--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 12:33:36 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/ML2710/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1588.78         -1595.71
2      -1588.78         -1594.28
--------------------------------------
TOTAL    -1588.78         -1595.23
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.857700    0.087163    0.371438    1.498118    0.818721   1450.98   1475.99    1.000
r(A<->C){all}   0.128609    0.015636    0.000043    0.390337    0.091120    200.67    271.37    1.000
r(A<->G){all}   0.173072    0.023438    0.000055    0.481097    0.127195    284.45    284.70    1.004
r(A<->T){all}   0.183783    0.022984    0.000010    0.481335    0.147242    136.64    140.86    1.000
r(C<->G){all}   0.131556    0.013986    0.000031    0.371207    0.097409    213.99    272.99    1.000
r(C<->T){all}   0.212183    0.025011    0.000478    0.529592    0.175590    101.83    142.56    1.002
r(G<->T){all}   0.170798    0.019811    0.000034    0.450518    0.140201    219.39    280.92    1.000
pi(A){all}      0.228817    0.000153    0.203395    0.252148    0.228955   1233.79   1241.70    1.000
pi(C){all}      0.221904    0.000149    0.198993    0.246707    0.221858   1287.38   1347.42    1.000
pi(G){all}      0.273839    0.000177    0.247708    0.299478    0.273486   1296.94   1315.59    1.000
pi(T){all}      0.275440    0.000171    0.248736    0.299356    0.275666   1134.78   1187.27    1.000
alpha{1,2}      0.249422    0.100677    0.000888    0.805988    0.158403   1221.05   1230.35    1.000
alpha{3}        0.402812    0.231323    0.000104    1.335507    0.231194   1304.82   1310.34    1.000
pinvar{all}     0.996928    0.000006    0.992183    0.999912    0.997555   1315.32   1385.06    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1545.011324
Model 2: PositiveSelection	-1544.635454
Model 0: one-ratio	-1544.635328
Model 7: beta	-1545.01132
Model 8: beta&w>1	-1544.635469


Model 0 vs 1	0.7519919999999729

Model 2 vs 1	0.7517400000001544

Model 8 vs 7	0.751702000000023
>C1
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C2
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C3
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C4
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C5
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C6
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
LADKPDCVGYNNNPTSHTRRSGQRTKRRKR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=380 

C1              VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C2              VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C3              VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C4              VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C5              VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C6              VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
                **************************************************

C1              TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C2              TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C3              TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C4              TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C5              TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C6              TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
                **************************************************

C1              EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C2              EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C3              EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C4              EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C5              EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C6              EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
                **************************************************

C1              GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C2              GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C3              GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C4              GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C5              GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C6              GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
                **************************************************

C1              MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C2              MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C3              MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C4              MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C5              MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C6              MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
                **************************************************

C1              FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C2              FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C3              FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C4              FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C5              FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C6              FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
                **************************************************

C1              GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C2              GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C3              GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C4              GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C5              GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C6              GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
                **************************************************

C1              PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C2              PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C3              PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C4              PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C5              PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C6              LADKPDCVGYNNNPTSHTRRSGQRTKRRKR
                 *****************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  380 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  380 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11400]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [11400]--->[11400]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.528 Mb, Max= 30.957 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C2              VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C3              VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C4              VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C5              VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C6              VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
                **************************************************

C1              TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C2              TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C3              TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C4              TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C5              TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C6              TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
                **************************************************

C1              EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C2              EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C3              EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C4              EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C5              EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C6              EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
                **************************************************

C1              GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C2              GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C3              GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C4              GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C5              GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C6              GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
                **************************************************

C1              MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C2              MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C3              MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C4              MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C5              MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C6              MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
                **************************************************

C1              FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C2              FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C3              FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C4              FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C5              FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C6              FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
                **************************************************

C1              GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C2              GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C3              GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C4              GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C5              GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C6              GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
                **************************************************

C1              PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C2              PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C3              PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C4              PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C5              PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C6              LADKPDCVGYNNNPTSHTRRSGQRTKRRKR
                 *****************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 99.74 C1	 C6	 99.74
TOP	    5    0	 99.74 C6	 C1	 99.74
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.74 C2	 C6	 99.74
TOP	    5    1	 99.74 C6	 C2	 99.74
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 99.74 C3	 C6	 99.74
TOP	    5    2	 99.74 C6	 C3	 99.74
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 99.74 C4	 C6	 99.74
TOP	    5    3	 99.74 C6	 C4	 99.74
BOT	    4    5	 99.74 C5	 C6	 99.74
TOP	    5    4	 99.74 C6	 C5	 99.74
AVG	 0	 C1	  *	 99.95
AVG	 1	 C2	  *	 99.95
AVG	 2	 C3	  *	 99.95
AVG	 3	 C4	  *	 99.95
AVG	 4	 C5	  *	 99.95
AVG	 5	 C6	  *	 99.74
TOT	 TOT	  *	 99.91
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
C2              GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
C3              GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
C4              GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
C5              GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
C6              GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
                **************************************************

C1              GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
C2              GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
C3              GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
C4              GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
C5              GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
C6              GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
                **************************************************

C1              GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
C2              GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
C3              GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
C4              GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
C5              GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
C6              GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
                **************************************************

C1              ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
C2              ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
C3              ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
C4              ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
C5              ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
C6              ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
                **************************************************

C1              TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
C2              TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
C3              TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
C4              TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
C5              TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
C6              TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
                **************************************************

C1              ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
C2              ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
C3              ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
C4              ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
C5              ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
C6              ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
                **************************************************

C1              GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
C2              GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
C3              GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
C4              GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
C5              GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
C6              GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
                **************************************************

C1              ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
C2              ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
C3              ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
C4              ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
C5              ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
C6              ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
                **************************************************

C1              CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
C2              CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
C3              CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
C4              CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
C5              CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
C6              CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
                **************************************************

C1              GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
C2              GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
C3              GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
C4              GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
C5              GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
C6              GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
                **************************************************

C1              TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
C2              TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
C3              TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
C4              TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
C5              TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
C6              TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
                **************************************************

C1              ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
C2              ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
C3              ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
C4              ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
C5              ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
C6              ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
                **************************************************

C1              ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
C2              ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
C3              ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
C4              ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
C5              ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
C6              ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
                **************************************************

C1              AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
C2              AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
C3              AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
C4              AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
C5              AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
C6              AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
                **************************************************

C1              ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
C2              ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
C3              ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
C4              ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
C5              ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
C6              ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
                **************************************************

C1              TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
C2              TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
C3              TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
C4              TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
C5              TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
C6              TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
                **************************************************

C1              TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
C2              TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
C3              TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
C4              TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
C5              TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
C6              TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
                **************************************************

C1              CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
C2              CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
C3              CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
C4              CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
C5              CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
C6              CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
                **************************************************

C1              GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
C2              GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
C3              GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
C4              GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
C5              GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
C6              GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
                **************************************************

C1              TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
C2              TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
C3              TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
C4              TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
C5              TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
C6              TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
                **************************************************

C1              AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
C2              AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
C3              AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
C4              AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
C5              AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
C6              AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
                **************************************************

C1              CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
C2              CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
C3              CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
C4              CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
C5              CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
C6              CTGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
                * ************************************************

C1              TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
C2              TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
C3              TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
C4              TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
C5              TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
C6              TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
                ****************************************



>C1
GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
>C2
GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
>C3
GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
>C4
GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
>C5
GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
>C6
GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
CTGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
>C1
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C2
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C3
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C4
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C5
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C6
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
LADKPDCVGYNNNPTSHTRRSGQRTKRRKR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1140 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579782728
      Setting output file names to "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1872340855
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9716761319
      Seed = 1864958816
      Swapseed = 1579782728
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2554.775959 -- -24.965149
         Chain 2 -- -2554.777508 -- -24.965149
         Chain 3 -- -2554.775959 -- -24.965149
         Chain 4 -- -2554.775959 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2554.777055 -- -24.965149
         Chain 2 -- -2554.775811 -- -24.965149
         Chain 3 -- -2554.777508 -- -24.965149
         Chain 4 -- -2554.775959 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2554.776] (-2554.778) (-2554.776) (-2554.776) * [-2554.777] (-2554.776) (-2554.778) (-2554.776) 
        500 -- [-1596.119] (-1601.328) (-1602.955) (-1596.431) * [-1592.364] (-1600.041) (-1596.639) (-1593.218) -- 0:00:00
       1000 -- (-1592.012) [-1593.459] (-1595.531) (-1590.607) * [-1592.722] (-1599.136) (-1602.265) (-1596.380) -- 0:00:00
       1500 -- (-1591.819) [-1597.314] (-1596.340) (-1610.960) * (-1588.571) (-1592.803) [-1588.145] (-1597.145) -- 0:00:00
       2000 -- (-1598.336) (-1600.326) [-1589.211] (-1594.659) * (-1593.648) [-1590.666] (-1595.232) (-1591.311) -- 0:00:00
       2500 -- (-1594.062) [-1590.610] (-1596.542) (-1601.831) * (-1597.508) (-1611.085) (-1593.338) [-1590.894] -- 0:00:00
       3000 -- (-1591.873) [-1590.948] (-1593.509) (-1593.417) * [-1593.336] (-1596.420) (-1593.443) (-1595.910) -- 0:00:00
       3500 -- (-1600.016) [-1593.759] (-1599.269) (-1590.231) * (-1601.192) (-1599.942) (-1602.633) [-1590.188] -- 0:00:00
       4000 -- (-1593.030) (-1593.666) (-1590.792) [-1594.571] * (-1600.298) [-1591.083] (-1598.452) (-1599.190) -- 0:00:00
       4500 -- (-1598.631) (-1591.705) [-1597.216] (-1601.482) * (-1592.898) (-1596.620) [-1591.534] (-1590.367) -- 0:00:00
       5000 -- [-1594.685] (-1597.349) (-1589.992) (-1596.688) * [-1592.721] (-1591.842) (-1594.241) (-1598.498) -- 0:00:00

      Average standard deviation of split frequencies: 0.064282

       5500 -- (-1590.100) (-1594.958) [-1595.386] (-1592.509) * (-1595.610) [-1593.450] (-1593.743) (-1595.374) -- 0:00:00
       6000 -- (-1597.840) (-1594.971) [-1593.219] (-1596.554) * [-1593.055] (-1592.669) (-1594.257) (-1595.633) -- 0:02:45
       6500 -- (-1600.067) [-1591.968] (-1599.390) (-1598.772) * (-1602.370) (-1593.478) [-1590.445] (-1590.999) -- 0:02:32
       7000 -- [-1593.364] (-1596.605) (-1594.578) (-1605.645) * (-1595.687) (-1595.385) (-1601.545) [-1596.093] -- 0:02:21
       7500 -- [-1593.967] (-1592.357) (-1596.293) (-1599.100) * (-1596.556) [-1595.521] (-1598.901) (-1592.800) -- 0:02:12
       8000 -- (-1592.811) (-1592.970) (-1598.908) [-1591.596] * (-1594.803) (-1592.718) [-1597.660] (-1593.508) -- 0:02:04
       8500 -- (-1590.031) (-1604.323) [-1592.221] (-1601.354) * (-1597.668) (-1597.203) (-1595.482) [-1591.130] -- 0:01:56
       9000 -- (-1593.723) (-1593.036) (-1600.332) [-1597.031] * (-1596.619) (-1594.095) (-1594.923) [-1592.379] -- 0:01:50
       9500 -- (-1593.729) [-1592.975] (-1595.500) (-1596.270) * (-1599.618) (-1598.833) [-1588.488] (-1598.350) -- 0:01:44
      10000 -- (-1596.996) [-1592.112] (-1596.032) (-1605.500) * (-1597.488) (-1604.068) [-1595.142] (-1593.415) -- 0:01:39

      Average standard deviation of split frequencies: 0.075761

      10500 -- (-1595.639) (-1600.677) (-1598.333) [-1593.580] * (-1596.367) (-1595.303) [-1591.253] (-1601.337) -- 0:01:34
      11000 -- [-1587.277] (-1594.962) (-1598.047) (-1598.875) * [-1592.294] (-1591.147) (-1596.145) (-1594.494) -- 0:01:29
      11500 -- (-1599.996) [-1592.628] (-1595.134) (-1592.530) * (-1595.050) (-1594.151) (-1594.083) [-1590.069] -- 0:01:25
      12000 -- (-1592.707) [-1587.693] (-1595.902) (-1595.739) * [-1594.176] (-1606.983) (-1594.303) (-1591.432) -- 0:01:22
      12500 -- [-1599.948] (-1594.467) (-1595.817) (-1595.377) * [-1590.454] (-1598.036) (-1591.097) (-1602.292) -- 0:01:19
      13000 -- (-1598.233) [-1592.842] (-1596.038) (-1598.967) * (-1599.869) (-1590.346) (-1592.249) [-1599.248] -- 0:01:15
      13500 -- (-1591.624) (-1590.470) [-1594.820] (-1594.118) * (-1592.874) (-1599.087) (-1592.092) [-1596.619] -- 0:01:13
      14000 -- (-1598.274) [-1592.075] (-1593.572) (-1600.313) * [-1596.986] (-1591.309) (-1592.385) (-1591.012) -- 0:01:10
      14500 -- (-1589.679) [-1592.890] (-1591.914) (-1596.384) * [-1596.730] (-1591.029) (-1591.768) (-1590.514) -- 0:01:07
      15000 -- (-1589.923) (-1595.590) [-1597.674] (-1595.827) * [-1600.536] (-1593.742) (-1594.421) (-1593.117) -- 0:01:05

      Average standard deviation of split frequencies: 0.080635

      15500 -- (-1591.925) [-1590.709] (-1599.656) (-1604.044) * (-1593.148) (-1594.247) [-1590.681] (-1596.952) -- 0:01:03
      16000 -- [-1588.517] (-1598.333) (-1594.387) (-1595.970) * [-1593.100] (-1599.265) (-1597.213) (-1592.830) -- 0:01:01
      16500 -- (-1596.885) [-1593.905] (-1603.101) (-1589.210) * (-1592.032) (-1592.763) (-1592.950) [-1595.998] -- 0:00:59
      17000 -- (-1594.685) [-1593.907] (-1596.014) (-1592.258) * (-1592.172) (-1596.183) (-1592.524) [-1595.258] -- 0:00:57
      17500 -- (-1591.084) (-1598.593) (-1601.205) [-1591.159] * [-1590.984] (-1595.131) (-1591.012) (-1592.553) -- 0:00:56
      18000 -- [-1593.932] (-1594.044) (-1594.620) (-1594.098) * [-1594.675] (-1597.938) (-1589.352) (-1594.548) -- 0:00:54
      18500 -- (-1591.300) [-1591.756] (-1593.262) (-1596.792) * (-1593.209) (-1594.847) (-1590.409) [-1593.277] -- 0:00:53
      19000 -- (-1588.662) (-1598.844) (-1598.818) [-1597.366] * (-1590.730) [-1596.381] (-1590.082) (-1598.564) -- 0:00:51
      19500 -- (-1591.822) [-1587.072] (-1593.665) (-1594.566) * (-1591.875) [-1588.848] (-1588.735) (-1591.539) -- 0:00:50
      20000 -- (-1592.638) [-1589.709] (-1591.350) (-1599.048) * (-1598.758) [-1589.672] (-1588.764) (-1589.769) -- 0:00:49

      Average standard deviation of split frequencies: 0.060026

      20500 -- (-1589.978) (-1593.609) (-1597.978) [-1590.762] * (-1593.153) (-1597.346) [-1587.372] (-1597.488) -- 0:01:35
      21000 -- [-1589.985] (-1596.154) (-1595.102) (-1594.804) * (-1593.674) (-1595.849) (-1591.126) [-1588.559] -- 0:01:33
      21500 -- (-1589.255) [-1593.987] (-1594.463) (-1595.859) * (-1600.527) (-1594.351) (-1590.956) [-1592.711] -- 0:01:31
      22000 -- (-1588.025) (-1597.156) [-1595.247] (-1603.142) * (-1593.575) [-1593.235] (-1588.217) (-1592.276) -- 0:01:28
      22500 -- (-1587.642) [-1598.151] (-1592.530) (-1609.157) * [-1590.566] (-1595.802) (-1589.790) (-1597.580) -- 0:01:26
      23000 -- (-1590.333) (-1588.746) [-1599.031] (-1593.379) * (-1594.478) (-1602.713) (-1591.441) [-1591.046] -- 0:01:24
      23500 -- (-1589.808) [-1591.338] (-1600.013) (-1599.017) * (-1593.692) (-1599.469) (-1588.229) [-1597.991] -- 0:01:23
      24000 -- (-1589.332) [-1590.503] (-1594.440) (-1609.275) * (-1597.634) [-1593.975] (-1589.842) (-1595.588) -- 0:01:21
      24500 -- (-1590.029) [-1590.424] (-1596.886) (-1594.632) * [-1588.916] (-1599.079) (-1586.609) (-1594.552) -- 0:01:19
      25000 -- (-1587.708) [-1590.456] (-1596.840) (-1592.624) * [-1592.549] (-1597.254) (-1590.162) (-1592.280) -- 0:01:18

      Average standard deviation of split frequencies: 0.047486

      25500 -- (-1588.780) (-1594.125) (-1606.455) [-1591.361] * (-1592.071) [-1594.886] (-1589.739) (-1591.454) -- 0:01:16
      26000 -- [-1589.814] (-1592.416) (-1596.014) (-1599.021) * (-1600.239) (-1595.749) [-1591.099] (-1590.507) -- 0:01:14
      26500 -- (-1593.715) (-1596.497) (-1594.745) [-1590.313] * (-1595.145) [-1596.258] (-1593.458) (-1588.981) -- 0:01:13
      27000 -- (-1590.804) [-1589.626] (-1591.289) (-1594.822) * [-1589.966] (-1594.716) (-1589.394) (-1592.465) -- 0:01:12
      27500 -- [-1592.946] (-1598.685) (-1592.771) (-1596.352) * (-1594.135) (-1595.584) [-1589.682] (-1593.491) -- 0:01:10
      28000 -- (-1590.322) (-1599.710) (-1592.276) [-1589.959] * (-1606.156) (-1598.543) [-1589.917] (-1590.834) -- 0:01:09
      28500 -- [-1589.115] (-1595.408) (-1588.891) (-1598.311) * [-1594.382] (-1596.943) (-1588.848) (-1591.942) -- 0:01:08
      29000 -- [-1589.705] (-1593.593) (-1588.305) (-1595.200) * (-1593.781) (-1592.848) [-1589.545] (-1587.699) -- 0:01:06
      29500 -- [-1587.882] (-1593.603) (-1591.608) (-1593.013) * [-1592.054] (-1597.613) (-1588.174) (-1588.858) -- 0:01:05
      30000 -- (-1588.862) (-1596.795) [-1588.828] (-1594.242) * (-1597.839) (-1601.281) [-1592.434] (-1594.992) -- 0:01:04

      Average standard deviation of split frequencies: 0.049776

      30500 -- (-1591.566) (-1592.007) [-1588.856] (-1595.092) * [-1592.082] (-1595.620) (-1588.637) (-1588.884) -- 0:01:03
      31000 -- (-1590.144) (-1592.355) (-1589.159) [-1597.920] * (-1592.235) (-1598.564) [-1590.702] (-1589.916) -- 0:01:02
      31500 -- (-1591.550) (-1590.735) (-1590.614) [-1595.884] * (-1588.058) [-1593.759] (-1590.476) (-1589.763) -- 0:01:01
      32000 -- [-1591.202] (-1588.364) (-1589.977) (-1594.468) * [-1591.401] (-1598.254) (-1593.494) (-1592.822) -- 0:01:00
      32500 -- (-1590.841) (-1591.102) [-1589.373] (-1595.970) * (-1597.396) (-1593.707) (-1590.515) [-1589.718] -- 0:00:59
      33000 -- (-1591.714) (-1591.519) [-1589.256] (-1598.409) * (-1596.816) (-1597.053) (-1591.439) [-1590.547] -- 0:00:58
      33500 -- (-1590.546) (-1592.934) [-1590.072] (-1598.647) * (-1596.763) [-1592.195] (-1592.520) (-1591.969) -- 0:00:57
      34000 -- (-1592.931) (-1592.121) (-1589.931) [-1596.253] * [-1591.220] (-1596.169) (-1587.887) (-1589.324) -- 0:00:56
      34500 -- (-1593.480) (-1593.730) (-1591.450) [-1592.285] * [-1593.190] (-1602.942) (-1590.278) (-1588.080) -- 0:00:55
      35000 -- (-1590.031) (-1590.366) (-1592.167) [-1587.822] * (-1594.687) (-1605.903) [-1589.569] (-1587.866) -- 0:00:55

      Average standard deviation of split frequencies: 0.036010

      35500 -- (-1593.557) [-1589.246] (-1592.619) (-1592.884) * (-1593.818) [-1590.095] (-1589.070) (-1593.589) -- 0:01:21
      36000 -- (-1596.689) (-1593.205) (-1589.796) [-1593.289] * (-1595.007) [-1590.113] (-1588.775) (-1588.603) -- 0:01:20
      36500 -- (-1593.766) (-1601.049) (-1591.144) [-1594.809] * (-1590.864) (-1596.915) [-1590.184] (-1591.078) -- 0:01:19
      37000 -- [-1590.626] (-1588.705) (-1594.240) (-1593.709) * [-1591.775] (-1588.692) (-1588.872) (-1590.816) -- 0:01:18
      37500 -- (-1588.598) [-1592.263] (-1592.435) (-1592.307) * (-1592.169) [-1610.469] (-1588.198) (-1591.071) -- 0:01:17
      38000 -- (-1589.011) (-1592.428) (-1587.189) [-1590.686] * (-1586.633) (-1595.020) [-1588.451] (-1593.251) -- 0:01:15
      38500 -- (-1591.562) (-1593.801) [-1590.219] (-1601.757) * (-1591.886) [-1596.185] (-1588.500) (-1590.262) -- 0:01:14
      39000 -- (-1594.331) (-1593.762) (-1590.786) [-1591.811] * [-1587.913] (-1603.307) (-1592.682) (-1595.895) -- 0:01:13
      39500 -- (-1591.686) (-1592.132) (-1590.776) [-1600.330] * [-1589.677] (-1595.073) (-1588.626) (-1594.959) -- 0:01:12
      40000 -- [-1592.179] (-1591.536) (-1591.270) (-1598.097) * (-1594.579) (-1600.924) [-1588.518] (-1591.677) -- 0:01:12

      Average standard deviation of split frequencies: 0.039657

      40500 -- (-1597.985) (-1588.753) (-1598.376) [-1597.895] * (-1597.909) (-1603.543) (-1587.921) [-1588.584] -- 0:01:11
      41000 -- (-1599.384) (-1588.285) [-1590.449] (-1598.885) * [-1596.423] (-1601.124) (-1588.399) (-1588.588) -- 0:01:10
      41500 -- [-1595.999] (-1591.781) (-1592.997) (-1601.247) * (-1591.815) (-1597.344) (-1590.667) [-1589.271] -- 0:01:09
      42000 -- (-1591.525) (-1590.626) [-1588.667] (-1590.234) * (-1590.406) [-1592.669] (-1590.881) (-1591.403) -- 0:01:08
      42500 -- (-1591.853) (-1588.811) [-1588.498] (-1601.017) * (-1591.438) [-1595.534] (-1590.068) (-1588.007) -- 0:01:07
      43000 -- (-1591.298) [-1588.356] (-1594.650) (-1591.640) * (-1602.603) [-1601.110] (-1591.141) (-1594.667) -- 0:01:06
      43500 -- [-1593.696] (-1592.488) (-1593.003) (-1592.631) * (-1593.893) [-1592.702] (-1586.552) (-1594.732) -- 0:01:05
      44000 -- (-1594.105) [-1587.791] (-1590.244) (-1593.114) * (-1597.200) [-1594.327] (-1588.281) (-1587.846) -- 0:01:05
      44500 -- (-1591.582) (-1592.570) [-1588.415] (-1597.299) * (-1594.861) (-1595.637) [-1589.335] (-1592.155) -- 0:01:04
      45000 -- (-1591.679) (-1592.708) [-1590.557] (-1594.365) * [-1601.752] (-1599.576) (-1590.227) (-1590.734) -- 0:01:03

      Average standard deviation of split frequencies: 0.036112

      45500 -- [-1590.834] (-1591.025) (-1588.553) (-1593.762) * (-1596.428) (-1593.530) (-1590.118) [-1588.196] -- 0:01:02
      46000 -- (-1593.100) (-1592.895) [-1587.744] (-1598.779) * (-1594.851) (-1596.377) [-1588.960] (-1596.118) -- 0:01:02
      46500 -- (-1593.517) (-1590.324) (-1591.097) [-1591.784] * (-1592.997) [-1592.704] (-1588.173) (-1590.319) -- 0:01:01
      47000 -- [-1593.033] (-1590.323) (-1587.764) (-1590.477) * (-1591.126) (-1588.579) [-1586.417] (-1591.541) -- 0:01:00
      47500 -- (-1592.095) (-1587.952) [-1588.080] (-1590.415) * (-1594.082) [-1593.556] (-1591.836) (-1591.098) -- 0:01:00
      48000 -- (-1589.492) (-1589.848) [-1589.007] (-1593.291) * [-1593.088] (-1599.305) (-1591.217) (-1591.344) -- 0:00:59
      48500 -- (-1590.115) (-1589.012) [-1588.014] (-1591.447) * (-1589.365) [-1592.768] (-1590.792) (-1590.605) -- 0:00:58
      49000 -- (-1589.700) (-1590.432) (-1591.584) [-1590.169] * (-1595.435) (-1600.401) (-1589.828) [-1591.907] -- 0:00:58
      49500 -- [-1589.381] (-1590.904) (-1590.219) (-1590.071) * [-1591.240] (-1590.610) (-1590.040) (-1591.339) -- 0:01:16
      50000 -- (-1591.188) (-1589.546) [-1589.280] (-1588.524) * [-1591.680] (-1589.180) (-1588.608) (-1595.361) -- 0:01:16

      Average standard deviation of split frequencies: 0.032141

      50500 -- (-1590.526) [-1588.769] (-1588.544) (-1588.549) * (-1595.437) [-1588.357] (-1589.065) (-1590.386) -- 0:01:15
      51000 -- (-1592.494) [-1587.894] (-1588.637) (-1588.432) * [-1595.122] (-1587.305) (-1589.785) (-1590.295) -- 0:01:14
      51500 -- [-1588.684] (-1590.627) (-1589.023) (-1594.861) * (-1592.071) (-1592.337) (-1588.568) [-1591.561] -- 0:01:13
      52000 -- [-1589.060] (-1591.860) (-1588.755) (-1594.724) * (-1590.996) (-1592.406) [-1591.924] (-1592.727) -- 0:01:12
      52500 -- (-1591.181) (-1591.797) [-1589.709] (-1591.193) * (-1593.266) (-1590.145) [-1589.635] (-1591.080) -- 0:01:12
      53000 -- (-1589.873) (-1593.393) [-1587.570] (-1590.150) * (-1595.508) [-1590.097] (-1590.368) (-1591.826) -- 0:01:11
      53500 -- (-1589.708) (-1591.411) (-1590.494) [-1589.393] * [-1598.134] (-1589.602) (-1590.600) (-1590.759) -- 0:01:10
      54000 -- (-1589.596) [-1591.412] (-1589.870) (-1588.652) * (-1600.834) [-1589.521] (-1591.192) (-1588.184) -- 0:01:10
      54500 -- (-1589.474) (-1590.417) (-1589.052) [-1588.094] * (-1595.321) [-1593.034] (-1590.113) (-1589.141) -- 0:01:09
      55000 -- (-1588.820) (-1590.542) (-1588.566) [-1587.735] * (-1609.200) (-1594.745) [-1587.112] (-1592.763) -- 0:01:08

      Average standard deviation of split frequencies: 0.031146

      55500 -- (-1588.925) (-1590.742) [-1587.537] (-1590.586) * (-1589.258) [-1587.473] (-1587.084) (-1590.501) -- 0:01:08
      56000 -- (-1589.340) (-1587.681) (-1587.038) [-1587.331] * (-1590.970) (-1591.007) [-1590.911] (-1589.043) -- 0:01:07
      56500 -- (-1589.240) [-1589.169] (-1589.158) (-1589.260) * (-1592.636) (-1593.074) [-1588.630] (-1591.813) -- 0:01:06
      57000 -- [-1588.670] (-1591.541) (-1591.678) (-1587.333) * [-1586.902] (-1588.956) (-1588.977) (-1587.112) -- 0:01:06
      57500 -- (-1589.292) (-1590.470) (-1590.642) [-1591.453] * [-1588.054] (-1590.732) (-1590.784) (-1590.105) -- 0:01:05
      58000 -- [-1588.164] (-1590.689) (-1589.465) (-1590.061) * [-1588.354] (-1590.944) (-1588.922) (-1590.307) -- 0:01:04
      58500 -- [-1588.296] (-1593.073) (-1589.676) (-1588.577) * (-1589.722) [-1590.385] (-1589.371) (-1588.828) -- 0:01:04
      59000 -- [-1587.652] (-1594.677) (-1593.314) (-1587.610) * (-1587.844) [-1588.138] (-1592.579) (-1589.619) -- 0:01:03
      59500 -- (-1591.570) (-1591.271) (-1592.378) [-1587.339] * (-1590.688) (-1588.430) [-1586.791] (-1590.286) -- 0:01:03
      60000 -- [-1588.939] (-1590.573) (-1589.733) (-1590.584) * (-1589.010) (-1589.488) (-1590.396) [-1587.248] -- 0:01:02

      Average standard deviation of split frequencies: 0.035989

      60500 -- (-1589.381) (-1592.165) (-1589.906) [-1588.228] * (-1589.378) (-1589.599) [-1588.935] (-1594.078) -- 0:01:02
      61000 -- (-1590.941) [-1595.140] (-1588.680) (-1590.158) * (-1591.995) (-1590.724) [-1589.470] (-1594.794) -- 0:01:01
      61500 -- (-1586.724) (-1592.689) [-1594.391] (-1590.490) * (-1592.849) [-1587.670] (-1592.427) (-1593.222) -- 0:01:01
      62000 -- [-1591.997] (-1593.812) (-1591.922) (-1588.757) * (-1592.048) [-1591.205] (-1588.535) (-1588.536) -- 0:01:00
      62500 -- [-1594.162] (-1591.231) (-1591.931) (-1589.604) * (-1592.788) (-1587.748) (-1587.625) [-1587.170] -- 0:01:00
      63000 -- [-1592.140] (-1592.142) (-1591.001) (-1588.879) * (-1593.221) [-1586.995] (-1591.161) (-1588.310) -- 0:00:59
      63500 -- [-1591.019] (-1588.952) (-1590.714) (-1588.776) * (-1590.237) (-1588.841) [-1588.262] (-1593.764) -- 0:00:58
      64000 -- (-1589.549) (-1592.361) (-1590.713) [-1591.231] * (-1591.368) [-1589.105] (-1591.464) (-1590.288) -- 0:01:13
      64500 -- (-1589.760) (-1594.765) (-1592.114) [-1591.116] * (-1590.340) (-1588.744) (-1591.040) [-1591.835] -- 0:01:12
      65000 -- (-1588.132) (-1592.047) (-1589.854) [-1588.848] * (-1591.447) (-1589.168) [-1588.242] (-1589.286) -- 0:01:11

      Average standard deviation of split frequencies: 0.032791

      65500 -- (-1589.108) (-1592.669) [-1588.040] (-1589.198) * (-1592.171) [-1587.980] (-1589.607) (-1592.735) -- 0:01:11
      66000 -- (-1589.573) [-1593.649] (-1589.854) (-1590.182) * (-1590.362) [-1586.821] (-1588.396) (-1589.765) -- 0:01:10
      66500 -- [-1588.962] (-1590.851) (-1593.569) (-1588.313) * (-1591.976) [-1587.994] (-1587.569) (-1590.605) -- 0:01:10
      67000 -- (-1589.428) [-1590.387] (-1590.244) (-1588.909) * (-1589.621) (-1590.170) (-1587.712) [-1590.478] -- 0:01:09
      67500 -- (-1588.491) (-1594.151) [-1590.892] (-1591.872) * (-1589.666) (-1590.082) [-1589.901] (-1588.440) -- 0:01:09
      68000 -- (-1590.629) (-1588.416) [-1591.039] (-1589.815) * [-1587.426] (-1592.533) (-1589.690) (-1591.187) -- 0:01:08
      68500 -- [-1590.788] (-1588.350) (-1592.250) (-1589.407) * (-1588.224) [-1591.859] (-1595.771) (-1589.878) -- 0:01:07
      69000 -- (-1590.551) (-1589.894) [-1588.926] (-1588.700) * [-1588.058] (-1594.038) (-1588.471) (-1592.339) -- 0:01:07
      69500 -- (-1589.164) [-1588.731] (-1587.706) (-1590.404) * (-1588.764) (-1595.479) (-1591.628) [-1587.563] -- 0:01:06
      70000 -- (-1588.509) (-1590.555) [-1588.734] (-1587.634) * (-1596.407) [-1593.234] (-1591.605) (-1595.108) -- 0:01:06

      Average standard deviation of split frequencies: 0.031448

      70500 -- (-1586.682) (-1590.119) (-1589.261) [-1589.673] * (-1590.413) (-1594.479) [-1591.345] (-1591.307) -- 0:01:05
      71000 -- [-1588.651] (-1588.625) (-1590.563) (-1592.455) * (-1591.228) (-1591.792) [-1590.983] (-1590.844) -- 0:01:05
      71500 -- (-1593.645) [-1588.246] (-1592.374) (-1591.151) * (-1587.899) [-1588.873] (-1590.643) (-1591.640) -- 0:01:04
      72000 -- (-1589.094) [-1591.759] (-1590.255) (-1589.561) * (-1592.535) (-1591.669) [-1598.611] (-1592.187) -- 0:01:04
      72500 -- (-1590.572) (-1590.497) [-1591.328] (-1588.129) * (-1593.467) [-1591.355] (-1596.440) (-1589.909) -- 0:01:03
      73000 -- (-1593.226) (-1593.678) [-1593.532] (-1590.849) * (-1590.619) (-1591.460) (-1592.210) [-1588.679] -- 0:01:03
      73500 -- (-1590.435) [-1592.739] (-1594.215) (-1589.402) * (-1593.154) (-1592.850) [-1587.153] (-1588.867) -- 0:01:03
      74000 -- [-1596.581] (-1590.439) (-1589.941) (-1592.089) * (-1603.913) [-1590.501] (-1587.666) (-1587.031) -- 0:01:02
      74500 -- (-1593.376) (-1589.462) [-1588.239] (-1587.853) * (-1596.105) [-1590.944] (-1590.275) (-1587.911) -- 0:01:02
      75000 -- (-1594.269) [-1589.788] (-1591.545) (-1590.192) * [-1589.035] (-1590.826) (-1588.535) (-1589.679) -- 0:01:01

      Average standard deviation of split frequencies: 0.030168

      75500 -- (-1591.250) [-1591.468] (-1590.498) (-1587.585) * (-1589.719) (-1588.663) (-1590.934) [-1588.964] -- 0:01:01
      76000 -- (-1591.251) [-1588.755] (-1592.958) (-1599.288) * [-1589.200] (-1588.241) (-1587.259) (-1592.341) -- 0:01:00
      76500 -- (-1592.648) [-1587.683] (-1594.021) (-1594.691) * (-1590.895) (-1589.902) [-1587.870] (-1592.614) -- 0:01:00
      77000 -- (-1594.050) [-1590.979] (-1593.558) (-1590.441) * [-1591.311] (-1592.277) (-1589.396) (-1590.651) -- 0:00:59
      77500 -- (-1592.587) [-1588.394] (-1593.493) (-1588.545) * (-1600.814) (-1592.680) [-1587.529] (-1593.014) -- 0:00:59
      78000 -- (-1594.513) [-1588.930] (-1593.569) (-1589.986) * (-1590.514) (-1590.617) (-1590.174) [-1591.712] -- 0:00:59
      78500 -- (-1595.732) (-1593.582) (-1590.937) [-1592.472] * [-1589.420] (-1591.288) (-1592.877) (-1592.189) -- 0:01:10
      79000 -- [-1594.606] (-1596.752) (-1591.025) (-1591.190) * (-1591.803) [-1587.619] (-1593.978) (-1591.833) -- 0:01:09
      79500 -- (-1592.288) [-1595.750] (-1590.793) (-1590.913) * (-1591.291) [-1590.620] (-1591.699) (-1591.218) -- 0:01:09
      80000 -- [-1589.061] (-1592.035) (-1587.403) (-1594.187) * (-1587.717) (-1591.914) [-1587.768] (-1591.597) -- 0:01:09

      Average standard deviation of split frequencies: 0.031557

      80500 -- (-1592.195) [-1588.433] (-1592.665) (-1593.570) * (-1590.100) [-1589.226] (-1589.186) (-1595.667) -- 0:01:08
      81000 -- (-1589.765) (-1589.110) [-1589.356] (-1591.604) * (-1593.041) [-1587.333] (-1589.036) (-1596.388) -- 0:01:08
      81500 -- (-1590.100) (-1590.010) [-1590.901] (-1589.864) * (-1588.340) [-1588.486] (-1591.820) (-1592.770) -- 0:01:07
      82000 -- (-1589.898) [-1587.815] (-1588.276) (-1590.316) * (-1594.367) (-1587.138) [-1590.736] (-1594.125) -- 0:01:07
      82500 -- [-1590.199] (-1589.735) (-1587.085) (-1590.139) * (-1592.330) (-1587.021) (-1590.995) [-1590.396] -- 0:01:06
      83000 -- (-1591.174) (-1591.467) (-1589.709) [-1590.650] * (-1590.812) (-1590.367) (-1589.835) [-1589.297] -- 0:01:06
      83500 -- (-1589.553) [-1591.794] (-1594.715) (-1592.459) * [-1590.858] (-1590.070) (-1588.049) (-1595.413) -- 0:01:05
      84000 -- (-1589.044) (-1592.650) (-1594.137) [-1591.020] * [-1591.501] (-1600.412) (-1591.416) (-1591.813) -- 0:01:05
      84500 -- (-1588.971) (-1589.084) [-1591.716] (-1591.274) * [-1591.086] (-1599.810) (-1592.676) (-1588.893) -- 0:01:05
      85000 -- (-1590.976) (-1592.527) (-1595.591) [-1591.758] * (-1589.105) [-1593.804] (-1593.091) (-1588.842) -- 0:01:04

      Average standard deviation of split frequencies: 0.029151

      85500 -- (-1590.035) (-1592.180) [-1591.073] (-1591.771) * (-1588.885) [-1589.324] (-1589.953) (-1591.381) -- 0:01:04
      86000 -- (-1591.083) [-1588.822] (-1589.431) (-1589.696) * (-1588.494) [-1591.760] (-1590.088) (-1591.714) -- 0:01:03
      86500 -- (-1592.475) (-1588.358) (-1588.795) [-1592.528] * (-1587.821) (-1591.219) [-1590.203] (-1594.466) -- 0:01:03
      87000 -- (-1591.040) [-1587.637] (-1592.066) (-1594.577) * (-1591.259) (-1590.028) (-1588.576) [-1593.059] -- 0:01:02
      87500 -- (-1590.246) [-1587.356] (-1589.755) (-1589.184) * (-1588.458) [-1589.985] (-1594.478) (-1594.774) -- 0:01:02
      88000 -- (-1593.554) (-1589.393) (-1587.512) [-1590.561] * (-1588.681) [-1589.874] (-1588.678) (-1589.376) -- 0:01:02
      88500 -- [-1591.266] (-1590.317) (-1589.015) (-1591.156) * [-1590.093] (-1589.875) (-1590.259) (-1593.729) -- 0:01:01
      89000 -- (-1590.963) (-1591.935) [-1588.359] (-1593.575) * [-1589.575] (-1592.083) (-1589.333) (-1588.286) -- 0:01:01
      89500 -- [-1596.974] (-1591.870) (-1591.365) (-1590.314) * (-1589.926) (-1587.725) [-1589.758] (-1587.911) -- 0:01:01
      90000 -- (-1589.955) (-1594.709) [-1591.405] (-1590.809) * (-1593.571) [-1587.458] (-1590.591) (-1588.780) -- 0:01:00

      Average standard deviation of split frequencies: 0.027730

      90500 -- (-1592.895) (-1588.424) [-1591.997] (-1588.893) * [-1589.061] (-1590.003) (-1591.372) (-1589.471) -- 0:01:00
      91000 -- (-1592.039) (-1587.218) [-1586.917] (-1588.373) * (-1598.155) [-1589.098] (-1588.966) (-1589.974) -- 0:00:59
      91500 -- [-1588.981] (-1590.543) (-1589.894) (-1589.077) * (-1589.052) (-1590.303) [-1588.418] (-1587.706) -- 0:00:59
      92000 -- (-1589.634) [-1591.202] (-1589.099) (-1592.132) * (-1594.607) (-1588.362) [-1590.334] (-1589.319) -- 0:00:59
      92500 -- (-1593.399) [-1588.847] (-1588.837) (-1591.426) * [-1590.731] (-1587.084) (-1590.247) (-1590.031) -- 0:00:58
      93000 -- [-1589.676] (-1590.112) (-1588.731) (-1591.510) * [-1590.609] (-1588.716) (-1592.870) (-1590.169) -- 0:01:08
      93500 -- (-1589.102) [-1591.290] (-1589.877) (-1597.912) * (-1590.866) [-1590.598] (-1590.803) (-1590.347) -- 0:01:07
      94000 -- [-1588.250] (-1587.935) (-1589.054) (-1591.124) * (-1589.847) [-1588.696] (-1589.601) (-1586.315) -- 0:01:07
      94500 -- (-1590.658) [-1593.202] (-1592.687) (-1592.218) * (-1590.779) (-1592.902) [-1589.049] (-1589.836) -- 0:01:07
      95000 -- (-1589.476) (-1588.239) [-1590.338] (-1592.167) * (-1594.316) (-1591.189) (-1589.328) [-1589.057] -- 0:01:06

      Average standard deviation of split frequencies: 0.027124

      95500 -- (-1591.947) (-1588.571) [-1591.595] (-1594.390) * [-1593.219] (-1591.219) (-1589.280) (-1588.760) -- 0:01:06
      96000 -- (-1592.169) [-1588.559] (-1590.162) (-1594.138) * (-1593.554) (-1593.032) [-1588.140] (-1588.821) -- 0:01:05
      96500 -- (-1589.264) (-1590.012) [-1592.443] (-1592.027) * (-1591.059) (-1591.261) (-1588.643) [-1591.138] -- 0:01:05
      97000 -- (-1590.283) (-1590.659) [-1588.775] (-1592.444) * (-1589.013) (-1589.263) (-1591.057) [-1590.036] -- 0:01:05
      97500 -- (-1587.477) [-1590.233] (-1590.164) (-1593.555) * (-1590.906) (-1594.788) [-1590.326] (-1588.940) -- 0:01:04
      98000 -- (-1589.566) (-1590.923) (-1592.940) [-1592.744] * (-1593.974) (-1590.039) (-1591.006) [-1588.968] -- 0:01:04
      98500 -- (-1590.038) [-1591.376] (-1596.963) (-1591.320) * (-1591.036) [-1591.847] (-1594.914) (-1591.439) -- 0:01:04
      99000 -- (-1590.185) [-1591.266] (-1591.316) (-1593.436) * [-1590.922] (-1592.613) (-1594.399) (-1591.243) -- 0:01:03
      99500 -- [-1586.520] (-1588.284) (-1593.246) (-1588.487) * (-1593.105) [-1589.315] (-1590.584) (-1591.143) -- 0:01:03
      100000 -- (-1587.473) [-1588.429] (-1589.415) (-1590.639) * (-1596.985) (-1590.629) [-1588.837] (-1587.407) -- 0:01:02

      Average standard deviation of split frequencies: 0.026536

      100500 -- (-1592.549) (-1591.999) (-1590.612) [-1586.844] * (-1588.109) (-1592.102) (-1588.118) [-1591.513] -- 0:01:02
      101000 -- [-1593.166] (-1589.596) (-1590.917) (-1590.800) * (-1588.545) (-1590.632) [-1588.223] (-1599.168) -- 0:01:02
      101500 -- (-1594.172) (-1589.119) (-1588.409) [-1587.569] * (-1589.639) (-1590.961) [-1592.783] (-1596.519) -- 0:01:01
      102000 -- (-1595.064) (-1587.630) (-1593.147) [-1589.706] * (-1591.452) (-1591.904) (-1590.456) [-1588.048] -- 0:01:01
      102500 -- [-1596.061] (-1593.841) (-1590.377) (-1592.628) * (-1591.331) (-1593.962) (-1590.792) [-1588.951] -- 0:01:01
      103000 -- [-1593.033] (-1589.579) (-1589.934) (-1589.048) * (-1589.203) (-1591.401) (-1592.642) [-1593.879] -- 0:01:00
      103500 -- (-1591.771) (-1591.633) [-1589.038] (-1588.635) * (-1588.310) (-1590.301) [-1589.178] (-1591.386) -- 0:01:00
      104000 -- [-1588.955] (-1593.891) (-1590.895) (-1589.022) * (-1589.961) (-1593.256) (-1598.392) [-1590.621] -- 0:01:00
      104500 -- (-1588.786) (-1593.235) [-1588.869] (-1591.366) * (-1588.710) (-1588.409) [-1591.423] (-1589.246) -- 0:00:59
      105000 -- (-1588.338) [-1589.757] (-1590.079) (-1590.037) * (-1589.894) (-1589.667) (-1593.192) [-1589.065] -- 0:00:59

      Average standard deviation of split frequencies: 0.029109

      105500 -- (-1588.414) (-1588.837) [-1592.047] (-1591.266) * (-1591.311) (-1590.767) [-1591.484] (-1590.085) -- 0:00:59
      106000 -- (-1590.200) (-1593.409) [-1592.289] (-1588.103) * (-1589.505) [-1594.615] (-1592.156) (-1593.367) -- 0:00:59
      106500 -- [-1591.526] (-1594.709) (-1593.535) (-1587.670) * (-1589.071) (-1588.996) [-1589.693] (-1588.131) -- 0:00:58
      107000 -- (-1589.448) (-1592.732) (-1590.809) [-1587.012] * (-1587.599) (-1590.301) [-1590.191] (-1591.147) -- 0:00:58
      107500 -- [-1589.869] (-1589.079) (-1590.378) (-1589.426) * (-1589.765) [-1587.861] (-1593.209) (-1591.576) -- 0:01:06
      108000 -- (-1593.670) (-1591.736) [-1590.030] (-1587.327) * (-1588.472) (-1592.085) (-1589.969) [-1588.786] -- 0:01:06
      108500 -- [-1590.374] (-1590.740) (-1588.157) (-1591.879) * [-1591.845] (-1588.979) (-1591.790) (-1590.085) -- 0:01:05
      109000 -- (-1590.711) (-1589.356) [-1588.708] (-1589.998) * [-1589.400] (-1592.490) (-1592.519) (-1589.939) -- 0:01:05
      109500 -- (-1594.172) [-1588.715] (-1588.680) (-1588.524) * (-1590.752) (-1594.108) [-1589.619] (-1588.812) -- 0:01:05
      110000 -- (-1587.018) [-1587.748] (-1590.933) (-1591.430) * (-1589.848) (-1590.834) [-1588.445] (-1589.281) -- 0:01:04

      Average standard deviation of split frequencies: 0.029412

      110500 -- [-1590.247] (-1588.477) (-1589.165) (-1589.485) * (-1588.337) [-1590.268] (-1588.957) (-1591.856) -- 0:01:04
      111000 -- (-1589.300) (-1590.618) [-1589.935] (-1591.543) * [-1588.855] (-1589.120) (-1592.995) (-1590.910) -- 0:01:04
      111500 -- [-1589.111] (-1589.101) (-1590.631) (-1590.744) * [-1590.320] (-1590.281) (-1590.173) (-1591.775) -- 0:01:03
      112000 -- (-1591.237) (-1588.202) (-1592.207) [-1589.070] * [-1592.346] (-1591.183) (-1589.600) (-1591.910) -- 0:01:03
      112500 -- (-1590.024) [-1587.224] (-1593.849) (-1589.248) * (-1591.025) (-1590.538) (-1589.055) [-1588.701] -- 0:01:03
      113000 -- (-1587.173) (-1590.667) (-1592.344) [-1590.260] * (-1593.345) (-1591.466) (-1592.623) [-1589.818] -- 0:01:02
      113500 -- (-1591.014) (-1587.946) (-1591.130) [-1587.349] * [-1592.984] (-1591.636) (-1590.214) (-1591.040) -- 0:01:02
      114000 -- [-1587.168] (-1591.465) (-1591.131) (-1587.741) * (-1590.531) (-1590.564) [-1588.805] (-1589.704) -- 0:01:02
      114500 -- (-1588.987) [-1592.968] (-1592.665) (-1590.779) * [-1592.480] (-1592.300) (-1586.752) (-1591.880) -- 0:01:01
      115000 -- [-1588.754] (-1598.093) (-1593.211) (-1589.266) * [-1591.760] (-1591.489) (-1587.266) (-1594.063) -- 0:01:01

      Average standard deviation of split frequencies: 0.029186

      115500 -- (-1591.073) [-1588.883] (-1595.601) (-1588.786) * [-1591.594] (-1593.206) (-1589.699) (-1595.167) -- 0:01:01
      116000 -- (-1589.637) (-1589.948) [-1591.740] (-1590.659) * (-1595.845) [-1588.702] (-1588.942) (-1594.145) -- 0:01:00
      116500 -- (-1590.465) [-1588.699] (-1592.477) (-1591.320) * (-1592.096) (-1590.855) (-1588.733) [-1591.096] -- 0:01:00
      117000 -- (-1590.641) [-1589.013] (-1590.057) (-1591.314) * (-1590.066) (-1591.271) [-1590.386] (-1590.115) -- 0:01:00
      117500 -- [-1589.780] (-1588.893) (-1591.315) (-1590.306) * [-1588.215] (-1592.247) (-1588.707) (-1590.022) -- 0:01:00
      118000 -- (-1589.509) [-1589.826] (-1589.284) (-1594.519) * (-1588.595) (-1594.243) (-1589.258) [-1591.432] -- 0:00:59
      118500 -- (-1592.803) [-1591.241] (-1589.383) (-1588.292) * (-1588.850) (-1596.244) [-1587.340] (-1591.215) -- 0:00:59
      119000 -- (-1587.358) (-1590.553) (-1590.170) [-1589.593] * (-1588.710) (-1594.069) (-1589.289) [-1591.280] -- 0:00:59
      119500 -- [-1586.943] (-1591.058) (-1587.769) (-1588.416) * (-1596.177) [-1588.664] (-1591.187) (-1598.931) -- 0:00:58
      120000 -- (-1593.565) [-1588.497] (-1591.507) (-1587.698) * (-1589.497) (-1592.160) [-1588.720] (-1589.271) -- 0:00:58

      Average standard deviation of split frequencies: 0.027905

      120500 -- (-1588.571) (-1590.328) (-1595.714) [-1586.934] * (-1590.575) (-1587.642) (-1591.257) [-1590.084] -- 0:00:58
      121000 -- [-1587.124] (-1591.484) (-1589.358) (-1589.195) * (-1589.473) (-1591.040) (-1590.850) [-1589.667] -- 0:00:58
      121500 -- (-1586.790) (-1592.048) (-1589.263) [-1588.747] * (-1593.319) [-1588.159] (-1591.152) (-1591.787) -- 0:00:57
      122000 -- (-1587.579) (-1590.871) [-1587.989] (-1589.695) * (-1590.585) (-1590.678) [-1592.874] (-1592.247) -- 0:01:04
      122500 -- (-1589.413) [-1591.313] (-1589.118) (-1590.151) * [-1588.753] (-1588.237) (-1591.457) (-1590.133) -- 0:01:04
      123000 -- (-1586.552) (-1590.732) [-1585.940] (-1590.952) * (-1589.868) (-1588.925) [-1591.420] (-1590.745) -- 0:01:04
      123500 -- (-1589.169) (-1589.943) (-1587.413) [-1588.505] * (-1590.194) [-1592.693] (-1590.548) (-1590.201) -- 0:01:03
      124000 -- (-1589.830) (-1588.432) (-1587.638) [-1589.888] * (-1591.490) (-1589.277) (-1589.136) [-1589.367] -- 0:01:03
      124500 -- [-1588.246] (-1592.106) (-1589.732) (-1589.148) * (-1591.007) (-1589.284) (-1587.184) [-1591.547] -- 0:01:03
      125000 -- [-1588.954] (-1593.214) (-1590.138) (-1589.154) * (-1592.954) (-1590.661) [-1587.431] (-1590.933) -- 0:01:03

      Average standard deviation of split frequencies: 0.027793

      125500 -- (-1589.611) (-1600.114) [-1589.287] (-1588.288) * (-1589.868) (-1595.483) (-1586.797) [-1591.609] -- 0:01:02
      126000 -- (-1589.894) (-1591.596) [-1590.848] (-1588.961) * [-1590.675] (-1591.399) (-1589.646) (-1592.746) -- 0:01:02
      126500 -- (-1596.418) (-1592.052) [-1590.368] (-1590.038) * (-1590.989) (-1591.174) (-1590.361) [-1590.529] -- 0:01:02
      127000 -- (-1588.406) (-1591.911) [-1589.482] (-1588.427) * [-1593.028] (-1589.628) (-1592.088) (-1591.772) -- 0:01:01
      127500 -- [-1589.136] (-1590.008) (-1588.445) (-1588.638) * (-1593.660) (-1588.565) (-1590.548) [-1589.453] -- 0:01:01
      128000 -- (-1588.918) (-1590.618) [-1590.384] (-1587.661) * (-1591.049) (-1593.952) (-1590.970) [-1589.217] -- 0:01:01
      128500 -- (-1590.806) (-1589.199) (-1592.212) [-1592.051] * [-1589.992] (-1589.438) (-1588.394) (-1590.585) -- 0:01:01
      129000 -- (-1590.771) (-1592.526) (-1591.918) [-1588.535] * (-1591.279) [-1589.848] (-1589.112) (-1588.640) -- 0:01:00
      129500 -- [-1590.244] (-1588.284) (-1589.237) (-1589.350) * (-1591.695) [-1587.114] (-1588.038) (-1590.728) -- 0:01:00
      130000 -- (-1590.913) (-1590.812) (-1591.649) [-1588.128] * (-1593.257) [-1590.010] (-1587.273) (-1594.934) -- 0:01:00

      Average standard deviation of split frequencies: 0.027058

      130500 -- (-1589.927) [-1591.962] (-1590.034) (-1588.140) * (-1588.337) (-1589.038) [-1586.213] (-1592.897) -- 0:00:59
      131000 -- (-1588.087) (-1589.941) (-1588.454) [-1587.586] * (-1589.385) [-1589.561] (-1589.746) (-1588.430) -- 0:00:59
      131500 -- (-1592.378) (-1588.015) [-1588.243] (-1587.924) * (-1592.980) (-1590.160) (-1590.254) [-1589.402] -- 0:00:59
      132000 -- (-1591.520) [-1590.155] (-1589.229) (-1590.041) * (-1589.592) (-1591.170) [-1593.096] (-1590.167) -- 0:00:59
      132500 -- (-1587.517) [-1590.801] (-1592.175) (-1586.918) * (-1589.229) (-1591.634) [-1590.880] (-1590.097) -- 0:00:58
      133000 -- [-1589.178] (-1588.895) (-1588.198) (-1593.579) * (-1586.595) (-1593.151) [-1594.704] (-1590.600) -- 0:00:58
      133500 -- (-1592.804) (-1591.065) (-1589.287) [-1592.054] * (-1589.359) (-1593.739) [-1588.348] (-1591.135) -- 0:00:58
      134000 -- (-1590.178) [-1588.980] (-1592.665) (-1588.628) * (-1591.392) [-1590.875] (-1588.452) (-1590.009) -- 0:00:58
      134500 -- (-1587.995) [-1589.693] (-1587.659) (-1588.457) * (-1592.826) (-1588.708) (-1591.873) [-1593.440] -- 0:00:57
      135000 -- (-1588.517) (-1590.332) (-1589.945) [-1590.598] * (-1590.839) (-1589.781) (-1592.470) [-1589.924] -- 0:00:57

      Average standard deviation of split frequencies: 0.024263

      135500 -- [-1586.611] (-1588.336) (-1587.790) (-1591.155) * [-1590.778] (-1589.547) (-1590.009) (-1590.175) -- 0:00:57
      136000 -- (-1587.831) (-1588.754) [-1588.433] (-1592.310) * (-1591.247) (-1587.852) [-1587.408] (-1589.921) -- 0:00:57
      136500 -- [-1588.323] (-1592.173) (-1588.649) (-1591.746) * (-1588.468) (-1589.903) (-1587.172) [-1590.453] -- 0:01:03
      137000 -- (-1587.003) (-1589.566) [-1587.997] (-1591.188) * (-1588.809) [-1590.307] (-1590.087) (-1589.701) -- 0:01:02
      137500 -- (-1590.158) (-1591.305) [-1588.977] (-1588.101) * [-1588.971] (-1593.130) (-1591.053) (-1589.554) -- 0:01:02
      138000 -- (-1589.461) (-1591.662) (-1587.886) [-1588.093] * (-1589.540) (-1593.152) (-1590.819) [-1591.959] -- 0:01:02
      138500 -- (-1588.539) [-1589.051] (-1589.946) (-1588.666) * (-1588.849) [-1588.730] (-1591.268) (-1591.781) -- 0:01:02
      139000 -- (-1588.961) [-1589.231] (-1590.446) (-1590.970) * (-1592.323) (-1591.953) [-1594.436] (-1590.057) -- 0:01:01
      139500 -- [-1593.129] (-1590.932) (-1588.692) (-1587.345) * (-1593.220) [-1589.655] (-1589.563) (-1589.412) -- 0:01:01
      140000 -- (-1589.776) [-1590.425] (-1589.370) (-1587.965) * [-1586.966] (-1593.128) (-1592.300) (-1592.128) -- 0:01:01

      Average standard deviation of split frequencies: 0.022956

      140500 -- (-1594.875) (-1589.534) [-1591.841] (-1588.799) * [-1588.879] (-1593.174) (-1594.379) (-1589.993) -- 0:01:01
      141000 -- (-1592.655) (-1589.186) (-1591.331) [-1588.642] * (-1587.455) [-1588.820] (-1590.148) (-1591.907) -- 0:01:00
      141500 -- (-1591.144) (-1589.908) (-1590.666) [-1586.397] * [-1587.422] (-1587.436) (-1588.501) (-1589.416) -- 0:01:00
      142000 -- (-1588.841) [-1590.045] (-1590.715) (-1587.247) * (-1589.459) [-1586.520] (-1592.096) (-1590.390) -- 0:01:00
      142500 -- (-1594.985) [-1590.744] (-1593.745) (-1592.158) * (-1588.606) (-1587.980) (-1590.261) [-1590.972] -- 0:01:00
      143000 -- [-1588.731] (-1591.583) (-1594.970) (-1588.710) * (-1587.240) (-1591.882) (-1588.796) [-1592.507] -- 0:00:59
      143500 -- (-1590.345) (-1595.315) (-1589.933) [-1588.243] * [-1589.305] (-1590.543) (-1589.666) (-1590.916) -- 0:00:59
      144000 -- (-1589.834) (-1592.686) (-1588.465) [-1588.824] * (-1589.274) (-1592.096) (-1591.509) [-1591.481] -- 0:00:59
      144500 -- (-1592.062) [-1589.869] (-1597.717) (-1588.748) * [-1590.253] (-1597.446) (-1588.893) (-1590.964) -- 0:00:59
      145000 -- [-1587.388] (-1596.648) (-1590.780) (-1589.903) * [-1589.409] (-1591.114) (-1590.732) (-1591.964) -- 0:00:58

      Average standard deviation of split frequencies: 0.022308

      145500 -- [-1588.906] (-1589.064) (-1590.838) (-1589.862) * [-1591.998] (-1591.473) (-1592.019) (-1593.798) -- 0:00:58
      146000 -- [-1586.514] (-1589.301) (-1591.064) (-1591.367) * (-1591.571) (-1594.763) (-1593.532) [-1588.852] -- 0:00:58
      146500 -- [-1587.712] (-1589.043) (-1590.231) (-1591.322) * [-1592.284] (-1590.712) (-1588.627) (-1589.959) -- 0:00:58
      147000 -- (-1588.097) (-1588.079) (-1588.412) [-1589.313] * (-1587.905) (-1590.608) (-1591.266) [-1587.240] -- 0:00:58
      147500 -- (-1588.687) (-1590.562) [-1588.331] (-1591.152) * [-1588.276] (-1591.259) (-1591.750) (-1588.604) -- 0:00:57
      148000 -- (-1589.459) (-1593.822) (-1587.183) [-1589.709] * (-1590.286) (-1594.891) (-1591.597) [-1589.739] -- 0:00:57
      148500 -- [-1593.486] (-1592.726) (-1589.470) (-1593.259) * (-1590.727) (-1590.630) (-1592.027) [-1588.781] -- 0:00:57
      149000 -- (-1590.658) (-1590.140) [-1589.212] (-1590.249) * (-1592.209) (-1591.096) (-1592.458) [-1590.375] -- 0:00:57
      149500 -- [-1589.280] (-1594.842) (-1593.800) (-1588.202) * (-1587.846) (-1591.220) (-1592.714) [-1591.980] -- 0:00:56
      150000 -- (-1594.024) (-1592.333) [-1591.701] (-1591.058) * (-1590.067) (-1589.680) [-1590.412] (-1589.734) -- 0:00:56

      Average standard deviation of split frequencies: 0.019242

      150500 -- (-1592.418) (-1592.944) (-1588.564) [-1588.247] * [-1588.580] (-1589.812) (-1596.517) (-1588.748) -- 0:00:56
      151000 -- [-1590.835] (-1593.175) (-1589.742) (-1588.579) * (-1591.107) [-1587.982] (-1591.652) (-1594.796) -- 0:01:01
      151500 -- (-1591.330) (-1588.943) (-1591.877) [-1588.754] * (-1589.536) (-1589.999) [-1588.329] (-1591.323) -- 0:01:01
      152000 -- (-1590.608) (-1588.568) (-1587.785) [-1586.436] * [-1587.664] (-1589.826) (-1590.802) (-1589.539) -- 0:01:01
      152500 -- (-1587.680) (-1588.322) [-1590.061] (-1587.548) * (-1587.013) [-1590.266] (-1591.116) (-1590.902) -- 0:01:01
      153000 -- [-1586.232] (-1591.248) (-1591.976) (-1588.249) * (-1588.991) (-1591.590) [-1591.436] (-1590.722) -- 0:01:00
      153500 -- (-1596.468) [-1591.108] (-1590.757) (-1588.538) * (-1588.514) (-1590.959) [-1587.860] (-1590.703) -- 0:01:00
      154000 -- [-1589.415] (-1588.764) (-1588.639) (-1586.993) * (-1592.508) (-1591.028) (-1589.375) [-1591.868] -- 0:01:00
      154500 -- (-1588.418) (-1589.095) (-1591.149) [-1587.390] * (-1587.266) (-1591.721) [-1592.180] (-1595.654) -- 0:01:00
      155000 -- [-1587.752] (-1594.560) (-1591.731) (-1588.487) * (-1590.288) (-1589.232) [-1590.705] (-1595.061) -- 0:00:59

      Average standard deviation of split frequencies: 0.017972

      155500 -- (-1589.210) (-1593.503) (-1592.216) [-1587.615] * (-1587.676) [-1591.083] (-1590.465) (-1590.840) -- 0:00:59
      156000 -- (-1591.402) [-1591.780] (-1589.576) (-1590.357) * [-1589.460] (-1592.106) (-1592.898) (-1587.890) -- 0:00:59
      156500 -- (-1590.355) [-1590.580] (-1593.739) (-1586.088) * (-1591.441) (-1595.088) [-1587.423] (-1589.213) -- 0:00:59
      157000 -- [-1589.049] (-1589.931) (-1587.046) (-1588.126) * (-1590.747) (-1595.033) [-1592.439] (-1590.151) -- 0:00:59
      157500 -- (-1589.385) (-1588.548) (-1589.886) [-1587.829] * (-1590.541) (-1591.752) (-1592.414) [-1588.836] -- 0:00:58
      158000 -- (-1590.103) [-1593.120] (-1593.450) (-1588.194) * (-1591.972) (-1588.543) [-1590.601] (-1591.677) -- 0:00:58
      158500 -- (-1591.812) (-1593.355) [-1593.114] (-1588.225) * (-1589.349) [-1586.827] (-1592.473) (-1594.790) -- 0:00:58
      159000 -- (-1590.852) [-1593.818] (-1593.813) (-1586.796) * (-1588.039) [-1588.665] (-1588.539) (-1591.256) -- 0:00:58
      159500 -- (-1588.308) (-1593.933) (-1588.869) [-1589.373] * (-1587.827) [-1588.384] (-1590.104) (-1594.043) -- 0:00:57
      160000 -- (-1589.724) [-1590.826] (-1588.216) (-1589.455) * (-1591.152) (-1590.211) (-1589.881) [-1591.080] -- 0:00:57

      Average standard deviation of split frequencies: 0.020075

      160500 -- (-1589.987) (-1591.178) (-1589.505) [-1587.350] * (-1589.321) [-1589.735] (-1589.425) (-1588.230) -- 0:00:57
      161000 -- [-1590.552] (-1590.421) (-1587.908) (-1590.149) * [-1594.399] (-1588.376) (-1587.769) (-1588.977) -- 0:00:57
      161500 -- (-1591.652) [-1595.569] (-1588.943) (-1595.375) * (-1593.172) (-1589.477) (-1590.362) [-1587.763] -- 0:00:57
      162000 -- [-1592.273] (-1591.961) (-1587.741) (-1589.663) * (-1591.173) (-1589.984) (-1591.984) [-1588.444] -- 0:00:56
      162500 -- (-1587.963) [-1593.078] (-1588.410) (-1594.220) * (-1591.060) (-1588.429) (-1594.738) [-1590.782] -- 0:00:56
      163000 -- (-1590.547) (-1591.040) (-1589.608) [-1589.188] * (-1589.050) (-1590.035) (-1594.331) [-1588.971] -- 0:00:56
      163500 -- [-1588.218] (-1591.178) (-1589.083) (-1589.978) * (-1588.996) [-1588.017] (-1591.070) (-1588.892) -- 0:00:56
      164000 -- (-1591.015) (-1589.534) (-1591.553) [-1588.070] * (-1587.512) [-1586.791] (-1589.706) (-1586.844) -- 0:00:56
      164500 -- (-1590.814) [-1590.434] (-1590.689) (-1587.170) * (-1589.815) [-1591.798] (-1591.160) (-1588.422) -- 0:00:55
      165000 -- (-1591.068) (-1594.110) [-1594.557] (-1592.166) * [-1586.997] (-1589.195) (-1589.622) (-1592.514) -- 0:00:55

      Average standard deviation of split frequencies: 0.019595

      165500 -- (-1596.963) (-1592.622) (-1587.595) [-1593.106] * (-1588.425) (-1588.374) (-1590.459) [-1589.363] -- 0:01:00
      166000 -- (-1593.415) [-1591.774] (-1591.375) (-1591.003) * (-1589.281) (-1588.442) [-1588.991] (-1587.779) -- 0:01:00
      166500 -- (-1590.876) (-1590.355) [-1591.249] (-1594.543) * (-1590.331) (-1590.204) (-1592.282) [-1589.467] -- 0:01:00
      167000 -- (-1592.261) (-1588.910) (-1591.542) [-1591.401] * [-1588.250] (-1595.168) (-1589.247) (-1588.836) -- 0:00:59
      167500 -- (-1592.651) (-1589.498) [-1588.089] (-1595.626) * [-1588.586] (-1592.021) (-1591.409) (-1590.559) -- 0:00:59
      168000 -- (-1590.548) (-1590.185) [-1589.396] (-1595.503) * (-1591.006) (-1590.285) [-1590.996] (-1588.907) -- 0:00:59
      168500 -- (-1594.650) [-1592.024] (-1590.264) (-1588.245) * [-1589.212] (-1591.646) (-1591.115) (-1590.601) -- 0:00:59
      169000 -- (-1589.429) (-1594.179) [-1586.753] (-1589.094) * (-1591.017) (-1591.522) [-1589.068] (-1587.890) -- 0:00:59
      169500 -- (-1589.084) [-1588.436] (-1587.802) (-1589.288) * [-1594.773] (-1591.275) (-1589.621) (-1591.228) -- 0:00:58
      170000 -- (-1589.446) (-1590.768) (-1588.504) [-1592.530] * (-1590.981) [-1591.310] (-1588.652) (-1591.554) -- 0:00:58

      Average standard deviation of split frequencies: 0.019611

      170500 -- (-1588.449) (-1588.493) (-1590.482) [-1587.757] * [-1588.967] (-1591.821) (-1590.551) (-1588.547) -- 0:00:58
      171000 -- [-1592.978] (-1589.522) (-1589.079) (-1590.901) * [-1589.733] (-1590.606) (-1591.346) (-1588.480) -- 0:00:58
      171500 -- (-1591.870) [-1590.475] (-1588.812) (-1592.225) * (-1590.617) (-1590.605) [-1589.484] (-1590.137) -- 0:00:57
      172000 -- (-1591.492) [-1590.429] (-1589.071) (-1590.759) * (-1589.304) (-1592.491) (-1589.666) [-1588.825] -- 0:00:57
      172500 -- (-1590.604) (-1590.547) [-1587.756] (-1590.405) * [-1590.443] (-1593.141) (-1588.730) (-1588.824) -- 0:00:57
      173000 -- (-1592.141) (-1590.818) (-1594.151) [-1587.784] * (-1590.636) [-1590.631] (-1589.633) (-1591.366) -- 0:00:57
      173500 -- [-1591.413] (-1590.515) (-1588.572) (-1590.643) * (-1592.677) (-1589.068) (-1592.836) [-1587.043] -- 0:00:57
      174000 -- (-1593.401) [-1590.073] (-1588.098) (-1590.293) * [-1589.695] (-1590.178) (-1588.778) (-1586.894) -- 0:00:56
      174500 -- (-1590.307) (-1590.778) [-1587.773] (-1590.085) * (-1589.117) (-1592.239) (-1591.726) [-1586.477] -- 0:00:56
      175000 -- (-1590.481) (-1587.354) [-1588.036] (-1588.946) * [-1588.830] (-1589.249) (-1591.103) (-1593.395) -- 0:00:56

      Average standard deviation of split frequencies: 0.017903

      175500 -- (-1589.441) (-1587.548) (-1593.861) [-1587.173] * (-1590.860) (-1595.422) [-1590.059] (-1588.014) -- 0:00:56
      176000 -- (-1590.805) (-1591.144) (-1592.367) [-1586.525] * (-1591.342) (-1597.229) (-1594.386) [-1586.461] -- 0:00:56
      176500 -- (-1589.113) (-1592.730) (-1588.330) [-1587.866] * (-1588.802) [-1592.039] (-1594.436) (-1589.620) -- 0:00:55
      177000 -- (-1590.028) [-1591.848] (-1587.524) (-1589.764) * (-1589.549) (-1591.451) [-1593.550] (-1589.564) -- 0:00:55
      177500 -- (-1589.585) [-1590.706] (-1591.329) (-1593.334) * (-1589.552) (-1589.050) (-1588.207) [-1589.319] -- 0:00:55
      178000 -- (-1591.005) [-1590.670] (-1587.529) (-1591.871) * (-1587.634) (-1590.094) (-1589.871) [-1588.675] -- 0:00:55
      178500 -- (-1592.206) (-1591.010) (-1589.579) [-1590.866] * (-1590.593) (-1588.994) [-1589.172] (-1591.007) -- 0:00:55
      179000 -- (-1591.429) (-1593.867) (-1591.171) [-1591.154] * (-1587.798) (-1590.720) (-1587.429) [-1587.693] -- 0:00:55
      179500 -- [-1590.464] (-1594.195) (-1588.409) (-1588.680) * [-1588.537] (-1590.705) (-1590.483) (-1591.192) -- 0:00:54
      180000 -- (-1590.816) (-1592.851) [-1589.194] (-1590.122) * (-1589.289) (-1590.993) (-1589.390) [-1587.300] -- 0:00:54

      Average standard deviation of split frequencies: 0.016479

      180500 -- (-1588.553) (-1591.273) (-1590.137) [-1591.951] * (-1588.269) [-1589.865] (-1593.765) (-1588.886) -- 0:00:59
      181000 -- (-1589.809) (-1587.746) (-1593.347) [-1591.136] * [-1588.895] (-1590.727) (-1594.274) (-1587.552) -- 0:00:58
      181500 -- (-1587.686) (-1589.551) (-1592.254) [-1591.821] * (-1591.963) (-1590.592) (-1589.915) [-1591.482] -- 0:00:58
      182000 -- [-1588.502] (-1588.682) (-1589.776) (-1588.743) * (-1587.565) (-1589.287) (-1591.064) [-1591.919] -- 0:00:58
      182500 -- (-1589.674) [-1590.330] (-1591.602) (-1589.687) * (-1587.693) (-1589.942) (-1591.845) [-1593.173] -- 0:00:58
      183000 -- (-1591.608) [-1590.409] (-1591.639) (-1591.695) * (-1588.965) [-1588.646] (-1591.368) (-1595.921) -- 0:00:58
      183500 -- (-1593.470) [-1589.230] (-1590.237) (-1592.469) * (-1590.066) [-1593.390] (-1586.942) (-1593.232) -- 0:00:57
      184000 -- (-1588.740) (-1590.812) [-1591.510] (-1590.955) * (-1590.471) (-1592.938) [-1589.594] (-1595.244) -- 0:00:57
      184500 -- (-1588.776) (-1593.386) [-1591.941] (-1589.634) * (-1590.687) (-1592.488) [-1590.377] (-1592.631) -- 0:00:57
      185000 -- (-1590.733) (-1590.190) [-1589.315] (-1589.093) * [-1593.896] (-1591.914) (-1591.159) (-1591.773) -- 0:00:57

      Average standard deviation of split frequencies: 0.016407

      185500 -- (-1590.233) (-1588.905) (-1591.885) [-1592.117] * (-1593.212) (-1589.369) (-1590.510) [-1589.394] -- 0:00:57
      186000 -- (-1587.465) (-1590.124) [-1590.695] (-1593.902) * (-1593.893) [-1591.023] (-1592.030) (-1593.719) -- 0:00:56
      186500 -- (-1588.292) [-1587.306] (-1587.834) (-1590.776) * (-1589.929) (-1592.225) [-1590.273] (-1591.413) -- 0:00:56
      187000 -- [-1589.681] (-1592.206) (-1588.941) (-1590.110) * [-1591.952] (-1592.465) (-1592.554) (-1590.620) -- 0:00:56
      187500 -- (-1591.020) [-1591.878] (-1589.858) (-1588.830) * [-1588.678] (-1592.344) (-1593.857) (-1589.658) -- 0:00:56
      188000 -- (-1595.208) (-1595.324) (-1591.113) [-1589.573] * (-1587.359) [-1590.923] (-1591.446) (-1591.699) -- 0:00:56
      188500 -- (-1592.852) (-1593.040) [-1590.183] (-1588.317) * [-1588.757] (-1588.516) (-1589.810) (-1591.288) -- 0:00:55
      189000 -- (-1589.652) (-1592.348) (-1590.552) [-1592.125] * (-1590.352) [-1590.567] (-1588.969) (-1595.573) -- 0:00:55
      189500 -- [-1588.639] (-1592.431) (-1590.400) (-1591.818) * [-1589.788] (-1591.528) (-1589.366) (-1591.947) -- 0:00:55
      190000 -- [-1588.926] (-1592.316) (-1590.962) (-1592.303) * (-1591.421) [-1590.826] (-1587.809) (-1594.212) -- 0:00:55

      Average standard deviation of split frequencies: 0.016136

      190500 -- (-1592.465) (-1591.353) [-1592.091] (-1591.074) * (-1592.559) (-1590.792) (-1590.973) [-1591.792] -- 0:00:55
      191000 -- [-1592.078] (-1591.179) (-1591.260) (-1587.821) * (-1594.166) (-1592.725) [-1590.403] (-1590.541) -- 0:00:55
      191500 -- (-1590.410) (-1594.816) (-1591.154) [-1587.345] * (-1589.776) [-1588.786] (-1595.464) (-1590.743) -- 0:00:54
      192000 -- (-1589.295) (-1588.075) (-1593.026) [-1590.732] * (-1589.708) (-1592.232) [-1592.546] (-1590.800) -- 0:00:54
      192500 -- (-1591.321) (-1589.480) (-1591.702) [-1590.888] * [-1593.288] (-1592.463) (-1594.014) (-1590.290) -- 0:00:54
      193000 -- (-1592.445) [-1589.346] (-1589.092) (-1594.516) * (-1593.931) (-1589.532) [-1590.087] (-1588.744) -- 0:00:54
      193500 -- (-1590.972) (-1587.830) [-1594.007] (-1591.185) * (-1592.623) [-1590.923] (-1591.133) (-1592.311) -- 0:00:54
      194000 -- [-1590.558] (-1588.032) (-1591.663) (-1589.349) * [-1590.017] (-1593.907) (-1589.989) (-1587.405) -- 0:00:54
      194500 -- [-1590.631] (-1591.248) (-1590.493) (-1587.265) * (-1589.160) [-1592.546] (-1595.517) (-1593.649) -- 0:00:53
      195000 -- (-1590.777) (-1588.140) [-1589.326] (-1588.132) * (-1589.584) (-1592.227) (-1595.341) [-1591.134] -- 0:00:57

      Average standard deviation of split frequencies: 0.015064

      195500 -- (-1590.674) (-1592.121) (-1591.573) [-1588.964] * [-1590.251] (-1592.049) (-1591.103) (-1587.161) -- 0:00:57
      196000 -- (-1591.475) (-1593.597) (-1590.561) [-1591.069] * (-1591.290) (-1590.676) (-1593.452) [-1590.746] -- 0:00:57
      196500 -- (-1591.873) (-1588.258) (-1592.409) [-1589.093] * (-1592.203) [-1590.896] (-1587.218) (-1592.553) -- 0:00:57
      197000 -- (-1591.463) (-1588.254) (-1590.682) [-1587.186] * (-1592.056) (-1589.653) [-1587.891] (-1591.554) -- 0:00:57
      197500 -- (-1594.009) (-1589.863) (-1593.038) [-1586.672] * (-1589.879) (-1589.970) (-1591.685) [-1592.890] -- 0:00:56
      198000 -- (-1594.179) (-1589.185) (-1596.039) [-1591.638] * [-1590.553] (-1589.792) (-1591.731) (-1591.293) -- 0:00:56
      198500 -- (-1591.475) (-1590.314) (-1590.663) [-1588.069] * [-1592.156] (-1590.989) (-1592.177) (-1590.340) -- 0:00:56
      199000 -- (-1593.059) (-1587.854) [-1596.915] (-1587.082) * [-1588.431] (-1592.031) (-1590.754) (-1591.304) -- 0:00:56
      199500 -- (-1592.094) (-1586.656) [-1591.920] (-1590.509) * (-1590.637) (-1592.075) (-1589.976) [-1589.622] -- 0:00:56
      200000 -- (-1591.048) [-1587.640] (-1589.111) (-1593.625) * [-1592.029] (-1590.986) (-1591.419) (-1589.844) -- 0:00:55

      Average standard deviation of split frequencies: 0.013965

      200500 -- (-1590.882) (-1590.320) (-1589.828) [-1587.878] * (-1593.192) (-1590.439) [-1590.280] (-1589.433) -- 0:00:55
      201000 -- [-1594.540] (-1590.969) (-1592.388) (-1592.561) * (-1589.100) (-1591.566) (-1590.056) [-1590.224] -- 0:00:55
      201500 -- (-1590.513) [-1589.896] (-1590.698) (-1593.049) * (-1591.573) (-1591.902) [-1592.416] (-1593.070) -- 0:00:55
      202000 -- (-1590.832) (-1587.568) (-1591.000) [-1595.335] * (-1591.574) [-1591.602] (-1588.999) (-1594.293) -- 0:00:55
      202500 -- (-1595.430) [-1588.750] (-1597.213) (-1591.768) * (-1588.436) (-1590.900) [-1587.225] (-1593.309) -- 0:00:55
      203000 -- (-1593.154) (-1591.290) [-1593.545] (-1587.884) * (-1590.234) [-1591.749] (-1595.322) (-1589.511) -- 0:00:54
      203500 -- (-1591.365) (-1591.889) [-1590.494] (-1587.063) * (-1590.590) (-1593.772) (-1588.355) [-1590.132] -- 0:00:54
      204000 -- (-1590.105) [-1592.556] (-1591.766) (-1588.618) * (-1589.851) (-1590.222) [-1586.685] (-1590.466) -- 0:00:54
      204500 -- (-1593.022) [-1588.943] (-1591.949) (-1589.206) * (-1589.530) (-1591.631) (-1589.217) [-1589.792] -- 0:00:54
      205000 -- (-1591.394) (-1589.291) (-1590.507) [-1590.492] * (-1589.122) [-1589.169] (-1589.163) (-1592.463) -- 0:00:54

      Average standard deviation of split frequencies: 0.012586

      205500 -- (-1591.492) (-1589.234) [-1589.932] (-1588.518) * (-1587.204) (-1589.725) [-1592.323] (-1587.745) -- 0:00:54
      206000 -- (-1590.630) [-1590.249] (-1590.374) (-1586.360) * (-1589.296) [-1587.375] (-1591.342) (-1594.734) -- 0:00:53
      206500 -- [-1588.299] (-1592.631) (-1590.544) (-1588.359) * (-1587.889) [-1587.820] (-1590.120) (-1593.598) -- 0:00:53
      207000 -- (-1591.275) (-1592.368) [-1590.392] (-1590.645) * (-1587.347) (-1589.734) (-1591.559) [-1588.721] -- 0:00:53
      207500 -- (-1593.338) (-1591.594) (-1589.900) [-1589.893] * [-1589.624] (-1588.437) (-1586.519) (-1591.761) -- 0:00:53
      208000 -- (-1587.769) [-1596.979] (-1588.993) (-1588.129) * [-1587.767] (-1589.614) (-1590.522) (-1590.965) -- 0:00:53
      208500 -- [-1594.184] (-1594.996) (-1592.872) (-1590.923) * (-1590.811) [-1586.255] (-1591.472) (-1590.170) -- 0:00:53
      209000 -- (-1591.577) (-1593.634) (-1590.409) [-1592.898] * (-1590.389) (-1586.956) [-1586.982] (-1593.103) -- 0:00:52
      209500 -- (-1599.067) (-1592.626) (-1590.885) [-1591.259] * (-1591.633) (-1587.887) (-1587.874) [-1592.266] -- 0:00:56
      210000 -- (-1590.040) [-1591.300] (-1591.069) (-1590.646) * (-1594.244) (-1587.577) [-1588.409] (-1593.188) -- 0:00:56

      Average standard deviation of split frequencies: 0.012805

      210500 -- [-1590.766] (-1592.803) (-1589.246) (-1592.806) * (-1588.776) [-1589.940] (-1587.033) (-1590.606) -- 0:00:56
      211000 -- (-1590.566) [-1594.204] (-1589.621) (-1589.745) * (-1590.557) (-1590.413) (-1589.169) [-1592.269] -- 0:00:56
      211500 -- (-1590.389) (-1592.997) (-1590.014) [-1588.951] * (-1590.760) (-1593.932) (-1590.693) [-1587.234] -- 0:00:55
      212000 -- (-1589.873) [-1590.907] (-1590.867) (-1588.455) * (-1590.716) (-1593.522) (-1592.104) [-1586.488] -- 0:00:55
      212500 -- (-1588.300) (-1588.651) (-1596.949) [-1588.280] * [-1588.671] (-1595.101) (-1590.517) (-1587.699) -- 0:00:55
      213000 -- [-1593.562] (-1592.590) (-1594.061) (-1590.917) * [-1589.590] (-1589.117) (-1590.843) (-1589.687) -- 0:00:55
      213500 -- (-1590.902) (-1590.944) (-1589.717) [-1587.890] * (-1587.306) (-1593.416) [-1592.367] (-1592.642) -- 0:00:55
      214000 -- (-1594.210) [-1590.954] (-1589.863) (-1588.617) * (-1589.400) (-1590.620) (-1593.928) [-1590.537] -- 0:00:55
      214500 -- [-1593.134] (-1589.690) (-1592.381) (-1588.999) * (-1590.763) (-1592.851) (-1591.158) [-1589.456] -- 0:00:54
      215000 -- (-1590.216) (-1590.880) (-1591.261) [-1588.128] * [-1589.335] (-1592.145) (-1591.411) (-1587.431) -- 0:00:54

      Average standard deviation of split frequencies: 0.012973

      215500 -- (-1591.244) (-1591.125) (-1590.974) [-1587.045] * (-1588.938) [-1587.638] (-1590.064) (-1587.216) -- 0:00:54
      216000 -- (-1591.693) (-1589.938) [-1588.080] (-1589.173) * (-1592.034) [-1591.834] (-1593.608) (-1589.448) -- 0:00:54
      216500 -- (-1590.916) (-1589.089) (-1592.901) [-1586.914] * (-1591.405) (-1590.786) (-1590.669) [-1592.691] -- 0:00:54
      217000 -- (-1590.895) (-1591.274) (-1596.805) [-1590.354] * (-1591.810) (-1587.877) (-1591.806) [-1587.572] -- 0:00:54
      217500 -- (-1595.318) (-1588.543) (-1591.505) [-1588.998] * [-1588.820] (-1590.306) (-1590.071) (-1588.725) -- 0:00:53
      218000 -- (-1591.409) (-1588.594) [-1588.797] (-1590.353) * [-1588.399] (-1593.762) (-1590.936) (-1587.622) -- 0:00:53
      218500 -- [-1592.285] (-1592.427) (-1591.564) (-1591.535) * (-1589.069) [-1589.334] (-1590.197) (-1587.311) -- 0:00:53
      219000 -- (-1592.399) [-1591.645] (-1591.853) (-1589.462) * (-1591.925) (-1589.190) (-1591.543) [-1588.935] -- 0:00:53
      219500 -- (-1590.873) (-1589.768) (-1591.848) [-1590.207] * (-1590.305) [-1590.176] (-1592.661) (-1589.855) -- 0:00:53
      220000 -- (-1591.662) [-1587.844] (-1589.023) (-1589.898) * (-1590.045) [-1588.711] (-1589.634) (-1588.131) -- 0:00:53

      Average standard deviation of split frequencies: 0.013886

      220500 -- [-1593.943] (-1588.210) (-1590.080) (-1591.959) * (-1600.641) (-1591.677) [-1587.420] (-1588.483) -- 0:00:53
      221000 -- (-1592.063) (-1589.208) (-1590.891) [-1589.586] * (-1592.804) (-1590.548) (-1587.814) [-1591.044] -- 0:00:52
      221500 -- (-1591.190) [-1587.643] (-1591.282) (-1593.760) * (-1588.841) [-1590.024] (-1586.939) (-1591.308) -- 0:00:52
      222000 -- (-1588.235) (-1587.618) [-1590.432] (-1597.945) * (-1590.329) (-1590.019) [-1587.959] (-1589.835) -- 0:00:52
      222500 -- (-1592.165) (-1590.910) (-1590.787) [-1591.728] * [-1589.343] (-1590.794) (-1593.632) (-1591.844) -- 0:00:52
      223000 -- (-1590.664) (-1589.482) [-1590.726] (-1589.965) * (-1591.852) [-1590.847] (-1591.615) (-1591.720) -- 0:00:52
      223500 -- [-1591.329] (-1589.047) (-1588.119) (-1591.415) * (-1590.704) (-1592.026) [-1588.029] (-1587.752) -- 0:00:52
      224000 -- (-1595.129) (-1589.465) [-1591.476] (-1591.527) * (-1589.340) (-1591.930) [-1587.448] (-1590.187) -- 0:00:51
      224500 -- (-1589.321) (-1588.784) (-1589.060) [-1590.778] * [-1593.644] (-1591.284) (-1589.534) (-1589.602) -- 0:00:55
      225000 -- (-1591.601) [-1588.356] (-1590.201) (-1592.518) * [-1589.739] (-1592.192) (-1587.758) (-1590.177) -- 0:00:55

      Average standard deviation of split frequencies: 0.015369

      225500 -- [-1587.840] (-1590.706) (-1590.897) (-1592.182) * (-1588.334) (-1589.671) (-1591.520) [-1590.612] -- 0:00:54
      226000 -- (-1589.843) [-1588.676] (-1588.177) (-1593.789) * (-1590.800) (-1590.617) [-1587.712] (-1591.274) -- 0:00:54
      226500 -- (-1591.442) (-1589.093) [-1588.330] (-1597.625) * (-1593.958) (-1590.133) (-1591.281) [-1591.152] -- 0:00:54
      227000 -- [-1593.584] (-1590.589) (-1588.974) (-1592.415) * (-1590.730) [-1593.692] (-1595.792) (-1589.206) -- 0:00:54
      227500 -- (-1598.102) (-1588.355) [-1591.296] (-1591.029) * (-1591.709) [-1588.144] (-1590.940) (-1590.886) -- 0:00:54
      228000 -- (-1590.868) (-1588.290) [-1589.570] (-1594.252) * [-1588.175] (-1591.790) (-1591.028) (-1591.243) -- 0:00:54
      228500 -- (-1592.166) (-1587.218) [-1587.895] (-1589.699) * (-1590.066) (-1592.451) [-1590.190] (-1589.127) -- 0:00:54
      229000 -- [-1589.012] (-1592.966) (-1590.690) (-1590.118) * (-1592.644) (-1591.331) [-1590.819] (-1591.518) -- 0:00:53
      229500 -- (-1591.663) (-1590.395) [-1590.290] (-1592.122) * [-1589.324] (-1587.690) (-1594.281) (-1591.729) -- 0:00:53
      230000 -- [-1592.024] (-1588.461) (-1593.052) (-1591.395) * (-1589.284) [-1591.571] (-1596.121) (-1591.772) -- 0:00:53

      Average standard deviation of split frequencies: 0.014817

      230500 -- [-1589.150] (-1590.053) (-1590.297) (-1593.873) * (-1591.622) [-1587.132] (-1588.982) (-1591.674) -- 0:00:53
      231000 -- (-1592.486) [-1588.847] (-1592.489) (-1591.149) * (-1588.398) (-1588.454) (-1595.649) [-1589.666] -- 0:00:53
      231500 -- (-1593.772) (-1588.233) (-1593.184) [-1592.060] * (-1587.846) [-1593.602] (-1589.150) (-1591.000) -- 0:00:53
      232000 -- [-1590.855] (-1589.179) (-1592.234) (-1591.539) * [-1589.391] (-1587.444) (-1589.258) (-1592.452) -- 0:00:52
      232500 -- (-1590.473) (-1590.866) [-1588.229] (-1591.234) * (-1591.589) (-1589.095) (-1588.178) [-1592.333] -- 0:00:52
      233000 -- (-1590.379) [-1587.171] (-1587.724) (-1589.457) * (-1592.707) (-1591.776) (-1589.995) [-1588.594] -- 0:00:52
      233500 -- (-1590.931) (-1590.138) [-1590.949] (-1589.386) * (-1589.743) (-1590.355) [-1587.018] (-1588.970) -- 0:00:52
      234000 -- [-1590.802] (-1587.929) (-1590.586) (-1589.496) * (-1590.847) (-1589.691) [-1586.593] (-1593.638) -- 0:00:52
      234500 -- (-1591.962) (-1593.669) [-1590.800] (-1590.590) * (-1588.383) [-1591.311] (-1594.709) (-1589.728) -- 0:00:52
      235000 -- [-1596.333] (-1591.641) (-1587.670) (-1589.280) * (-1592.815) (-1591.165) (-1587.648) [-1589.875] -- 0:00:52

      Average standard deviation of split frequencies: 0.016979

      235500 -- (-1592.483) [-1591.977] (-1590.049) (-1591.039) * (-1592.040) [-1589.665] (-1590.896) (-1590.454) -- 0:00:51
      236000 -- [-1594.186] (-1587.593) (-1594.168) (-1590.917) * [-1590.195] (-1589.358) (-1588.379) (-1588.453) -- 0:00:51
      236500 -- [-1589.457] (-1590.684) (-1589.798) (-1593.913) * (-1590.077) [-1588.670] (-1589.053) (-1590.403) -- 0:00:51
      237000 -- (-1590.825) [-1591.082] (-1592.519) (-1587.726) * (-1588.730) [-1587.954] (-1589.771) (-1590.723) -- 0:00:51
      237500 -- (-1588.829) (-1590.540) [-1588.105] (-1590.801) * [-1589.746] (-1589.969) (-1594.185) (-1588.545) -- 0:00:51
      238000 -- (-1590.247) [-1589.921] (-1591.199) (-1592.487) * [-1591.390] (-1590.752) (-1591.490) (-1590.082) -- 0:00:51
      238500 -- (-1588.837) [-1587.224] (-1588.938) (-1591.353) * (-1590.055) [-1591.182] (-1591.091) (-1589.914) -- 0:00:51
      239000 -- (-1589.352) (-1588.616) (-1588.624) [-1589.140] * (-1591.408) (-1594.573) (-1590.519) [-1588.870] -- 0:00:54
      239500 -- (-1592.662) (-1591.418) [-1588.062] (-1589.187) * (-1590.583) (-1588.710) [-1592.016] (-1596.583) -- 0:00:53
      240000 -- [-1593.638] (-1590.930) (-1591.843) (-1590.825) * (-1588.348) [-1588.936] (-1591.985) (-1592.239) -- 0:00:53

      Average standard deviation of split frequencies: 0.014639

      240500 -- [-1589.905] (-1588.755) (-1591.771) (-1590.295) * (-1592.315) (-1589.826) [-1591.294] (-1591.503) -- 0:00:53
      241000 -- (-1593.340) (-1588.513) [-1590.555] (-1589.726) * (-1590.086) (-1590.773) [-1590.797] (-1590.721) -- 0:00:53
      241500 -- (-1590.849) [-1591.174] (-1587.420) (-1593.939) * (-1590.480) (-1586.898) (-1591.954) [-1592.092] -- 0:00:53
      242000 -- (-1594.806) (-1589.837) (-1589.066) [-1590.828] * (-1592.337) [-1587.100] (-1592.801) (-1589.591) -- 0:00:53
      242500 -- (-1591.687) [-1588.871] (-1590.299) (-1586.770) * (-1594.136) (-1591.217) (-1592.359) [-1590.382] -- 0:00:53
      243000 -- (-1591.683) [-1589.667] (-1590.991) (-1589.653) * [-1588.548] (-1595.265) (-1589.790) (-1587.185) -- 0:00:52
      243500 -- (-1591.736) (-1593.226) (-1593.531) [-1589.752] * (-1592.682) (-1588.851) [-1589.312] (-1590.691) -- 0:00:52
      244000 -- (-1591.713) (-1593.203) [-1592.174] (-1592.486) * (-1592.667) (-1591.710) [-1588.326] (-1593.021) -- 0:00:52
      244500 -- [-1592.996] (-1592.214) (-1595.489) (-1594.571) * (-1589.305) (-1590.195) [-1591.633] (-1592.176) -- 0:00:52
      245000 -- [-1592.290] (-1589.747) (-1589.429) (-1596.210) * [-1593.771] (-1587.446) (-1592.229) (-1590.630) -- 0:00:52

      Average standard deviation of split frequencies: 0.016480

      245500 -- (-1592.886) (-1590.652) [-1587.270] (-1591.960) * (-1592.931) [-1590.774] (-1592.314) (-1590.891) -- 0:00:52
      246000 -- (-1592.460) (-1589.956) (-1590.625) [-1593.920] * [-1592.454] (-1593.474) (-1588.573) (-1590.922) -- 0:00:52
      246500 -- (-1594.932) (-1588.653) [-1588.764] (-1591.049) * (-1595.318) (-1592.345) [-1589.558] (-1590.602) -- 0:00:51
      247000 -- (-1594.683) (-1589.320) (-1589.915) [-1592.148] * (-1593.216) [-1589.144] (-1590.985) (-1589.079) -- 0:00:51
      247500 -- (-1592.816) (-1590.022) [-1592.226] (-1589.105) * (-1587.812) (-1591.283) (-1590.946) [-1591.034] -- 0:00:51
      248000 -- (-1591.890) (-1589.090) (-1587.827) [-1589.402] * [-1589.988] (-1590.208) (-1589.565) (-1591.090) -- 0:00:51
      248500 -- (-1588.261) (-1591.073) [-1588.948] (-1590.803) * [-1588.413] (-1590.410) (-1587.218) (-1591.165) -- 0:00:51
      249000 -- (-1591.215) (-1595.268) [-1588.476] (-1594.110) * (-1590.654) [-1589.807] (-1589.619) (-1593.040) -- 0:00:51
      249500 -- (-1592.791) (-1591.675) (-1589.927) [-1589.916] * (-1589.184) (-1591.458) (-1590.964) [-1591.207] -- 0:00:51
      250000 -- (-1590.886) (-1590.939) (-1589.210) [-1591.663] * (-1588.989) (-1587.293) [-1589.038] (-1593.820) -- 0:00:51

      Average standard deviation of split frequencies: 0.019464

      250500 -- (-1592.461) [-1591.099] (-1590.318) (-1590.030) * (-1590.846) (-1585.943) [-1587.622] (-1591.114) -- 0:00:50
      251000 -- (-1589.759) [-1589.411] (-1588.436) (-1599.858) * (-1590.038) (-1589.105) [-1587.456] (-1590.462) -- 0:00:50
      251500 -- [-1592.828] (-1593.868) (-1591.502) (-1588.178) * [-1589.350] (-1589.134) (-1596.010) (-1588.420) -- 0:00:50
      252000 -- (-1590.728) [-1591.829] (-1596.304) (-1589.349) * (-1589.919) [-1587.022] (-1593.672) (-1588.160) -- 0:00:50
      252500 -- (-1590.641) (-1588.897) [-1592.502] (-1589.803) * (-1589.887) (-1587.595) (-1592.733) [-1591.489] -- 0:00:50
      253000 -- (-1589.701) (-1589.205) [-1590.370] (-1595.448) * [-1592.375] (-1588.802) (-1589.591) (-1592.544) -- 0:00:50
      253500 -- (-1589.747) (-1592.333) [-1592.918] (-1590.442) * [-1590.748] (-1589.549) (-1589.514) (-1592.401) -- 0:00:53
      254000 -- [-1589.746] (-1588.865) (-1590.487) (-1590.154) * (-1587.569) [-1587.570] (-1588.552) (-1589.943) -- 0:00:52
      254500 -- [-1588.233] (-1588.522) (-1591.279) (-1589.100) * (-1588.535) [-1587.823] (-1592.885) (-1591.230) -- 0:00:52
      255000 -- (-1592.452) [-1587.621] (-1591.632) (-1590.328) * (-1592.167) (-1593.230) (-1589.387) [-1589.795] -- 0:00:52

      Average standard deviation of split frequencies: 0.021031

      255500 -- [-1588.647] (-1587.593) (-1590.607) (-1588.198) * (-1589.386) (-1588.820) [-1589.362] (-1593.164) -- 0:00:52
      256000 -- (-1589.202) [-1586.658] (-1595.153) (-1590.036) * [-1590.122] (-1590.523) (-1590.109) (-1593.257) -- 0:00:52
      256500 -- (-1588.412) (-1588.102) (-1592.355) [-1587.272] * (-1590.031) [-1588.449] (-1591.084) (-1590.845) -- 0:00:52
      257000 -- (-1588.092) (-1588.996) [-1592.221] (-1588.996) * [-1589.916] (-1590.629) (-1591.676) (-1596.153) -- 0:00:52
      257500 -- (-1589.686) [-1589.023] (-1589.329) (-1589.750) * (-1588.831) [-1589.606] (-1587.452) (-1591.163) -- 0:00:51
      258000 -- (-1589.194) (-1587.114) (-1591.261) [-1586.707] * [-1586.183] (-1593.718) (-1594.087) (-1590.967) -- 0:00:51
      258500 -- [-1589.868] (-1590.077) (-1588.521) (-1590.663) * [-1591.488] (-1595.681) (-1589.028) (-1591.481) -- 0:00:51
      259000 -- (-1590.648) (-1587.996) [-1591.351] (-1589.878) * [-1591.957] (-1596.458) (-1589.433) (-1591.935) -- 0:00:51
      259500 -- (-1592.937) [-1589.509] (-1592.712) (-1589.139) * [-1588.495] (-1591.362) (-1590.727) (-1595.468) -- 0:00:51
      260000 -- (-1593.482) [-1588.022] (-1594.691) (-1588.078) * [-1587.500] (-1589.319) (-1587.626) (-1593.188) -- 0:00:51

      Average standard deviation of split frequencies: 0.021701

      260500 -- (-1593.652) [-1588.691] (-1593.209) (-1588.646) * (-1590.290) [-1590.565] (-1593.563) (-1594.198) -- 0:00:51
      261000 -- [-1594.035] (-1589.409) (-1591.359) (-1589.733) * (-1587.204) (-1588.535) [-1593.450] (-1600.210) -- 0:00:50
      261500 -- [-1591.791] (-1587.393) (-1590.687) (-1590.473) * [-1590.571] (-1592.471) (-1589.698) (-1590.098) -- 0:00:50
      262000 -- [-1591.232] (-1590.760) (-1589.140) (-1591.379) * (-1593.383) (-1589.406) [-1591.307] (-1590.765) -- 0:00:50
      262500 -- (-1592.025) (-1589.486) [-1595.105] (-1591.490) * (-1592.705) (-1590.621) [-1592.427] (-1590.123) -- 0:00:50
      263000 -- (-1591.784) (-1589.500) [-1593.027] (-1589.579) * (-1592.330) (-1589.859) [-1592.421] (-1589.708) -- 0:00:50
      263500 -- (-1591.198) (-1588.216) (-1588.880) [-1588.690] * (-1589.057) (-1588.832) (-1588.909) [-1593.395] -- 0:00:50
      264000 -- (-1590.526) (-1595.735) (-1594.981) [-1587.382] * (-1593.058) (-1593.779) [-1588.283] (-1593.438) -- 0:00:50
      264500 -- (-1590.739) (-1596.379) [-1588.805] (-1589.708) * (-1590.490) (-1591.037) (-1586.543) [-1592.385] -- 0:00:50
      265000 -- [-1587.511] (-1596.515) (-1590.176) (-1590.914) * [-1588.018] (-1590.743) (-1591.109) (-1591.184) -- 0:00:49

      Average standard deviation of split frequencies: 0.019583

      265500 -- (-1590.365) (-1592.874) [-1589.511] (-1588.762) * [-1587.604] (-1590.409) (-1588.067) (-1591.830) -- 0:00:49
      266000 -- (-1592.415) [-1591.087] (-1594.878) (-1592.288) * [-1589.137] (-1589.527) (-1590.706) (-1593.196) -- 0:00:49
      266500 -- [-1589.412] (-1594.117) (-1590.085) (-1589.932) * (-1586.617) [-1592.018] (-1587.799) (-1591.385) -- 0:00:49
      267000 -- (-1590.369) [-1591.244] (-1588.945) (-1593.597) * [-1588.319] (-1589.192) (-1593.801) (-1591.235) -- 0:00:49
      267500 -- (-1593.802) (-1593.809) [-1588.706] (-1596.084) * [-1587.624] (-1588.322) (-1590.638) (-1590.828) -- 0:00:49
      268000 -- (-1594.033) [-1591.603] (-1587.570) (-1594.733) * [-1587.328] (-1591.299) (-1590.996) (-1592.950) -- 0:00:51
      268500 -- (-1591.728) (-1592.228) (-1591.121) [-1590.611] * (-1587.647) (-1590.707) [-1588.971] (-1592.291) -- 0:00:51
      269000 -- (-1594.686) (-1589.669) [-1591.154] (-1587.560) * (-1590.900) [-1590.618] (-1587.938) (-1589.145) -- 0:00:51
      269500 -- [-1593.907] (-1591.154) (-1590.409) (-1587.818) * (-1589.559) (-1592.070) [-1587.046] (-1591.319) -- 0:00:51
      270000 -- (-1596.344) (-1593.806) [-1590.073] (-1588.428) * (-1588.423) [-1587.117] (-1590.139) (-1594.728) -- 0:00:51

      Average standard deviation of split frequencies: 0.020716

      270500 -- (-1594.690) (-1592.335) [-1589.892] (-1591.696) * [-1592.805] (-1591.647) (-1587.628) (-1590.360) -- 0:00:51
      271000 -- (-1590.705) [-1592.224] (-1589.621) (-1587.135) * [-1588.771] (-1589.610) (-1592.014) (-1593.243) -- 0:00:51
      271500 -- (-1590.190) (-1592.121) [-1589.153] (-1589.140) * [-1587.560] (-1590.542) (-1588.774) (-1589.537) -- 0:00:50
      272000 -- (-1591.225) [-1590.271] (-1590.409) (-1591.898) * [-1590.211] (-1590.752) (-1590.873) (-1594.345) -- 0:00:50
      272500 -- (-1590.673) (-1592.167) [-1592.216] (-1590.997) * (-1589.737) [-1586.799] (-1594.324) (-1590.274) -- 0:00:50
      273000 -- (-1591.542) [-1590.716] (-1593.386) (-1590.110) * (-1589.942) [-1591.105] (-1594.897) (-1593.931) -- 0:00:50
      273500 -- [-1588.591] (-1590.398) (-1591.702) (-1590.720) * (-1588.581) (-1588.924) [-1593.452] (-1595.426) -- 0:00:50
      274000 -- (-1590.110) (-1588.224) (-1589.701) [-1591.041] * (-1588.354) (-1590.344) [-1591.516] (-1588.372) -- 0:00:50
      274500 -- (-1587.818) [-1588.421] (-1593.365) (-1588.554) * (-1588.592) (-1589.290) [-1588.266] (-1588.557) -- 0:00:50
      275000 -- (-1589.589) [-1589.155] (-1594.816) (-1589.167) * (-1587.278) (-1589.071) (-1593.793) [-1588.772] -- 0:00:50

      Average standard deviation of split frequencies: 0.020226

      275500 -- [-1588.597] (-1597.103) (-1588.359) (-1589.686) * (-1590.376) (-1589.508) (-1589.968) [-1589.484] -- 0:00:49
      276000 -- (-1591.729) (-1591.679) (-1589.172) [-1589.247] * (-1588.364) (-1589.551) [-1591.058] (-1593.338) -- 0:00:49
      276500 -- (-1592.596) (-1594.153) (-1587.591) [-1593.016] * (-1592.048) (-1591.504) [-1591.072] (-1591.259) -- 0:00:49
      277000 -- (-1592.249) (-1593.174) (-1588.459) [-1590.073] * [-1589.924] (-1590.840) (-1589.157) (-1590.085) -- 0:00:49
      277500 -- (-1594.197) [-1590.758] (-1587.075) (-1590.367) * (-1592.885) [-1590.641] (-1592.326) (-1593.468) -- 0:00:49
      278000 -- [-1593.762] (-1590.108) (-1589.642) (-1591.454) * (-1590.521) (-1588.986) (-1591.171) [-1589.260] -- 0:00:49
      278500 -- (-1591.419) [-1594.242] (-1589.634) (-1588.770) * (-1589.495) (-1590.989) [-1588.151] (-1595.208) -- 0:00:49
      279000 -- [-1589.961] (-1592.294) (-1592.164) (-1591.059) * (-1589.697) (-1590.807) (-1593.749) [-1590.747] -- 0:00:49
      279500 -- (-1594.369) (-1588.569) (-1595.029) [-1594.620] * (-1595.653) (-1587.797) [-1588.417] (-1590.148) -- 0:00:48
      280000 -- (-1594.277) [-1588.650] (-1594.161) (-1592.825) * (-1586.999) (-1591.580) [-1589.830] (-1589.331) -- 0:00:48

      Average standard deviation of split frequencies: 0.021039

      280500 -- [-1590.857] (-1589.219) (-1590.714) (-1594.125) * (-1587.823) (-1588.927) (-1593.443) [-1590.929] -- 0:00:48
      281000 -- (-1590.361) (-1591.158) [-1589.716] (-1599.270) * (-1588.806) [-1589.030] (-1593.441) (-1598.614) -- 0:00:48
      281500 -- (-1588.139) (-1590.192) (-1587.922) [-1594.109] * (-1589.393) [-1593.713] (-1591.994) (-1592.555) -- 0:00:48
      282000 -- (-1593.174) (-1589.652) [-1593.570] (-1590.498) * [-1589.723] (-1591.593) (-1590.332) (-1591.393) -- 0:00:48
      282500 -- (-1593.688) [-1590.459] (-1590.265) (-1591.134) * (-1589.176) (-1587.918) (-1588.757) [-1590.154] -- 0:00:50
      283000 -- (-1590.181) [-1589.820] (-1587.131) (-1589.986) * (-1589.583) (-1591.387) [-1589.144] (-1590.108) -- 0:00:50
      283500 -- (-1591.200) (-1588.625) (-1592.289) [-1590.413] * (-1587.834) [-1585.533] (-1590.798) (-1590.698) -- 0:00:50
      284000 -- (-1591.318) (-1591.014) [-1586.911] (-1591.859) * [-1589.813] (-1588.947) (-1588.493) (-1589.938) -- 0:00:50
      284500 -- [-1590.971] (-1588.574) (-1589.309) (-1594.030) * (-1588.185) [-1588.381] (-1587.962) (-1591.308) -- 0:00:50
      285000 -- (-1591.451) (-1592.534) (-1588.987) [-1591.949] * (-1587.205) [-1593.472] (-1591.734) (-1589.144) -- 0:00:50

      Average standard deviation of split frequencies: 0.020733

      285500 -- (-1591.502) (-1590.825) [-1590.914] (-1591.778) * (-1590.117) (-1594.380) (-1592.271) [-1591.856] -- 0:00:50
      286000 -- [-1591.247] (-1590.789) (-1590.638) (-1591.485) * (-1592.339) (-1590.040) (-1592.089) [-1594.216] -- 0:00:49
      286500 -- (-1592.656) (-1591.766) (-1593.900) [-1591.303] * [-1591.120] (-1590.281) (-1589.214) (-1593.820) -- 0:00:49
      287000 -- [-1591.371] (-1592.106) (-1592.055) (-1595.069) * (-1591.148) (-1589.200) [-1593.064] (-1592.973) -- 0:00:49
      287500 -- (-1593.999) (-1592.444) [-1591.878] (-1593.565) * (-1589.997) (-1590.109) [-1589.709] (-1590.661) -- 0:00:49
      288000 -- (-1591.341) (-1593.440) [-1588.289] (-1592.008) * (-1591.216) [-1588.212] (-1587.107) (-1592.941) -- 0:00:49
      288500 -- (-1587.109) [-1589.320] (-1591.822) (-1594.195) * [-1591.451] (-1586.923) (-1588.919) (-1591.771) -- 0:00:49
      289000 -- [-1587.247] (-1589.918) (-1594.083) (-1593.383) * (-1589.061) (-1591.274) (-1589.903) [-1588.907] -- 0:00:49
      289500 -- [-1589.023] (-1587.904) (-1590.834) (-1592.137) * (-1588.293) (-1587.945) [-1586.897] (-1592.831) -- 0:00:49
      290000 -- (-1593.925) [-1592.998] (-1589.873) (-1592.680) * (-1590.163) (-1591.175) (-1589.356) [-1591.295] -- 0:00:48

      Average standard deviation of split frequencies: 0.020401

      290500 -- [-1587.712] (-1592.442) (-1590.386) (-1590.353) * (-1591.169) (-1589.878) (-1589.030) [-1588.931] -- 0:00:48
      291000 -- (-1588.195) [-1590.949] (-1593.257) (-1590.102) * (-1595.300) (-1591.408) (-1590.685) [-1588.434] -- 0:00:48
      291500 -- (-1589.149) (-1591.786) [-1587.342] (-1589.816) * [-1588.647] (-1591.752) (-1591.640) (-1590.387) -- 0:00:48
      292000 -- (-1587.635) (-1594.958) [-1590.089] (-1589.168) * [-1588.471] (-1591.183) (-1591.113) (-1590.507) -- 0:00:48
      292500 -- [-1589.791] (-1591.809) (-1590.484) (-1592.217) * (-1589.025) (-1590.611) [-1590.339] (-1591.471) -- 0:00:48
      293000 -- [-1588.311] (-1594.472) (-1590.670) (-1591.596) * [-1590.320] (-1591.302) (-1593.026) (-1588.629) -- 0:00:48
      293500 -- (-1592.908) (-1592.463) (-1592.577) [-1590.337] * [-1594.762] (-1591.102) (-1591.334) (-1587.244) -- 0:00:48
      294000 -- (-1590.158) (-1595.620) (-1590.341) [-1590.264] * (-1588.439) (-1589.154) (-1589.793) [-1588.412] -- 0:00:48
      294500 -- [-1588.498] (-1590.939) (-1590.457) (-1591.239) * [-1588.981] (-1591.882) (-1589.378) (-1590.112) -- 0:00:47
      295000 -- (-1589.479) (-1592.088) (-1590.920) [-1589.330] * [-1590.669] (-1594.936) (-1588.704) (-1590.885) -- 0:00:47

      Average standard deviation of split frequencies: 0.020704

      295500 -- (-1593.352) (-1589.752) [-1590.428] (-1590.900) * (-1589.163) (-1593.794) [-1589.923] (-1589.935) -- 0:00:47
      296000 -- (-1589.279) (-1589.956) [-1587.913] (-1590.643) * (-1587.954) (-1590.709) (-1592.199) [-1588.369] -- 0:00:47
      296500 -- [-1586.673] (-1592.502) (-1590.946) (-1590.694) * (-1586.476) (-1591.657) (-1591.634) [-1588.075] -- 0:00:47
      297000 -- (-1587.500) (-1597.738) [-1590.780] (-1592.173) * (-1587.157) (-1591.742) (-1595.200) [-1587.207] -- 0:00:49
      297500 -- (-1587.187) (-1589.768) [-1590.594] (-1590.574) * (-1593.265) (-1588.004) [-1588.150] (-1595.086) -- 0:00:49
      298000 -- [-1590.773] (-1592.408) (-1590.910) (-1590.343) * (-1590.332) (-1589.977) (-1591.221) [-1588.792] -- 0:00:49
      298500 -- [-1588.936] (-1592.312) (-1591.347) (-1589.247) * (-1588.691) (-1596.283) (-1591.173) [-1589.368] -- 0:00:49
      299000 -- [-1594.382] (-1593.246) (-1591.255) (-1588.851) * [-1590.123] (-1590.551) (-1589.786) (-1588.620) -- 0:00:49
      299500 -- (-1591.529) [-1589.564] (-1591.573) (-1590.290) * (-1592.730) (-1589.250) [-1590.630] (-1587.201) -- 0:00:49
      300000 -- (-1593.753) [-1587.793] (-1591.245) (-1591.040) * (-1592.697) [-1588.114] (-1590.452) (-1589.357) -- 0:00:48

      Average standard deviation of split frequencies: 0.020295

      300500 -- (-1591.920) (-1589.590) (-1587.277) [-1591.097] * (-1591.022) (-1590.184) (-1587.731) [-1589.659] -- 0:00:48
      301000 -- [-1592.520] (-1587.206) (-1587.817) (-1591.234) * (-1591.727) (-1589.873) (-1590.579) [-1589.423] -- 0:00:48
      301500 -- (-1591.578) [-1588.708] (-1589.713) (-1589.537) * (-1590.150) (-1590.424) (-1592.113) [-1589.675] -- 0:00:48
      302000 -- (-1591.371) [-1587.116] (-1589.690) (-1590.682) * (-1589.415) [-1591.288] (-1594.533) (-1591.709) -- 0:00:48
      302500 -- (-1591.418) (-1590.028) [-1588.706] (-1592.042) * (-1593.445) (-1587.995) [-1591.636] (-1591.627) -- 0:00:48
      303000 -- (-1594.198) (-1589.997) [-1587.856] (-1592.385) * (-1590.242) (-1588.721) (-1591.495) [-1590.320] -- 0:00:48
      303500 -- (-1590.764) (-1587.994) [-1589.999] (-1592.597) * (-1587.823) (-1586.880) (-1595.709) [-1592.264] -- 0:00:48
      304000 -- [-1591.207] (-1593.775) (-1589.349) (-1591.879) * [-1588.129] (-1590.189) (-1591.775) (-1590.279) -- 0:00:48
      304500 -- [-1589.551] (-1594.453) (-1589.187) (-1591.218) * (-1590.472) (-1590.966) (-1588.656) [-1587.689] -- 0:00:47
      305000 -- [-1591.204] (-1593.356) (-1589.729) (-1591.500) * (-1590.421) [-1590.797] (-1589.506) (-1589.111) -- 0:00:47

      Average standard deviation of split frequencies: 0.019796

      305500 -- [-1592.603] (-1592.082) (-1586.660) (-1594.127) * [-1589.787] (-1587.772) (-1588.600) (-1590.246) -- 0:00:47
      306000 -- [-1587.486] (-1591.439) (-1588.553) (-1588.483) * [-1593.216] (-1593.086) (-1592.623) (-1589.479) -- 0:00:47
      306500 -- [-1589.525] (-1592.065) (-1591.377) (-1591.677) * (-1592.021) (-1590.562) (-1590.612) [-1590.793] -- 0:00:47
      307000 -- (-1588.912) (-1589.441) [-1592.845] (-1592.023) * (-1592.810) [-1590.355] (-1588.677) (-1593.566) -- 0:00:47
      307500 -- (-1589.856) (-1589.079) (-1590.025) [-1590.162] * (-1591.394) (-1588.540) (-1587.912) [-1589.428] -- 0:00:47
      308000 -- (-1590.247) [-1588.395] (-1588.102) (-1588.355) * (-1589.673) [-1589.035] (-1588.098) (-1593.038) -- 0:00:47
      308500 -- (-1591.792) (-1589.064) (-1587.761) [-1589.604] * (-1589.412) (-1590.128) (-1590.583) [-1586.978] -- 0:00:47
      309000 -- (-1590.412) (-1588.510) [-1587.466] (-1589.452) * (-1588.296) [-1589.129] (-1590.748) (-1589.693) -- 0:00:46
      309500 -- (-1589.175) (-1591.211) (-1588.063) [-1592.695] * (-1587.564) (-1589.465) [-1587.262] (-1588.709) -- 0:00:46
      310000 -- (-1590.488) [-1590.468] (-1587.510) (-1591.478) * (-1586.858) [-1596.406] (-1587.384) (-1595.407) -- 0:00:46

      Average standard deviation of split frequencies: 0.019043

      310500 -- (-1590.091) (-1587.669) (-1588.658) [-1589.112] * (-1591.507) (-1589.747) [-1589.077] (-1590.444) -- 0:00:46
      311000 -- (-1589.940) (-1592.574) (-1589.415) [-1586.960] * (-1592.090) (-1592.849) (-1590.894) [-1588.324] -- 0:00:46
      311500 -- (-1592.569) (-1592.045) (-1589.946) [-1590.189] * [-1591.747] (-1592.402) (-1592.502) (-1590.354) -- 0:00:46
      312000 -- (-1591.351) (-1589.181) [-1590.819] (-1589.688) * (-1592.175) (-1592.819) [-1591.209] (-1590.156) -- 0:00:48
      312500 -- (-1591.260) (-1591.341) [-1590.830] (-1590.443) * (-1588.887) (-1591.089) [-1589.637] (-1590.638) -- 0:00:48
      313000 -- (-1589.810) (-1595.479) [-1591.552] (-1589.852) * (-1590.471) (-1593.410) (-1594.344) [-1592.591] -- 0:00:48
      313500 -- (-1591.229) (-1590.381) (-1590.990) [-1590.460] * (-1591.328) (-1592.855) [-1589.433] (-1591.451) -- 0:00:48
      314000 -- (-1593.276) [-1590.163] (-1590.623) (-1591.493) * [-1589.258] (-1591.503) (-1591.021) (-1591.807) -- 0:00:48
      314500 -- (-1591.820) (-1591.250) (-1589.210) [-1590.912] * (-1589.304) [-1588.749] (-1586.901) (-1588.170) -- 0:00:47
      315000 -- [-1592.118] (-1591.191) (-1590.286) (-1590.034) * (-1591.284) (-1592.577) [-1589.362] (-1588.412) -- 0:00:47

      Average standard deviation of split frequencies: 0.020288

      315500 -- (-1593.095) [-1587.303] (-1592.160) (-1588.221) * (-1591.312) (-1591.346) (-1588.688) [-1590.945] -- 0:00:47
      316000 -- (-1590.265) [-1589.206] (-1592.093) (-1588.639) * [-1589.545] (-1589.547) (-1593.211) (-1589.988) -- 0:00:47
      316500 -- [-1590.560] (-1591.257) (-1593.179) (-1588.898) * [-1593.366] (-1592.995) (-1590.098) (-1589.214) -- 0:00:47
      317000 -- (-1588.763) (-1592.302) [-1591.864] (-1587.967) * (-1591.358) (-1589.570) [-1590.312] (-1591.614) -- 0:00:47
      317500 -- [-1590.463] (-1589.367) (-1588.407) (-1589.038) * (-1590.822) (-1589.039) [-1588.318] (-1589.511) -- 0:00:47
      318000 -- (-1589.915) (-1588.068) (-1589.494) [-1589.175] * (-1590.682) [-1587.681] (-1590.082) (-1591.622) -- 0:00:47
      318500 -- (-1590.856) [-1589.912] (-1592.369) (-1592.109) * (-1589.164) [-1593.324] (-1586.449) (-1591.570) -- 0:00:47
      319000 -- [-1590.883] (-1589.221) (-1591.670) (-1593.249) * (-1591.489) [-1589.821] (-1587.111) (-1590.479) -- 0:00:46
      319500 -- [-1590.169] (-1587.258) (-1589.279) (-1587.880) * [-1596.247] (-1591.498) (-1589.737) (-1590.599) -- 0:00:46
      320000 -- [-1589.427] (-1589.192) (-1588.863) (-1590.217) * (-1592.909) [-1589.593] (-1586.194) (-1591.435) -- 0:00:46

      Average standard deviation of split frequencies: 0.020826

      320500 -- (-1591.265) [-1589.320] (-1589.911) (-1589.681) * (-1591.794) (-1589.545) [-1587.751] (-1594.171) -- 0:00:46
      321000 -- [-1588.830] (-1590.140) (-1589.157) (-1590.095) * (-1592.700) [-1589.253] (-1590.680) (-1595.592) -- 0:00:46
      321500 -- [-1590.899] (-1589.137) (-1588.700) (-1589.873) * (-1590.601) (-1589.021) [-1588.763] (-1590.905) -- 0:00:46
      322000 -- (-1590.461) (-1587.341) (-1589.324) [-1590.329] * (-1589.677) (-1589.079) [-1587.375] (-1592.985) -- 0:00:46
      322500 -- (-1590.080) (-1594.529) (-1590.680) [-1587.826] * (-1588.048) [-1589.782] (-1587.426) (-1590.406) -- 0:00:46
      323000 -- (-1590.027) [-1589.855] (-1590.818) (-1587.247) * (-1590.510) (-1589.003) [-1595.867] (-1589.465) -- 0:00:46
      323500 -- (-1590.866) [-1590.786] (-1591.128) (-1589.147) * [-1588.698] (-1590.893) (-1589.373) (-1597.795) -- 0:00:46
      324000 -- (-1593.410) [-1589.244] (-1592.813) (-1590.072) * (-1587.715) (-1593.928) [-1590.551] (-1592.413) -- 0:00:45
      324500 -- (-1590.368) (-1593.376) (-1588.738) [-1591.504] * (-1592.757) (-1590.121) [-1588.494] (-1591.885) -- 0:00:45
      325000 -- (-1589.550) [-1587.824] (-1591.403) (-1592.200) * (-1591.087) (-1591.468) (-1589.233) [-1589.969] -- 0:00:45

      Average standard deviation of split frequencies: 0.021005

      325500 -- (-1587.685) (-1590.708) (-1591.597) [-1590.505] * (-1588.025) (-1595.721) [-1587.494] (-1591.917) -- 0:00:45
      326000 -- (-1590.265) [-1590.297] (-1590.979) (-1590.709) * (-1588.692) (-1598.898) [-1589.758] (-1593.344) -- 0:00:45
      326500 -- [-1590.170] (-1588.169) (-1591.837) (-1590.605) * [-1588.102] (-1591.254) (-1590.389) (-1593.471) -- 0:00:47
      327000 -- (-1588.741) (-1588.537) (-1587.849) [-1591.578] * (-1588.856) [-1589.814] (-1586.499) (-1588.295) -- 0:00:47
      327500 -- [-1593.081] (-1589.284) (-1587.888) (-1591.542) * (-1588.414) (-1592.411) [-1586.950] (-1588.853) -- 0:00:47
      328000 -- [-1590.202] (-1590.539) (-1588.500) (-1593.437) * (-1591.331) (-1590.630) [-1588.310] (-1593.354) -- 0:00:47
      328500 -- (-1592.473) (-1589.246) [-1588.036] (-1591.262) * (-1591.879) [-1589.607] (-1587.457) (-1589.254) -- 0:00:47
      329000 -- (-1589.457) (-1590.989) [-1590.376] (-1593.029) * (-1591.096) [-1592.023] (-1592.513) (-1592.021) -- 0:00:46
      329500 -- (-1590.781) [-1589.933] (-1587.789) (-1590.556) * (-1592.014) [-1593.469] (-1590.694) (-1591.889) -- 0:00:46
      330000 -- (-1587.918) [-1590.151] (-1587.460) (-1593.759) * [-1591.849] (-1593.040) (-1591.242) (-1593.376) -- 0:00:46

      Average standard deviation of split frequencies: 0.019325

      330500 -- [-1588.607] (-1591.056) (-1589.435) (-1591.562) * [-1591.190] (-1587.569) (-1593.367) (-1589.296) -- 0:00:46
      331000 -- (-1589.797) (-1596.109) [-1590.503] (-1593.176) * (-1589.938) (-1591.571) (-1587.199) [-1590.283] -- 0:00:46
      331500 -- (-1588.124) [-1592.786] (-1590.074) (-1591.587) * (-1589.740) (-1589.811) (-1589.272) [-1590.592] -- 0:00:46
      332000 -- (-1591.420) (-1594.430) (-1593.332) [-1592.871] * (-1588.501) (-1590.109) (-1590.084) [-1590.830] -- 0:00:46
      332500 -- (-1589.016) (-1591.035) [-1590.964] (-1592.992) * (-1589.865) (-1591.421) (-1592.104) [-1590.652] -- 0:00:46
      333000 -- [-1592.283] (-1592.231) (-1592.073) (-1594.599) * [-1591.109] (-1593.868) (-1589.708) (-1593.797) -- 0:00:46
      333500 -- (-1592.276) (-1591.254) (-1592.030) [-1588.523] * [-1591.779] (-1591.683) (-1589.778) (-1592.233) -- 0:00:45
      334000 -- (-1594.277) (-1591.662) [-1592.131] (-1593.232) * (-1594.160) (-1588.467) [-1588.792] (-1589.151) -- 0:00:45
      334500 -- [-1592.427] (-1591.861) (-1591.082) (-1592.035) * [-1589.692] (-1592.369) (-1591.845) (-1588.453) -- 0:00:45
      335000 -- [-1588.747] (-1588.916) (-1592.910) (-1589.890) * [-1588.782] (-1591.737) (-1588.991) (-1588.168) -- 0:00:45

      Average standard deviation of split frequencies: 0.019096

      335500 -- (-1591.129) (-1589.247) (-1589.815) [-1589.787] * (-1589.844) (-1591.944) (-1589.342) [-1587.114] -- 0:00:45
      336000 -- [-1589.229] (-1590.376) (-1589.330) (-1588.084) * (-1592.771) (-1588.904) (-1597.606) [-1588.272] -- 0:00:45
      336500 -- (-1591.076) (-1589.846) [-1593.153] (-1591.672) * [-1590.519] (-1589.789) (-1596.250) (-1590.004) -- 0:00:45
      337000 -- [-1589.440] (-1591.687) (-1592.249) (-1589.666) * (-1593.565) (-1593.412) [-1594.843] (-1590.172) -- 0:00:45
      337500 -- [-1592.303] (-1591.334) (-1590.321) (-1591.846) * (-1591.189) (-1590.480) [-1589.384] (-1588.653) -- 0:00:45
      338000 -- (-1586.455) (-1589.782) [-1590.866] (-1589.354) * (-1594.398) [-1590.477] (-1589.450) (-1593.311) -- 0:00:45
      338500 -- [-1589.252] (-1588.846) (-1592.839) (-1588.522) * (-1588.774) [-1592.176] (-1590.093) (-1590.907) -- 0:00:44
      339000 -- (-1592.115) (-1595.060) (-1588.799) [-1588.934] * [-1588.642] (-1594.597) (-1589.074) (-1589.002) -- 0:00:44
      339500 -- [-1587.439] (-1593.536) (-1592.150) (-1592.177) * (-1589.474) [-1594.188] (-1591.798) (-1589.506) -- 0:00:44
      340000 -- (-1589.179) (-1590.817) (-1594.393) [-1591.436] * (-1590.358) (-1590.639) (-1587.683) [-1587.576] -- 0:00:44

      Average standard deviation of split frequencies: 0.019219

      340500 -- [-1597.031] (-1591.534) (-1591.501) (-1591.533) * (-1588.941) (-1588.605) [-1589.178] (-1591.890) -- 0:00:44
      341000 -- (-1593.334) (-1592.117) (-1590.923) [-1594.188] * (-1591.312) (-1591.440) [-1596.163] (-1589.263) -- 0:00:44
      341500 -- (-1589.620) [-1588.533] (-1589.344) (-1590.995) * (-1590.601) (-1588.297) [-1592.110] (-1592.873) -- 0:00:46
      342000 -- (-1590.006) [-1590.553] (-1591.160) (-1590.719) * (-1593.031) (-1592.033) (-1595.307) [-1591.385] -- 0:00:46
      342500 -- (-1590.364) (-1590.837) [-1593.111] (-1590.730) * (-1589.498) [-1587.202] (-1593.288) (-1591.628) -- 0:00:46
      343000 -- (-1587.347) (-1589.397) (-1596.008) [-1588.614] * (-1590.828) [-1586.950] (-1591.650) (-1591.332) -- 0:00:45
      343500 -- (-1594.145) (-1589.702) (-1591.431) [-1590.095] * (-1590.366) (-1589.956) [-1590.767] (-1592.125) -- 0:00:45
      344000 -- (-1590.318) [-1588.938] (-1591.215) (-1592.157) * (-1590.814) (-1593.607) [-1587.760] (-1591.015) -- 0:00:45
      344500 -- (-1594.500) (-1588.904) (-1588.616) [-1587.502] * (-1589.464) (-1593.073) [-1590.275] (-1591.717) -- 0:00:45
      345000 -- (-1589.744) (-1591.896) (-1591.088) [-1590.454] * (-1594.306) (-1591.123) (-1593.000) [-1589.155] -- 0:00:45

      Average standard deviation of split frequencies: 0.018787

      345500 -- (-1590.519) [-1591.492] (-1590.367) (-1594.997) * (-1590.945) (-1590.510) (-1589.692) [-1588.741] -- 0:00:45
      346000 -- (-1594.283) [-1590.360] (-1592.389) (-1592.181) * [-1588.456] (-1592.188) (-1592.225) (-1586.569) -- 0:00:45
      346500 -- (-1591.525) (-1594.517) (-1593.659) [-1589.124] * (-1588.038) (-1595.199) (-1589.649) [-1589.868] -- 0:00:45
      347000 -- (-1590.898) (-1588.839) (-1592.221) [-1590.657] * (-1591.213) (-1588.856) (-1590.924) [-1589.851] -- 0:00:45
      347500 -- (-1596.860) (-1591.514) (-1591.115) [-1590.180] * (-1594.091) (-1593.284) [-1593.205] (-1589.508) -- 0:00:45
      348000 -- (-1589.262) (-1590.783) (-1591.013) [-1588.755] * [-1588.743] (-1593.769) (-1588.342) (-1589.084) -- 0:00:44
      348500 -- (-1590.114) (-1593.812) [-1589.861] (-1587.851) * [-1590.434] (-1589.065) (-1588.795) (-1591.342) -- 0:00:44
      349000 -- (-1590.212) (-1591.984) [-1588.656] (-1591.639) * (-1590.105) (-1595.717) [-1597.141] (-1588.253) -- 0:00:44
      349500 -- [-1592.114] (-1590.583) (-1589.463) (-1588.917) * (-1590.426) (-1592.704) [-1589.065] (-1589.947) -- 0:00:44
      350000 -- (-1591.971) (-1595.155) (-1592.793) [-1591.412] * (-1591.149) [-1588.040] (-1589.932) (-1593.701) -- 0:00:44

      Average standard deviation of split frequencies: 0.019418

      350500 -- (-1592.238) (-1593.518) (-1592.936) [-1591.154] * (-1590.697) (-1590.042) (-1589.433) [-1587.842] -- 0:00:44
      351000 -- (-1595.326) [-1591.778] (-1592.809) (-1591.138) * (-1592.122) [-1589.095] (-1590.402) (-1591.441) -- 0:00:44
      351500 -- (-1594.108) (-1588.023) [-1593.021] (-1592.150) * [-1586.955] (-1590.482) (-1591.376) (-1592.118) -- 0:00:44
      352000 -- (-1595.786) (-1591.443) [-1588.458] (-1591.844) * (-1591.903) [-1589.725] (-1589.402) (-1593.608) -- 0:00:44
      352500 -- (-1596.227) [-1592.956] (-1586.898) (-1590.578) * (-1592.880) [-1591.995] (-1590.681) (-1593.055) -- 0:00:44
      353000 -- (-1593.955) [-1588.188] (-1590.755) (-1593.179) * (-1593.252) [-1590.576] (-1591.677) (-1593.146) -- 0:00:43
      353500 -- (-1590.460) (-1590.212) [-1591.032] (-1591.538) * (-1589.983) [-1590.095] (-1589.318) (-1590.359) -- 0:00:43
      354000 -- (-1590.428) (-1591.054) [-1591.707] (-1591.623) * (-1592.117) [-1588.655] (-1590.574) (-1592.993) -- 0:00:43
      354500 -- [-1588.867] (-1590.454) (-1587.666) (-1591.394) * [-1589.656] (-1588.897) (-1590.813) (-1590.424) -- 0:00:43
      355000 -- (-1588.373) (-1597.323) (-1591.412) [-1589.326] * (-1591.408) (-1588.850) (-1590.932) [-1590.188] -- 0:00:43

      Average standard deviation of split frequencies: 0.019127

      355500 -- (-1590.664) (-1589.922) [-1593.833] (-1596.436) * (-1594.425) (-1589.433) [-1592.004] (-1590.498) -- 0:00:43
      356000 -- [-1591.043] (-1589.155) (-1592.248) (-1591.475) * (-1593.855) (-1589.250) (-1591.649) [-1592.759] -- 0:00:43
      356500 -- (-1589.612) [-1588.517] (-1593.586) (-1592.503) * [-1591.231] (-1591.350) (-1592.996) (-1591.976) -- 0:00:45
      357000 -- (-1592.799) [-1591.607] (-1588.106) (-1593.020) * (-1592.263) [-1592.156] (-1588.129) (-1586.669) -- 0:00:45
      357500 -- (-1590.124) [-1591.717] (-1590.323) (-1592.355) * (-1597.369) (-1590.315) [-1589.108] (-1594.151) -- 0:00:44
      358000 -- (-1588.746) (-1589.368) (-1590.925) [-1589.924] * (-1590.041) (-1590.085) (-1587.308) [-1591.072] -- 0:00:44
      358500 -- (-1587.289) [-1592.032] (-1592.358) (-1591.389) * (-1591.457) (-1589.544) (-1590.430) [-1590.101] -- 0:00:44
      359000 -- (-1588.742) (-1593.518) [-1592.360] (-1591.210) * (-1595.767) [-1590.707] (-1591.102) (-1590.788) -- 0:00:44
      359500 -- (-1589.267) (-1592.313) [-1595.697] (-1593.243) * (-1592.901) (-1590.772) [-1593.116] (-1589.631) -- 0:00:44
      360000 -- (-1591.264) [-1591.382] (-1592.242) (-1592.981) * (-1593.188) (-1590.465) [-1590.561] (-1591.858) -- 0:00:44

      Average standard deviation of split frequencies: 0.019315

      360500 -- (-1589.798) (-1591.348) (-1592.135) [-1593.726] * [-1594.742] (-1592.847) (-1589.877) (-1591.828) -- 0:00:44
      361000 -- [-1588.908] (-1591.463) (-1588.672) (-1588.165) * (-1594.764) (-1590.625) [-1589.346] (-1591.150) -- 0:00:44
      361500 -- [-1588.960] (-1592.383) (-1590.815) (-1595.133) * (-1590.381) [-1588.318] (-1589.297) (-1591.057) -- 0:00:44
      362000 -- [-1592.583] (-1592.317) (-1588.264) (-1591.904) * (-1588.556) (-1588.833) (-1591.747) [-1589.460] -- 0:00:44
      362500 -- (-1596.722) (-1590.988) [-1590.484] (-1593.132) * (-1590.162) [-1589.280] (-1593.566) (-1588.777) -- 0:00:43
      363000 -- (-1587.437) (-1590.415) (-1593.307) [-1593.872] * [-1591.729] (-1592.144) (-1591.474) (-1587.847) -- 0:00:43
      363500 -- (-1591.207) (-1590.029) (-1590.264) [-1593.578] * [-1591.724] (-1594.114) (-1591.240) (-1588.608) -- 0:00:43
      364000 -- [-1593.118] (-1590.251) (-1588.841) (-1593.304) * (-1590.565) [-1589.973] (-1589.962) (-1591.384) -- 0:00:43
      364500 -- (-1587.571) (-1591.841) (-1592.819) [-1593.066] * (-1591.030) (-1586.796) [-1588.514] (-1591.425) -- 0:00:43
      365000 -- (-1588.198) [-1591.251] (-1593.891) (-1593.188) * (-1591.485) [-1587.758] (-1590.627) (-1590.238) -- 0:00:43

      Average standard deviation of split frequencies: 0.019177

      365500 -- (-1588.594) [-1589.806] (-1594.226) (-1591.354) * [-1590.579] (-1591.068) (-1590.631) (-1592.606) -- 0:00:43
      366000 -- (-1589.918) (-1587.095) [-1592.760] (-1591.049) * (-1592.684) (-1591.014) [-1589.942] (-1589.935) -- 0:00:43
      366500 -- (-1588.601) (-1590.764) [-1591.703] (-1590.294) * (-1596.465) (-1589.056) [-1590.669] (-1588.837) -- 0:00:43
      367000 -- [-1592.594] (-1589.891) (-1596.836) (-1593.978) * (-1596.842) (-1592.355) (-1589.139) [-1588.587] -- 0:00:43
      367500 -- (-1587.548) [-1591.177] (-1590.307) (-1591.251) * (-1598.562) (-1588.722) (-1589.882) [-1590.179] -- 0:00:43
      368000 -- (-1591.905) (-1591.779) [-1592.431] (-1591.690) * (-1589.541) (-1589.595) [-1590.375] (-1588.168) -- 0:00:42
      368500 -- (-1589.643) (-1589.846) (-1592.781) [-1591.931] * (-1589.850) [-1591.439] (-1593.456) (-1590.143) -- 0:00:42
      369000 -- (-1589.916) [-1589.327] (-1587.793) (-1591.281) * (-1592.874) (-1594.345) (-1588.920) [-1590.429] -- 0:00:42
      369500 -- (-1592.114) (-1591.239) [-1590.046] (-1588.788) * (-1591.519) (-1590.201) [-1589.915] (-1592.900) -- 0:00:42
      370000 -- (-1587.869) (-1591.473) (-1588.065) [-1591.936] * (-1591.949) (-1592.990) [-1588.429] (-1591.143) -- 0:00:42

      Average standard deviation of split frequencies: 0.018158

      370500 -- [-1587.888] (-1588.836) (-1588.949) (-1595.145) * (-1591.531) [-1591.041] (-1591.448) (-1588.817) -- 0:00:42
      371000 -- [-1588.560] (-1589.184) (-1588.644) (-1590.876) * (-1591.777) (-1593.465) (-1592.792) [-1590.652] -- 0:00:44
      371500 -- (-1587.605) (-1589.555) (-1588.188) [-1593.152] * (-1588.473) [-1587.913] (-1594.684) (-1590.868) -- 0:00:43
      372000 -- (-1590.597) (-1588.755) [-1588.573] (-1590.228) * [-1587.446] (-1591.984) (-1590.673) (-1590.754) -- 0:00:43
      372500 -- (-1591.404) [-1588.617] (-1589.130) (-1590.369) * [-1588.473] (-1590.962) (-1591.092) (-1589.740) -- 0:00:43
      373000 -- (-1590.381) [-1590.860] (-1587.506) (-1590.670) * (-1589.025) (-1591.435) (-1590.652) [-1589.241] -- 0:00:43
      373500 -- (-1588.480) (-1589.911) [-1592.220] (-1588.564) * (-1593.072) [-1588.527] (-1591.785) (-1589.868) -- 0:00:43
      374000 -- (-1597.707) (-1589.335) (-1595.397) [-1594.893] * (-1593.871) (-1589.708) [-1588.346] (-1597.133) -- 0:00:43
      374500 -- (-1591.909) [-1589.723] (-1591.102) (-1590.777) * (-1589.882) [-1588.677] (-1591.109) (-1588.174) -- 0:00:43
      375000 -- (-1589.364) (-1590.472) (-1590.752) [-1591.367] * (-1590.648) (-1590.658) (-1593.006) [-1589.222] -- 0:00:43

      Average standard deviation of split frequencies: 0.019363

      375500 -- (-1590.680) (-1591.581) (-1590.070) [-1593.896] * (-1589.992) (-1589.178) [-1590.070] (-1589.405) -- 0:00:43
      376000 -- [-1588.063] (-1591.303) (-1590.322) (-1592.359) * (-1588.373) (-1589.502) (-1593.037) [-1591.817] -- 0:00:43
      376500 -- (-1592.440) (-1592.114) [-1590.345] (-1590.176) * (-1590.789) [-1588.294] (-1591.554) (-1589.603) -- 0:00:43
      377000 -- (-1592.705) [-1591.036] (-1591.851) (-1590.441) * (-1590.892) [-1592.055] (-1591.512) (-1590.254) -- 0:00:42
      377500 -- [-1591.636] (-1592.011) (-1592.321) (-1590.948) * (-1588.439) (-1592.255) (-1593.813) [-1589.001] -- 0:00:42
      378000 -- [-1589.399] (-1590.511) (-1595.008) (-1591.482) * (-1591.045) (-1590.352) [-1589.378] (-1594.027) -- 0:00:42
      378500 -- [-1591.383] (-1591.634) (-1592.980) (-1593.150) * [-1594.456] (-1593.087) (-1594.471) (-1594.437) -- 0:00:42
      379000 -- [-1590.061] (-1589.656) (-1591.274) (-1591.257) * (-1589.375) (-1590.788) [-1594.147] (-1590.273) -- 0:00:42
      379500 -- [-1590.972] (-1587.235) (-1591.299) (-1591.533) * [-1592.815] (-1591.791) (-1594.864) (-1596.771) -- 0:00:42
      380000 -- (-1591.923) (-1591.280) [-1590.535] (-1587.171) * (-1592.364) (-1590.982) (-1593.948) [-1592.868] -- 0:00:42

      Average standard deviation of split frequencies: 0.020295

      380500 -- [-1587.776] (-1590.816) (-1590.035) (-1588.141) * (-1591.731) (-1589.561) [-1595.753] (-1593.248) -- 0:00:42
      381000 -- [-1587.995] (-1591.487) (-1591.064) (-1586.962) * (-1591.533) (-1589.460) (-1589.343) [-1589.026] -- 0:00:42
      381500 -- (-1592.341) [-1592.210] (-1590.204) (-1587.899) * (-1590.642) (-1590.932) [-1590.747] (-1590.062) -- 0:00:42
      382000 -- (-1593.019) (-1592.289) (-1589.147) [-1591.101] * (-1590.692) (-1590.791) (-1590.595) [-1594.065] -- 0:00:42
      382500 -- [-1588.682] (-1591.410) (-1592.488) (-1589.850) * (-1592.821) (-1589.661) [-1590.456] (-1590.148) -- 0:00:41
      383000 -- (-1590.849) (-1590.061) (-1589.342) [-1585.847] * (-1590.620) (-1588.212) [-1590.414] (-1594.319) -- 0:00:41
      383500 -- (-1588.801) (-1590.851) (-1596.277) [-1588.912] * (-1595.704) (-1592.036) [-1590.095] (-1588.598) -- 0:00:41
      384000 -- (-1586.437) (-1590.698) (-1593.037) [-1587.851] * (-1595.010) (-1589.772) [-1591.804] (-1588.967) -- 0:00:41
      384500 -- [-1587.985] (-1588.335) (-1591.524) (-1589.275) * [-1590.963] (-1591.933) (-1590.848) (-1587.784) -- 0:00:41
      385000 -- (-1589.321) [-1588.033] (-1591.802) (-1586.480) * [-1590.621] (-1591.565) (-1589.151) (-1591.435) -- 0:00:41

      Average standard deviation of split frequencies: 0.019472

      385500 -- [-1588.210] (-1592.680) (-1591.725) (-1586.853) * (-1590.582) [-1587.861] (-1589.999) (-1591.946) -- 0:00:41
      386000 -- [-1589.251] (-1590.297) (-1595.571) (-1589.072) * (-1589.272) [-1588.476] (-1593.248) (-1595.879) -- 0:00:42
      386500 -- [-1587.703] (-1594.998) (-1592.579) (-1588.291) * (-1589.782) (-1589.962) [-1590.452] (-1591.428) -- 0:00:42
      387000 -- (-1588.271) (-1592.345) (-1593.470) [-1589.371] * (-1590.213) [-1589.085] (-1588.287) (-1596.534) -- 0:00:42
      387500 -- (-1588.394) [-1587.986] (-1589.335) (-1588.880) * (-1592.081) [-1590.218] (-1591.949) (-1592.294) -- 0:00:42
      388000 -- (-1588.245) (-1588.865) [-1591.814] (-1589.336) * [-1594.438] (-1590.568) (-1592.342) (-1595.447) -- 0:00:42
      388500 -- (-1589.863) (-1590.708) [-1590.320] (-1589.195) * (-1589.558) [-1589.731] (-1591.476) (-1592.303) -- 0:00:42
      389000 -- (-1588.426) [-1589.062] (-1594.321) (-1590.080) * [-1587.707] (-1590.508) (-1590.721) (-1592.941) -- 0:00:42
      389500 -- (-1588.662) (-1590.952) [-1594.237] (-1591.142) * [-1591.622] (-1588.874) (-1590.727) (-1588.483) -- 0:00:42
      390000 -- (-1590.537) (-1589.906) (-1589.534) [-1590.044] * (-1592.691) [-1587.987] (-1589.476) (-1592.195) -- 0:00:42

      Average standard deviation of split frequencies: 0.020513

      390500 -- (-1588.254) (-1589.935) (-1593.845) [-1588.150] * (-1595.756) [-1587.834] (-1590.138) (-1587.682) -- 0:00:42
      391000 -- (-1588.192) (-1593.868) (-1591.823) [-1589.173] * (-1594.818) (-1594.296) (-1590.652) [-1590.191] -- 0:00:42
      391500 -- [-1588.510] (-1589.970) (-1590.986) (-1592.083) * (-1591.278) [-1590.973] (-1591.496) (-1587.850) -- 0:00:41
      392000 -- [-1588.752] (-1587.702) (-1592.642) (-1590.303) * [-1594.409] (-1591.687) (-1589.288) (-1589.289) -- 0:00:41
      392500 -- (-1586.683) (-1588.722) (-1590.989) [-1587.419] * (-1593.097) (-1595.439) (-1594.251) [-1589.246] -- 0:00:41
      393000 -- (-1589.082) (-1587.738) (-1592.934) [-1588.347] * (-1588.429) (-1589.290) (-1591.567) [-1589.487] -- 0:00:41
      393500 -- [-1591.863] (-1588.686) (-1590.314) (-1591.627) * [-1589.981] (-1590.551) (-1592.019) (-1589.458) -- 0:00:41
      394000 -- [-1588.874] (-1589.827) (-1592.494) (-1591.914) * (-1589.295) (-1589.150) (-1590.006) [-1588.084] -- 0:00:41
      394500 -- (-1591.072) (-1589.657) (-1590.627) [-1590.127] * [-1589.872] (-1588.857) (-1589.350) (-1588.566) -- 0:00:41
      395000 -- (-1592.468) (-1594.451) (-1590.928) [-1586.217] * (-1589.677) (-1587.449) [-1586.584] (-1589.929) -- 0:00:41

      Average standard deviation of split frequencies: 0.019397

      395500 -- (-1591.313) (-1589.295) [-1588.476] (-1590.878) * (-1590.362) (-1590.602) [-1590.819] (-1588.585) -- 0:00:41
      396000 -- (-1591.167) (-1590.969) (-1594.906) [-1586.505] * (-1588.071) (-1588.965) [-1590.831] (-1589.117) -- 0:00:41
      396500 -- (-1587.846) [-1591.853] (-1588.322) (-1589.550) * (-1590.859) (-1592.218) [-1588.736] (-1588.767) -- 0:00:41
      397000 -- [-1587.488] (-1590.752) (-1592.336) (-1589.121) * (-1588.151) (-1595.123) [-1590.938] (-1586.956) -- 0:00:41
      397500 -- (-1590.313) (-1590.952) (-1590.561) [-1588.996] * (-1591.674) (-1590.742) (-1591.270) [-1588.049] -- 0:00:40
      398000 -- (-1593.528) (-1588.591) [-1588.016] (-1589.808) * (-1588.607) (-1590.972) (-1590.976) [-1591.404] -- 0:00:40
      398500 -- [-1586.788] (-1590.469) (-1590.739) (-1587.480) * (-1587.653) [-1587.397] (-1590.444) (-1591.724) -- 0:00:40
      399000 -- (-1589.101) (-1589.282) (-1589.501) [-1587.024] * (-1588.063) (-1590.230) [-1588.606] (-1597.151) -- 0:00:40
      399500 -- (-1588.921) (-1588.994) (-1590.662) [-1586.824] * (-1588.358) (-1590.753) [-1589.557] (-1588.270) -- 0:00:40
      400000 -- (-1590.138) (-1591.025) [-1589.293] (-1591.491) * [-1590.337] (-1588.337) (-1589.499) (-1588.746) -- 0:00:40

      Average standard deviation of split frequencies: 0.020278

      400500 -- [-1589.587] (-1589.321) (-1593.557) (-1588.605) * (-1590.011) [-1590.007] (-1591.595) (-1588.662) -- 0:00:41
      401000 -- (-1590.135) (-1591.406) (-1591.357) [-1591.750] * [-1592.038] (-1592.659) (-1587.554) (-1588.843) -- 0:00:41
      401500 -- (-1592.361) [-1591.027] (-1590.462) (-1590.922) * [-1590.247] (-1593.236) (-1589.956) (-1590.030) -- 0:00:41
      402000 -- [-1586.672] (-1589.842) (-1590.216) (-1593.690) * [-1589.246] (-1590.183) (-1589.708) (-1588.347) -- 0:00:41
      402500 -- [-1587.512] (-1588.836) (-1591.106) (-1589.152) * (-1589.250) (-1591.737) (-1590.218) [-1589.033] -- 0:00:41
      403000 -- [-1591.008] (-1587.860) (-1593.425) (-1590.649) * (-1593.360) (-1593.336) (-1592.299) [-1590.394] -- 0:00:41
      403500 -- (-1588.247) (-1593.040) (-1590.801) [-1589.429] * (-1590.964) (-1591.139) [-1590.266] (-1587.275) -- 0:00:41
      404000 -- (-1591.456) (-1587.524) (-1591.151) [-1593.298] * (-1589.926) (-1595.724) (-1590.097) [-1589.312] -- 0:00:41
      404500 -- (-1591.497) (-1590.503) (-1588.520) [-1589.841] * (-1590.261) [-1591.238] (-1592.384) (-1590.354) -- 0:00:41
      405000 -- [-1589.092] (-1590.500) (-1587.699) (-1589.429) * (-1592.661) [-1591.619] (-1592.100) (-1590.454) -- 0:00:41

      Average standard deviation of split frequencies: 0.020627

      405500 -- [-1592.983] (-1591.646) (-1591.115) (-1590.161) * (-1589.558) [-1589.770] (-1589.721) (-1587.132) -- 0:00:41
      406000 -- (-1586.971) (-1591.310) (-1590.839) [-1589.444] * [-1588.938] (-1589.998) (-1595.341) (-1590.819) -- 0:00:40
      406500 -- [-1587.693] (-1589.801) (-1591.636) (-1591.934) * (-1592.869) (-1591.620) [-1589.036] (-1591.894) -- 0:00:40
      407000 -- [-1590.684] (-1591.887) (-1590.153) (-1587.000) * (-1589.735) (-1590.565) [-1591.321] (-1590.635) -- 0:00:40
      407500 -- (-1590.995) (-1588.816) [-1588.723] (-1591.131) * (-1587.930) (-1590.402) (-1588.951) [-1587.470] -- 0:00:40
      408000 -- (-1587.770) (-1589.517) (-1590.331) [-1589.326] * [-1587.775] (-1590.825) (-1591.890) (-1588.390) -- 0:00:40
      408500 -- (-1587.809) (-1589.484) (-1590.708) [-1587.843] * [-1586.641] (-1590.869) (-1596.387) (-1588.190) -- 0:00:40
      409000 -- (-1593.992) [-1590.662] (-1590.821) (-1592.838) * [-1590.392] (-1592.736) (-1591.559) (-1589.218) -- 0:00:40
      409500 -- (-1591.972) (-1591.050) (-1597.297) [-1586.470] * (-1590.329) [-1592.467] (-1589.978) (-1590.046) -- 0:00:40
      410000 -- (-1590.570) (-1589.653) (-1589.004) [-1589.215] * [-1590.232] (-1590.584) (-1589.852) (-1587.986) -- 0:00:40

      Average standard deviation of split frequencies: 0.020662

      410500 -- [-1591.022] (-1588.923) (-1592.659) (-1589.647) * [-1592.189] (-1598.014) (-1594.317) (-1589.854) -- 0:00:40
      411000 -- [-1587.502] (-1594.389) (-1593.124) (-1589.668) * (-1589.226) (-1591.510) (-1588.672) [-1588.297] -- 0:00:40
      411500 -- (-1591.256) (-1588.962) [-1591.923] (-1589.060) * [-1587.161] (-1591.192) (-1591.608) (-1595.464) -- 0:00:40
      412000 -- (-1590.006) (-1590.672) [-1591.102] (-1589.213) * (-1590.063) [-1590.274] (-1590.597) (-1592.667) -- 0:00:39
      412500 -- [-1586.518] (-1590.498) (-1589.972) (-1591.018) * [-1588.434] (-1593.507) (-1591.054) (-1592.648) -- 0:00:39
      413000 -- (-1588.088) [-1589.768] (-1596.053) (-1589.197) * [-1587.416] (-1588.563) (-1591.560) (-1593.436) -- 0:00:39
      413500 -- (-1589.782) [-1588.667] (-1593.093) (-1591.247) * (-1588.261) (-1591.449) [-1588.873] (-1592.677) -- 0:00:39
      414000 -- (-1590.092) (-1592.254) (-1593.571) [-1589.723] * [-1590.458] (-1591.336) (-1588.836) (-1588.044) -- 0:00:39
      414500 -- (-1592.926) (-1589.915) (-1594.182) [-1590.185] * (-1591.042) (-1593.689) (-1588.009) [-1588.202] -- 0:00:39
      415000 -- (-1591.042) [-1589.149] (-1600.039) (-1591.573) * (-1591.045) [-1588.827] (-1591.025) (-1587.995) -- 0:00:39

      Average standard deviation of split frequencies: 0.020397

      415500 -- (-1591.813) [-1590.476] (-1591.964) (-1588.232) * (-1589.665) (-1593.862) [-1589.503] (-1593.384) -- 0:00:40
      416000 -- (-1588.908) (-1591.500) [-1592.171] (-1591.861) * (-1589.836) (-1590.111) [-1593.841] (-1590.819) -- 0:00:40
      416500 -- (-1589.905) [-1592.798] (-1596.346) (-1590.484) * [-1589.129] (-1590.882) (-1590.647) (-1593.500) -- 0:00:40
      417000 -- (-1592.242) (-1593.201) [-1588.932] (-1593.182) * (-1596.815) (-1590.983) [-1587.775] (-1598.647) -- 0:00:40
      417500 -- [-1589.051] (-1593.486) (-1591.329) (-1592.746) * (-1590.241) (-1591.638) (-1586.849) [-1590.446] -- 0:00:40
      418000 -- (-1588.932) [-1587.115] (-1591.804) (-1590.833) * (-1587.145) [-1590.677] (-1587.996) (-1589.489) -- 0:00:40
      418500 -- (-1588.660) (-1591.470) (-1591.557) [-1590.237] * (-1588.684) (-1587.963) [-1588.668] (-1588.816) -- 0:00:40
      419000 -- (-1591.017) [-1587.147] (-1591.097) (-1588.542) * (-1589.224) (-1591.798) [-1589.189] (-1590.357) -- 0:00:40
      419500 -- (-1591.509) (-1592.893) [-1587.762] (-1591.129) * (-1593.192) [-1596.539] (-1588.580) (-1590.128) -- 0:00:40
      420000 -- [-1587.887] (-1593.422) (-1592.190) (-1592.901) * (-1590.141) [-1589.312] (-1589.272) (-1589.031) -- 0:00:40

      Average standard deviation of split frequencies: 0.019907

      420500 -- (-1591.485) [-1591.719] (-1590.589) (-1593.013) * (-1588.717) (-1592.424) [-1589.460] (-1592.908) -- 0:00:39
      421000 -- [-1589.990] (-1591.651) (-1591.147) (-1590.342) * (-1590.683) (-1593.835) (-1592.891) [-1589.834] -- 0:00:39
      421500 -- (-1590.152) [-1592.189] (-1591.379) (-1591.643) * (-1589.306) (-1593.439) (-1589.692) [-1589.879] -- 0:00:39
      422000 -- [-1590.770] (-1590.738) (-1592.152) (-1595.216) * [-1588.275] (-1589.257) (-1593.267) (-1591.841) -- 0:00:39
      422500 -- [-1590.448] (-1593.800) (-1595.333) (-1591.765) * (-1591.421) [-1590.543] (-1594.009) (-1591.338) -- 0:00:39
      423000 -- (-1590.619) (-1594.025) [-1593.997] (-1595.309) * [-1590.992] (-1591.430) (-1591.715) (-1591.664) -- 0:00:39
      423500 -- (-1596.357) (-1593.338) [-1590.442] (-1594.819) * (-1589.803) [-1591.448] (-1590.415) (-1593.958) -- 0:00:39
      424000 -- (-1589.450) (-1589.451) [-1594.148] (-1592.327) * (-1596.314) (-1590.335) [-1588.484] (-1592.446) -- 0:00:39
      424500 -- (-1589.129) [-1589.335] (-1594.534) (-1591.117) * (-1591.829) (-1587.543) [-1590.027] (-1592.233) -- 0:00:39
      425000 -- [-1588.016] (-1589.242) (-1590.583) (-1592.119) * (-1592.540) [-1590.605] (-1590.511) (-1590.513) -- 0:00:39

      Average standard deviation of split frequencies: 0.018747

      425500 -- [-1591.080] (-1588.839) (-1595.240) (-1594.049) * (-1593.194) [-1593.061] (-1589.957) (-1590.077) -- 0:00:39
      426000 -- [-1587.974] (-1593.576) (-1592.840) (-1592.177) * [-1592.921] (-1592.030) (-1589.331) (-1589.947) -- 0:00:39
      426500 -- (-1591.498) [-1590.460] (-1591.188) (-1593.633) * (-1594.355) (-1592.702) [-1592.740] (-1590.636) -- 0:00:38
      427000 -- (-1591.148) (-1589.520) (-1590.048) [-1588.825] * (-1592.382) [-1591.578] (-1591.433) (-1591.506) -- 0:00:38
      427500 -- (-1592.953) (-1592.840) (-1587.163) [-1588.599] * (-1591.683) (-1592.404) (-1588.350) [-1589.069] -- 0:00:38
      428000 -- (-1589.622) [-1589.574] (-1591.809) (-1590.315) * [-1588.150] (-1591.842) (-1588.870) (-1592.630) -- 0:00:38
      428500 -- [-1588.600] (-1591.439) (-1594.610) (-1592.470) * (-1587.911) [-1589.960] (-1589.578) (-1587.928) -- 0:00:38
      429000 -- (-1593.125) (-1592.953) (-1591.699) [-1590.937] * (-1590.121) (-1589.134) [-1590.023] (-1591.143) -- 0:00:38
      429500 -- [-1592.757] (-1587.856) (-1591.632) (-1587.794) * (-1590.789) (-1593.489) [-1590.524] (-1590.983) -- 0:00:38
      430000 -- (-1592.143) (-1588.871) (-1588.613) [-1590.081] * (-1589.063) [-1586.794] (-1591.416) (-1592.694) -- 0:00:39

      Average standard deviation of split frequencies: 0.017513

      430500 -- (-1587.823) (-1597.481) (-1590.503) [-1590.773] * [-1588.143] (-1587.176) (-1588.705) (-1592.610) -- 0:00:39
      431000 -- [-1588.767] (-1593.634) (-1588.378) (-1592.134) * (-1588.376) [-1591.927] (-1591.781) (-1592.180) -- 0:00:39
      431500 -- [-1589.084] (-1593.718) (-1590.598) (-1589.089) * (-1591.029) [-1589.260] (-1587.937) (-1591.848) -- 0:00:39
      432000 -- [-1590.541] (-1593.731) (-1590.467) (-1595.858) * (-1591.207) (-1588.520) [-1592.780] (-1592.504) -- 0:00:39
      432500 -- (-1593.505) (-1591.692) (-1589.185) [-1592.513] * [-1587.944] (-1591.376) (-1592.983) (-1589.852) -- 0:00:39
      433000 -- [-1592.510] (-1590.083) (-1588.648) (-1592.456) * [-1589.065] (-1592.946) (-1589.875) (-1591.936) -- 0:00:39
      433500 -- (-1593.107) [-1590.549] (-1588.801) (-1596.219) * (-1590.096) [-1594.059] (-1590.101) (-1594.947) -- 0:00:39
      434000 -- (-1591.141) [-1586.792] (-1589.814) (-1596.014) * (-1591.420) [-1593.407] (-1588.876) (-1592.344) -- 0:00:39
      434500 -- [-1587.816] (-1589.925) (-1590.373) (-1589.476) * (-1591.682) [-1591.117] (-1591.959) (-1593.505) -- 0:00:39
      435000 -- (-1590.311) (-1597.323) [-1589.069] (-1592.596) * (-1589.946) (-1592.495) (-1593.822) [-1593.263] -- 0:00:38

      Average standard deviation of split frequencies: 0.017299

      435500 -- (-1589.065) (-1592.943) (-1587.842) [-1590.233] * [-1588.043] (-1590.472) (-1590.192) (-1591.878) -- 0:00:38
      436000 -- (-1586.893) (-1595.672) [-1589.803] (-1590.711) * (-1589.188) [-1589.519] (-1591.305) (-1591.380) -- 0:00:38
      436500 -- (-1586.636) (-1588.813) (-1588.079) [-1587.695] * [-1589.865] (-1590.880) (-1589.592) (-1589.418) -- 0:00:38
      437000 -- (-1589.159) (-1591.230) (-1586.953) [-1590.631] * (-1588.588) (-1588.321) [-1589.311] (-1590.294) -- 0:00:38
      437500 -- [-1588.316] (-1589.283) (-1588.166) (-1589.074) * (-1590.724) [-1588.764] (-1588.607) (-1589.326) -- 0:00:38
      438000 -- (-1587.899) [-1588.545] (-1587.888) (-1590.029) * (-1591.140) (-1593.784) [-1591.862] (-1590.163) -- 0:00:38
      438500 -- (-1592.170) (-1589.181) (-1592.409) [-1592.358] * [-1590.447] (-1592.784) (-1589.775) (-1589.634) -- 0:00:38
      439000 -- (-1589.307) [-1589.724] (-1589.982) (-1593.541) * (-1595.596) [-1590.075] (-1590.202) (-1594.009) -- 0:00:38
      439500 -- (-1590.738) (-1592.030) (-1590.377) [-1587.755] * (-1589.644) (-1596.933) (-1590.483) [-1594.806] -- 0:00:38
      440000 -- (-1589.731) (-1589.646) [-1588.419] (-1595.259) * (-1588.677) (-1592.945) (-1592.684) [-1589.099] -- 0:00:38

      Average standard deviation of split frequencies: 0.017934

      440500 -- (-1590.687) [-1592.580] (-1591.228) (-1590.999) * (-1586.619) [-1590.333] (-1591.453) (-1589.834) -- 0:00:38
      441000 -- (-1589.084) (-1590.242) [-1592.436] (-1589.351) * [-1588.624] (-1590.743) (-1597.121) (-1591.703) -- 0:00:38
      441500 -- (-1591.628) [-1590.588] (-1591.400) (-1588.842) * (-1590.873) (-1593.791) (-1591.898) [-1592.114] -- 0:00:37
      442000 -- [-1589.259] (-1591.565) (-1590.007) (-1590.385) * (-1589.299) [-1592.230] (-1588.533) (-1587.667) -- 0