9
7 h-m-p 0.0000 0.0000 337.0186 ++ 970.969688 m 0.0000 96 | 6/9
8 h-m-p 0.0004 0.0540 8.3232 ----------.. | 6/9
9 h-m-p 0.0000 0.0000 239.4966 ++ 970.855469 m 0.0000 128 | 7/9
10 h-m-p 0.0160 8.0000 0.0000 --Y 970.855469 0 0.0003 142 | 7/9
11 h-m-p 0.6758 8.0000 0.0000 N 970.855469 0 0.3379 156
Out..
lnL = -970.855469
157 lfun, 471 eigenQcodon, 1884 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.048585 0.059337 0.048554 0.085800 0.037393 0.031446 0.270609 1.672759 0.380390 0.293311 1.420816
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.777491
np = 11
lnL0 = -1042.302009
Iterating by ming2
Initial: fx= 1042.302009
x= 0.04859 0.05934 0.04855 0.08580 0.03739 0.03145 0.27061 1.67276 0.38039 0.29331 1.42082
1 h-m-p 0.0000 0.0001 539.5452 ++ 999.889287 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0002 201.5695 ++ 992.755541 m 0.0002 30 | 2/11
3 h-m-p 0.0000 0.0000 228616.6198 ++ 982.072311 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0000 5072.7048 ++ 982.049008 m 0.0000 58 | 4/11
5 h-m-p 0.0000 0.0000 44950.0733 ++ 976.875924 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0000 7659.6109 ++ 972.040562 m 0.0000 86 | 6/11
7 h-m-p 0.0061 0.0524 5.1879 ------------.. | 6/11
8 h-m-p 0.0000 0.0000 238.1661 ++ 970.855468 m 0.0000 124 | 7/11
9 h-m-p 0.0494 8.0000 0.0000 ++++ 970.855468 m 8.0000 140 | 7/11
10 h-m-p 0.0160 8.0000 0.0133 ------Y 970.855468 0 0.0000 164 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 ----C 970.855468 0 0.0000 186 | 7/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 970.855468 m 8.0000 207 | 7/11
13 h-m-p 0.0003 0.1687 4.3679 +++++ 970.855462 m 0.1687 228 | 8/11
14 h-m-p 1.0565 8.0000 0.5266 Y 970.855461 0 0.6014 242 | 8/11
15 h-m-p 1.6000 8.0000 0.0608 Y 970.855461 0 0.7693 259 | 8/11
16 h-m-p 1.6000 8.0000 0.0008 C 970.855461 0 1.6000 276 | 8/11
17 h-m-p 1.6000 8.0000 0.0001 ++ 970.855461 m 8.0000 293 | 8/11
18 h-m-p 0.1527 8.0000 0.0071 ++C 970.855461 0 2.4429 312 | 8/11
19 h-m-p 1.6000 8.0000 0.0006 ++ 970.855461 m 8.0000 329 | 8/11
20 h-m-p 0.0160 8.0000 0.6318 +++C 970.855460 0 1.0240 349 | 8/11
21 h-m-p 1.6000 8.0000 0.0802 C 970.855460 0 1.6000 366 | 8/11
22 h-m-p 1.6000 8.0000 0.0215 Y 970.855460 0 1.0681 383 | 8/11
23 h-m-p 1.6000 8.0000 0.0003 ++ 970.855460 m 8.0000 400 | 8/11
24 h-m-p 0.5332 8.0000 0.0044 +C 970.855460 0 2.3728 418 | 8/11
25 h-m-p 1.6000 8.0000 0.0017 ++ 970.855460 m 8.0000 435 | 8/11
26 h-m-p 0.6424 8.0000 0.0216 +C 970.855460 0 3.3195 453 | 8/11
27 h-m-p 1.6000 8.0000 0.0008 ++ 970.855460 m 8.0000 470 | 8/11
28 h-m-p 0.0000 0.0015 217.1704 +++ 970.855451 m 0.0015 488 | 9/11
29 h-m-p 0.2644 8.0000 1.0922 +++ 970.855325 m 8.0000 503 | 9/11
30 h-m-p 1.6000 8.0000 0.0998 ++ 970.855325 m 8.0000 517 | 9/11
31 h-m-p 1.6000 8.0000 0.1681 ++ 970.855324 m 8.0000 533 | 9/11
32 h-m-p 1.1365 8.0000 1.1834 ++ 970.855324 m 8.0000 549 | 9/11
33 h-m-p 1.6000 8.0000 3.3427 +Y 970.855324 0 7.1927 564 | 9/11
34 h-m-p 1.6000 8.0000 0.0000 Y 970.855324 0 1.6000 578 | 9/11
35 h-m-p 0.0160 8.0000 0.0000 Y 970.855324 0 0.0160 594
Out..
lnL = -970.855324
595 lfun, 2380 eigenQcodon, 10710 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -970.904147 S = -970.856312 -0.018471
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:04
did 20 / 57 patterns 0:04
did 30 / 57 patterns 0:04
did 40 / 57 patterns 0:04
did 50 / 57 patterns 0:04
did 57 / 57 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108186 0.033891 0.109363 0.100509 0.106137 0.096258 0.000100 0.629998 1.560787
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.896756
np = 9
lnL0 = -1093.532192
Iterating by ming2
Initial: fx= 1093.532192
x= 0.10819 0.03389 0.10936 0.10051 0.10614 0.09626 0.00011 0.63000 1.56079
1 h-m-p 0.0000 0.0000 506.1382 ++ 1093.342997 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0069 86.3002 +++++ 1051.792225 m 0.0069 29 | 2/9
3 h-m-p 0.0001 0.0003 190.4922 ++ 1035.540005 m 0.0003 41 | 3/9
4 h-m-p 0.0007 0.0035 45.2160 ++ 1029.885357 m 0.0035 53 | 4/9
5 h-m-p 0.0000 0.0002 118.5500 ++ 1021.168883 m 0.0002 65 | 5/9
6 h-m-p 0.0009 0.0089 23.3152 ++ 1012.998439 m 0.0089 77 | 6/9
7 h-m-p 0.0001 0.0004 161.3121 ++ 998.633749 m 0.0004 89 | 7/9
8 h-m-p 0.0160 8.0000 2.9635 -------------.. | 7/9
9 h-m-p 0.0000 0.0006 204.7311 +++ 970.855324 m 0.0006 125 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 C 970.855324 0 1.6000 137 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 ---Y 970.855324 0 0.0063 153
Out..
lnL = -970.855324
154 lfun, 1694 eigenQcodon, 9240 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108679 0.038251 0.082253 0.041299 0.109574 0.079383 0.000100 0.900000 0.578640 1.306246 1.294355
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.517780
np = 11
lnL0 = -1071.208490
Iterating by ming2
Initial: fx= 1071.208490
x= 0.10868 0.03825 0.08225 0.04130 0.10957 0.07938 0.00011 0.90000 0.57864 1.30625 1.29435
1 h-m-p 0.0000 0.0000 493.3202 ++ 1070.950843 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0010 244.3595 ++++ 1022.357322 m 0.0010 32 | 2/11
3 h-m-p 0.0000 0.0000 1378.5010 ++ 1019.049007 m 0.0000 46 | 3/11
4 h-m-p 0.0001 0.0039 126.7145 +++ 985.617960 m 0.0039 61 | 4/11
5 h-m-p 0.0000 0.0000 109908.0822 ++ 983.667256 m 0.0000 75 | 5/11
6 h-m-p 0.0000 0.0000 12532.8104 ++ 982.965156 m 0.0000 89 | 6/11
7 h-m-p 0.0005 0.0187 18.5981 +++ 976.227703 m 0.0187 104 | 6/11
8 h-m-p 0.0000 0.0000 5.3086
h-m-p: 0.00000000e+00 0.00000000e+00 5.30859550e+00 976.227703
.. | 6/11
9 h-m-p 0.0000 0.0000 326.5783 ++ 971.251696 m 0.0000 129 | 7/11
10 h-m-p 0.0000 0.0001 95.5093 ++ 970.855330 m 0.0001 143 | 8/11
11 h-m-p 1.6000 8.0000 0.0001 -----------Y 970.855330 0 0.0000 168
Out..
lnL = -970.855330
169 lfun, 2028 eigenQcodon, 11154 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -970.916811 S = -970.856147 -0.026964
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 57 patterns 0:10
did 20 / 57 patterns 0:10
did 30 / 57 patterns 0:10
did 40 / 57 patterns 0:10
did 50 / 57 patterns 0:10
did 57 / 57 patterns 0:10
Time used: 0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=243
NC_011896_1_WP_010909037_1_2884_MLBR_RS13730 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
NC_002677_1_NP_302719_1_1591_ML2696 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP
**************************************************
NC_011896_1_WP_010909037_1_2884_MLBR_RS13730 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
NC_002677_1_NP_302719_1_1591_ML2696 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190 PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK
**************************************************
NC_011896_1_WP_010909037_1_2884_MLBR_RS13730 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
NC_002677_1_NP_302719_1_1591_ML2696 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190 LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT
**************************************************
NC_011896_1_WP_010909037_1_2884_MLBR_RS13730 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
NC_002677_1_NP_302719_1_1591_ML2696 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190 TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT
**************************************************
NC_011896_1_WP_010909037_1_2884_MLBR_RS13730 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
NC_002677_1_NP_302719_1_1591_ML2696 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190 TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
*******************************************
>NC_011896_1_WP_010909037_1_2884_MLBR_RS13730 TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG CCGGCGACTCGCCCGCATGCAAGCAGGCA >NC_002677_1_NP_302719_1_1591_ML2696 TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG CCGGCGACTCGCCCGCATGCAAGCAGGCA >NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945 TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG CCGGCGACTCGCCCGCATGCAAGCAGGCA >NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660 TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG CCGGCGACTCGCCCGCATGCAAGCAGGCA >NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870 TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG CCGGCGACTCGCCCGCATGCAAGCAGGCA >NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190 TTGTTTTCATATATCACGACAAAGTCGTGGAATCCAGGAAACCAGAGCAG ATATTCGAGACCGCGCAGACTAAGCGCCTACAACGGTCTCTATCCCAAGT ACTTTGACGTCCTGGATTTTACGAACGACGACCCGCTGCACCCGGCTCCG CCGCACTTGCGACCGCCACTGCAACTCGCGCACACGAGGTCCCTCAACGC CCGACACATCGCGTTAAACTGCCGACTTATGGCGGACAGCGAATTCACCG CGCACGAGGTGACGGAGCTGGCGGATGGGTTGCACCGTGCGCTGTCCAAA CTGTTTTCGATCCTGCGCCGCAGAACCCCCAACGGGGCGGTGTCGGGTGA ATTGACACTGGCGCAGCTATCCATTTTGGTAACGTTACTCGATCAAGGTC CCATCCGGATGACGGATCTGGCTGCCCATGAACGGGTGCGTACCCCCACC ACCACCGTGGCGATCCGCCGTCTGGAAAAGATCGGGCTGGTGAAGCGTTC GCGTGATCTGTCTGACCTGCGTGCTGTGCTTGTCGACATCACCCCGCGTG GGCGCACGGTACATGGCGAATCGCTGGCCAACCGGCGTGCCGCCTTGACA ACGATGCTCAGTCAGCTCCCCACCTCCGATCTGAACATTCTGAAGAATGC GCTAGCACCGCTGCAGCGCCTGGCCTCCGGTGAACCGGTATCCAGCCCTG CCGGCGACTCGCCCGCATGCAAGCAGGCA
>NC_011896_1_WP_010909037_1_2884_MLBR_RS13730 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA >NC_002677_1_NP_302719_1_1591_ML2696 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA >NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA >NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA >NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA >NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190 LFSYITTKSWNPGNQSRYSRPRRLSAYNGLYPKYFDVLDFTNDDPLHPAP PHLRPPLQLAHTRSLNARHIALNCRLMADSEFTAHEVTELADGLHRALSK LFSILRRRTPNGAVSGELTLAQLSILVTLLDQGPIRMTDLAAHERVRTPT TTVAIRRLEKIGLVKRSRDLSDLRAVLVDITPRGRTVHGESLANRRAALT TMLSQLPTSDLNILKNALAPLQRLASGEPVSSPAGDSPACKQA
#NEXUS
[ID: 9602685080]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010909037_1_2884_MLBR_RS13730
NC_002677_1_NP_302719_1_1591_ML2696
NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945
NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660
NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870
NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190
;
end;
begin trees;
translate
1 NC_011896_1_WP_010909037_1_2884_MLBR_RS13730,
2 NC_002677_1_NP_302719_1_1591_ML2696,
3 NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945,
4 NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660,
5 NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870,
6 NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0692806,2:0.07108073,3:0.07034862,4:0.06622494,5:0.06618455,6:0.07089707);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0692806,2:0.07108073,3:0.07034862,4:0.06622494,5:0.06618455,6:0.07089707);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -995.12 -998.49
2 -995.09 -999.01
--------------------------------------
TOTAL -995.10 -998.78
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2696/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894883 0.091536 0.385920 1.510580 0.850727 1432.06 1466.53 1.000
r(A<->C){all} 0.156341 0.017032 0.000218 0.415406 0.121576 239.63 244.78 1.001
r(A<->G){all} 0.168980 0.021811 0.000057 0.471032 0.127915 347.21 422.01 1.001
r(A<->T){all} 0.167197 0.020962 0.000033 0.457504 0.121908 133.28 210.16 1.004
r(C<->G){all} 0.178584 0.021602 0.000226 0.481386 0.142206 201.65 206.27 1.000
r(C<->T){all} 0.169340 0.020376 0.000072 0.455916 0.132560 213.35 222.12 1.005
r(G<->T){all} 0.159557 0.018012 0.000025 0.425931 0.123547 242.23 290.01 1.005
pi(A){all} 0.205751 0.000218 0.177695 0.235018 0.205248 1274.95 1318.46 1.000
pi(C){all} 0.328057 0.000303 0.294854 0.361295 0.328159 1302.69 1308.52 1.000
pi(G){all} 0.274378 0.000252 0.244234 0.305897 0.274435 1256.78 1290.74 1.000
pi(T){all} 0.191814 0.000222 0.163564 0.221633 0.191422 791.18 1072.77 1.000
alpha{1,2} 0.410627 0.199828 0.000113 1.362898 0.248713 1145.47 1246.88 1.000
alpha{3} 0.457259 0.238771 0.000104 1.422236 0.302238 1194.73 1195.22 1.000
pinvar{all} 0.997862 0.000006 0.992951 0.999999 0.998664 1155.30 1168.86 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/ML2696/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 243
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 4 4 4 4 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 6 6 6 6 6 6 | TAC 2 2 2 2 2 2 | TGC 2 2 2 2 2 2
Leu TTA 2 2 2 2 2 2 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 6 6 6 6 6 6 | TCG 7 7 7 7 7 7 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 8 8 8 8 8 8
CTC 6 6 6 6 6 6 | CCC 6 6 6 6 6 6 | CAC 6 6 6 6 6 6 | CGC 6 6 6 6 6 6
CTA 3 3 3 3 3 3 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 2 2 2 | CGA 3 3 3 3 3 3
CTG 18 18 18 18 18 18 | CCG 9 9 9 9 9 9 | CAG 5 5 5 5 5 5 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 7 7 7 7 7 7 | ACC 8 8 8 8 8 8 | AAC 8 8 8 8 8 8 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 3 3 3 3 3 3 | Lys AAA 1 1 1 1 1 1 | Arg AGA 4 4 4 4 4 4
Met ATG 3 3 3 3 3 3 | ACG 8 8 8 8 8 8 | AAG 6 6 6 6 6 6 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 3 3 3 3 3 3 | Asp GAT 6 6 6 6 6 6 | Gly GGT 4 4 4 4 4 4
GTC 2 2 2 2 2 2 | GCC 8 8 8 8 8 8 | GAC 7 7 7 7 7 7 | GGC 2 2 2 2 2 2
GTA 3 3 3 3 3 3 | GCA 3 3 3 3 3 3 | Glu GAA 6 6 6 6 6 6 | GGA 1 1 1 1 1 1
GTG 6 6 6 6 6 6 | GCG 10 10 10 10 10 10 | GAG 2 2 2 2 2 2 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010909037_1_2884_MLBR_RS13730
position 1: T:0.14815 C:0.33745 A:0.23868 G:0.27572
position 2: T:0.26749 C:0.31276 A:0.23868 G:0.18107
position 3: T:0.16049 C:0.33333 A:0.13992 G:0.36626
Average T:0.19204 C:0.32785 A:0.20576 G:0.27435
#2: NC_002677_1_NP_302719_1_1591_ML2696
position 1: T:0.14815 C:0.33745 A:0.23868 G:0.27572
position 2: T:0.26749 C:0.31276 A:0.23868 G:0.18107
position 3: T:0.16049 C:0.33333 A:0.13992 G:0.36626
Average T:0.19204 C:0.32785 A:0.20576 G:0.27435
#3: NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945
position 1: T:0.14815 C:0.33745 A:0.23868 G:0.27572
position 2: T:0.26749 C:0.31276 A:0.23868 G:0.18107
position 3: T:0.16049 C:0.33333 A:0.13992 G:0.36626
Average T:0.19204 C:0.32785 A:0.20576 G:0.27435
#4: NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660
position 1: T:0.14815 C:0.33745 A:0.23868 G:0.27572
position 2: T:0.26749 C:0.31276 A:0.23868 G:0.18107
position 3: T:0.16049 C:0.33333 A:0.13992 G:0.36626
Average T:0.19204 C:0.32785 A:0.20576 G:0.27435
#5: NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870
position 1: T:0.14815 C:0.33745 A:0.23868 G:0.27572
position 2: T:0.26749 C:0.31276 A:0.23868 G:0.18107
position 3: T:0.16049 C:0.33333 A:0.13992 G:0.36626
Average T:0.19204 C:0.32785 A:0.20576 G:0.27435
#6: NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190
position 1: T:0.14815 C:0.33745 A:0.23868 G:0.27572
position 2: T:0.26749 C:0.31276 A:0.23868 G:0.18107
position 3: T:0.16049 C:0.33333 A:0.13992 G:0.36626
Average T:0.19204 C:0.32785 A:0.20576 G:0.27435
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 24 | Ser S TCT 6 | Tyr Y TAT 18 | Cys C TGT 0
TTC 6 | TCC 36 | TAC 12 | TGC 12
Leu L TTA 12 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 36 | TCG 42 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 48
CTC 36 | CCC 36 | CAC 36 | CGC 36
CTA 18 | CCA 12 | Gln Q CAA 12 | CGA 18
CTG 108 | CCG 54 | CAG 30 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 12 | Ser S AGT 6
ATC 42 | ACC 48 | AAC 48 | AGC 24
ATA 0 | ACA 18 | Lys K AAA 6 | Arg R AGA 24
Met M ATG 18 | ACG 48 | AAG 36 | AGG 6
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 18 | Asp D GAT 36 | Gly G GGT 24
GTC 12 | GCC 48 | GAC 42 | GGC 12
GTA 18 | GCA 18 | Glu E GAA 36 | GGA 6
GTG 36 | GCG 60 | GAG 12 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14815 C:0.33745 A:0.23868 G:0.27572
position 2: T:0.26749 C:0.31276 A:0.23868 G:0.18107
position 3: T:0.16049 C:0.33333 A:0.13992 G:0.36626
Average T:0.19204 C:0.32785 A:0.20576 G:0.27435
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -970.855505 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.296424 1.294355
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909037_1_2884_MLBR_RS13730: 0.000004, NC_002677_1_NP_302719_1_1591_ML2696: 0.000004, NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945: 0.000004, NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660: 0.000004, NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870: 0.000004, NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29642
omega (dN/dS) = 1.29435
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 556.7 172.3 1.2944 0.0000 0.0000 0.0 0.0
7..2 0.000 556.7 172.3 1.2944 0.0000 0.0000 0.0 0.0
7..3 0.000 556.7 172.3 1.2944 0.0000 0.0000 0.0 0.0
7..4 0.000 556.7 172.3 1.2944 0.0000 0.0000 0.0 0.0
7..5 0.000 556.7 172.3 1.2944 0.0000 0.0000 0.0 0.0
7..6 0.000 556.7 172.3 1.2944 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -970.855469 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.270609 0.637610 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909037_1_2884_MLBR_RS13730: 0.000004, NC_002677_1_NP_302719_1_1591_ML2696: 0.000004, NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945: 0.000004, NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660: 0.000004, NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870: 0.000004, NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.27061
MLEs of dN/dS (w) for site classes (K=2)
p: 0.63761 0.36239
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 557.2 171.8 0.3624 0.0000 0.0000 0.0 0.0
7..2 0.000 557.2 171.8 0.3624 0.0000 0.0000 0.0 0.0
7..3 0.000 557.2 171.8 0.3624 0.0000 0.0000 0.0 0.0
7..4 0.000 557.2 171.8 0.3624 0.0000 0.0000 0.0 0.0
7..5 0.000 557.2 171.8 0.3624 0.0000 0.0000 0.0 0.0
7..6 0.000 557.2 171.8 0.3624 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -970.855324 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909037_1_2884_MLBR_RS13730: 0.000004, NC_002677_1_NP_302719_1_1591_ML2696: 0.000004, NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945: 0.000004, NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660: 0.000004, NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870: 0.000004, NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 563.1 165.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 563.1 165.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 563.1 165.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 563.1 165.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 563.1 165.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 563.1 165.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909037_1_2884_MLBR_RS13730)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -970.855324 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.466821
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909037_1_2884_MLBR_RS13730: 0.000004, NC_002677_1_NP_302719_1_1591_ML2696: 0.000004, NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945: 0.000004, NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660: 0.000004, NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870: 0.000004, NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.46682
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 563.1 165.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 563.1 165.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 563.1 165.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 563.1 165.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 563.1 165.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 563.1 165.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -970.855330 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.995382 0.005000 1.440468 1.640852
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909037_1_2884_MLBR_RS13730: 0.000004, NC_002677_1_NP_302719_1_1591_ML2696: 0.000004, NZ_LVXE01000090_1_WP_010909037_1_2898_A3216_RS13945: 0.000004, NZ_LYPH01000093_1_WP_010909037_1_2834_A8144_RS13660: 0.000004, NZ_CP029543_1_WP_010909037_1_2923_DIJ64_RS14870: 0.000004, NZ_AP014567_1_WP_010909037_1_2987_JK2ML_RS15190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99538 p = 0.00500 q = 1.44047
(p1 = 0.00462) w = 1.64085
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09954 0.09954 0.09954 0.09954 0.09954 0.09954 0.09954 0.09954 0.09954 0.09954 0.00462
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.64085
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 563.1 165.9 0.0076 0.0000 0.0000 0.0 0.0
7..2 0.000 563.1 165.9 0.0076 0.0000 0.0000 0.0 0.0
7..3 0.000 563.1 165.9 0.0076 0.0000 0.0000 0.0 0.0
7..4 0.000 563.1 165.9 0.0076 0.0000 0.0000 0.0 0.0
7..5 0.000 563.1 165.9 0.0076 0.0000 0.0000 0.0 0.0
7..6 0.000 563.1 165.9 0.0076 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909037_1_2884_MLBR_RS13730)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909037_1_2884_MLBR_RS13730)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.102 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096
Time used: 0:10
Model 1: NearlyNeutral -970.855469 Model 2: PositiveSelection -970.855324 Model 0: one-ratio -970.855505 Model 7: beta -970.855324 Model 8: beta&w>1 -970.85533 Model 0 vs 1 7.200000004559115E-5 Model 2 vs 1 2.899999999499414E-4 Model 8 vs 7 1.1999999969702912E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
