>C1
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C2
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C3
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C4
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C5
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C6
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
LADKPDCVGYNNNPTSHTRRSGQRTKRRKR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=380
C1 VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C2 VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C3 VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C4 VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C5 VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C6 VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
**************************************************
C1 TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C2 TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C3 TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C4 TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C5 TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C6 TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
**************************************************
C1 EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C2 EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C3 EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C4 EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C5 EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C6 EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
**************************************************
C1 GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C2 GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C3 GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C4 GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C5 GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C6 GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
**************************************************
C1 MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C2 MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C3 MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C4 MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C5 MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C6 MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
**************************************************
C1 FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C2 FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C3 FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C4 FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C5 FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C6 FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
**************************************************
C1 GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C2 GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C3 GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C4 GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C5 GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C6 GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
**************************************************
C1 PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C2 PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C3 PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C4 PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C5 PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C6 LADKPDCVGYNNNPTSHTRRSGQRTKRRKR
*****************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 380 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 380 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11400]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [11400]--->[11400]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.528 Mb, Max= 30.957 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C2 VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C3 VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C4 VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C5 VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
C6 VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
**************************************************
C1 TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C2 TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C3 TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C4 TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C5 TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
C6 TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
**************************************************
C1 EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C2 EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C3 EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C4 EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C5 EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
C6 EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
**************************************************
C1 GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C2 GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C3 GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C4 GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C5 GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
C6 GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
**************************************************
C1 MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C2 MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C3 MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C4 MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C5 MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
C6 MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
**************************************************
C1 FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C2 FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C3 FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C4 FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C5 FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
C6 FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
**************************************************
C1 GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C2 GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C3 GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C4 GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C5 GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
C6 GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
**************************************************
C1 PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C2 PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C3 PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C4 PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C5 PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
C6 LADKPDCVGYNNNPTSHTRRSGQRTKRRKR
*****************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.74 C1 C6 99.74
TOP 5 0 99.74 C6 C1 99.74
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.74 C2 C6 99.74
TOP 5 1 99.74 C6 C2 99.74
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.74 C3 C6 99.74
TOP 5 2 99.74 C6 C3 99.74
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.74 C4 C6 99.74
TOP 5 3 99.74 C6 C4 99.74
BOT 4 5 99.74 C5 C6 99.74
TOP 5 4 99.74 C6 C5 99.74
AVG 0 C1 * 99.95
AVG 1 C2 * 99.95
AVG 2 C3 * 99.95
AVG 3 C4 * 99.95
AVG 4 C5 * 99.95
AVG 5 C6 * 99.74
TOT TOT * 99.91
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
C2 GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
C3 GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
C4 GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
C5 GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
C6 GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
**************************************************
C1 GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
C2 GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
C3 GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
C4 GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
C5 GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
C6 GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
**************************************************
C1 GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
C2 GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
C3 GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
C4 GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
C5 GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
C6 GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
**************************************************
C1 ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
C2 ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
C3 ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
C4 ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
C5 ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
C6 ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
**************************************************
C1 TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
C2 TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
C3 TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
C4 TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
C5 TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
C6 TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
**************************************************
C1 ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
C2 ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
C3 ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
C4 ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
C5 ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
C6 ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
**************************************************
C1 GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
C2 GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
C3 GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
C4 GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
C5 GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
C6 GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
**************************************************
C1 ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
C2 ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
C3 ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
C4 ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
C5 ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
C6 ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
**************************************************
C1 CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
C2 CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
C3 CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
C4 CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
C5 CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
C6 CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
**************************************************
C1 GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
C2 GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
C3 GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
C4 GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
C5 GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
C6 GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
**************************************************
C1 TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
C2 TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
C3 TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
C4 TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
C5 TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
C6 TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
**************************************************
C1 ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
C2 ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
C3 ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
C4 ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
C5 ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
C6 ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
**************************************************
C1 ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
C2 ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
C3 ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
C4 ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
C5 ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
C6 ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
**************************************************
C1 AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
C2 AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
C3 AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
C4 AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
C5 AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
C6 AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
**************************************************
C1 ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
C2 ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
C3 ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
C4 ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
C5 ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
C6 ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
**************************************************
C1 TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
C2 TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
C3 TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
C4 TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
C5 TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
C6 TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
**************************************************
C1 TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
C2 TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
C3 TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
C4 TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
C5 TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
C6 TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
**************************************************
C1 CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
C2 CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
C3 CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
C4 CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
C5 CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
C6 CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
**************************************************
C1 GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
C2 GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
C3 GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
C4 GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
C5 GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
C6 GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
**************************************************
C1 TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
C2 TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
C3 TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
C4 TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
C5 TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
C6 TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
**************************************************
C1 AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
C2 AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
C3 AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
C4 AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
C5 AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
C6 AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
**************************************************
C1 CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
C2 CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
C3 CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
C4 CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
C5 CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
C6 CTGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
* ************************************************
C1 TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
C2 TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
C3 TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
C4 TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
C5 TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
C6 TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
****************************************
>C1
GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
>C2
GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
>C3
GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
>C4
GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
>C5
GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
CCGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
>C6
GTGAGTCTGTTGCCGTTTGATTTTGTCAGTCTTGACATCGTCTACTATCC
GGTGTCGTGGATTATGTGGGTTTGGTACAAGCTGTTTGCTGCTGTGCTGG
GTCCATCAAACTTTTTCGCATGGGCGTTATCGGTGATGTTCTTGGTGTTC
ACCTTGCGAGCGTTGCTTTACAAACCGTTCGTGCGCCAGATCCGTACCAC
TCGGCAGATGCAGGAGTTGCAGCCACGAATTAGAGCGCTGCAAAGAAAGT
ACGGTAAAGATCGTCAACGCATGGCGCTCGAGATGCAGAAATTGCAACGC
GAGCACGGGTTCAACCCAATTTTAGGATGCTTGCCGATGCTTGCGCAGAT
ACCGGTGTTTTTGGGGCTTTACCATGCTTTACGGTCATTCAATCGTACAA
CTGGAGGTTTCGGTCAGCCACATATGTCAGTGACCGAGAACCGGATGACA
GGAAATTATGTGTTCACCCCAGTTGACGTGGGGCATTTTCTTGATGCCAA
TCTGTGGGGTGCTCCAATTGGTGCGTACATGACGCAACGTTCCGGATTAG
ATGCGTTCATTGATTTCAGTCGTCCAGCGGTGATTTTGGTTGGTATTCCA
ATGATGGTTTTGGCTGGTGTTGCGACTTACTTCAACAGTCGCGCTTCAAT
AGCACGGCAGAGTGCGGAGGCAGCAGAAAATCCGCAGACTGCGTTGATGA
ACAAAATTGCGTTGTATGTGTTTCCTTTTGGTGTAGTTGTCGGTGGCCCG
TTTCTTCCGTTGGCGATTATTTTGTATTGGTTTTCTAACAATATCTGGAC
TTTTGGTCAACAACATTATGTGTTCTCTATGATCGAGAAAGAAGACGAGG
CTAAGAAGCAGAAAGCTATCGAACGTCGGACGGCTAACGCGCCTGCGCCA
GGCTCTAAGCCAAAGTACGTCTCTACGACGGCACCGGTAAGCGTTAATGG
TTTTTCGAAAGATACCATGATATCCGACGACGGCGCAAAGTTGGGGTCCC
AGGAGGCGGACTCTATTGACTGGGTGACTGAAACGAAAACAGCTACCACT
CTGGCGGATAAGCCGGATTGCGTCGGCTATAACAACAATCCAACCTCTCA
TACTCGGCGTTCTGGACAGCGGACAAAGAGACGTAAGCGC
>C1
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C2
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C3
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C4
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C5
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
PADKPDCVGYNNNPTSHTRRSGQRTKRRKR
>C6
VSLLPFDFVSLDIVYYPVSWIMWVWYKLFAAVLGPSNFFAWALSVMFLVF
TLRALLYKPFVRQIRTTRQMQELQPRIRALQRKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFLGLYHALRSFNRTTGGFGQPHMSVTENRMT
GNYVFTPVDVGHFLDANLWGAPIGAYMTQRSGLDAFIDFSRPAVILVGIP
MMVLAGVATYFNSRASIARQSAEAAENPQTALMNKIALYVFPFGVVVGGP
FLPLAIILYWFSNNIWTFGQQHYVFSMIEKEDEAKKQKAIERRTANAPAP
GSKPKYVSTTAPVSVNGFSKDTMISDDGAKLGSQEADSIDWVTETKTATT
LADKPDCVGYNNNPTSHTRRSGQRTKRRKR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 1140 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579782728
Setting output file names to "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1872340855
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9716761319
Seed = 1864958816
Swapseed = 1579782728
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2554.775959 -- -24.965149
Chain 2 -- -2554.777508 -- -24.965149
Chain 3 -- -2554.775959 -- -24.965149
Chain 4 -- -2554.775959 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2554.777055 -- -24.965149
Chain 2 -- -2554.775811 -- -24.965149
Chain 3 -- -2554.777508 -- -24.965149
Chain 4 -- -2554.775959 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2554.776] (-2554.778) (-2554.776) (-2554.776) * [-2554.777] (-2554.776) (-2554.778) (-2554.776)
500 -- [-1596.119] (-1601.328) (-1602.955) (-1596.431) * [-1592.364] (-1600.041) (-1596.639) (-1593.218) -- 0:00:00
1000 -- (-1592.012) [-1593.459] (-1595.531) (-1590.607) * [-1592.722] (-1599.136) (-1602.265) (-1596.380) -- 0:00:00
1500 -- (-1591.819) [-1597.314] (-1596.340) (-1610.960) * (-1588.571) (-1592.803) [-1588.145] (-1597.145) -- 0:00:00
2000 -- (-1598.336) (-1600.326) [-1589.211] (-1594.659) * (-1593.648) [-1590.666] (-1595.232) (-1591.311) -- 0:00:00
2500 -- (-1594.062) [-1590.610] (-1596.542) (-1601.831) * (-1597.508) (-1611.085) (-1593.338) [-1590.894] -- 0:00:00
3000 -- (-1591.873) [-1590.948] (-1593.509) (-1593.417) * [-1593.336] (-1596.420) (-1593.443) (-1595.910) -- 0:00:00
3500 -- (-1600.016) [-1593.759] (-1599.269) (-1590.231) * (-1601.192) (-1599.942) (-1602.633) [-1590.188] -- 0:00:00
4000 -- (-1593.030) (-1593.666) (-1590.792) [-1594.571] * (-1600.298) [-1591.083] (-1598.452) (-1599.190) -- 0:00:00
4500 -- (-1598.631) (-1591.705) [-1597.216] (-1601.482) * (-1592.898) (-1596.620) [-1591.534] (-1590.367) -- 0:00:00
5000 -- [-1594.685] (-1597.349) (-1589.992) (-1596.688) * [-1592.721] (-1591.842) (-1594.241) (-1598.498) -- 0:00:00
Average standard deviation of split frequencies: 0.064282
5500 -- (-1590.100) (-1594.958) [-1595.386] (-1592.509) * (-1595.610) [-1593.450] (-1593.743) (-1595.374) -- 0:00:00
6000 -- (-1597.840) (-1594.971) [-1593.219] (-1596.554) * [-1593.055] (-1592.669) (-1594.257) (-1595.633) -- 0:02:45
6500 -- (-1600.067) [-1591.968] (-1599.390) (-1598.772) * (-1602.370) (-1593.478) [-1590.445] (-1590.999) -- 0:02:32
7000 -- [-1593.364] (-1596.605) (-1594.578) (-1605.645) * (-1595.687) (-1595.385) (-1601.545) [-1596.093] -- 0:02:21
7500 -- [-1593.967] (-1592.357) (-1596.293) (-1599.100) * (-1596.556) [-1595.521] (-1598.901) (-1592.800) -- 0:02:12
8000 -- (-1592.811) (-1592.970) (-1598.908) [-1591.596] * (-1594.803) (-1592.718) [-1597.660] (-1593.508) -- 0:02:04
8500 -- (-1590.031) (-1604.323) [-1592.221] (-1601.354) * (-1597.668) (-1597.203) (-1595.482) [-1591.130] -- 0:01:56
9000 -- (-1593.723) (-1593.036) (-1600.332) [-1597.031] * (-1596.619) (-1594.095) (-1594.923) [-1592.379] -- 0:01:50
9500 -- (-1593.729) [-1592.975] (-1595.500) (-1596.270) * (-1599.618) (-1598.833) [-1588.488] (-1598.350) -- 0:01:44
10000 -- (-1596.996) [-1592.112] (-1596.032) (-1605.500) * (-1597.488) (-1604.068) [-1595.142] (-1593.415) -- 0:01:39
Average standard deviation of split frequencies: 0.075761
10500 -- (-1595.639) (-1600.677) (-1598.333) [-1593.580] * (-1596.367) (-1595.303) [-1591.253] (-1601.337) -- 0:01:34
11000 -- [-1587.277] (-1594.962) (-1598.047) (-1598.875) * [-1592.294] (-1591.147) (-1596.145) (-1594.494) -- 0:01:29
11500 -- (-1599.996) [-1592.628] (-1595.134) (-1592.530) * (-1595.050) (-1594.151) (-1594.083) [-1590.069] -- 0:01:25
12000 -- (-1592.707) [-1587.693] (-1595.902) (-1595.739) * [-1594.176] (-1606.983) (-1594.303) (-1591.432) -- 0:01:22
12500 -- [-1599.948] (-1594.467) (-1595.817) (-1595.377) * [-1590.454] (-1598.036) (-1591.097) (-1602.292) -- 0:01:19
13000 -- (-1598.233) [-1592.842] (-1596.038) (-1598.967) * (-1599.869) (-1590.346) (-1592.249) [-1599.248] -- 0:01:15
13500 -- (-1591.624) (-1590.470) [-1594.820] (-1594.118) * (-1592.874) (-1599.087) (-1592.092) [-1596.619] -- 0:01:13
14000 -- (-1598.274) [-1592.075] (-1593.572) (-1600.313) * [-1596.986] (-1591.309) (-1592.385) (-1591.012) -- 0:01:10
14500 -- (-1589.679) [-1592.890] (-1591.914) (-1596.384) * [-1596.730] (-1591.029) (-1591.768) (-1590.514) -- 0:01:07
15000 -- (-1589.923) (-1595.590) [-1597.674] (-1595.827) * [-1600.536] (-1593.742) (-1594.421) (-1593.117) -- 0:01:05
Average standard deviation of split frequencies: 0.080635
15500 -- (-1591.925) [-1590.709] (-1599.656) (-1604.044) * (-1593.148) (-1594.247) [-1590.681] (-1596.952) -- 0:01:03
16000 -- [-1588.517] (-1598.333) (-1594.387) (-1595.970) * [-1593.100] (-1599.265) (-1597.213) (-1592.830) -- 0:01:01
16500 -- (-1596.885) [-1593.905] (-1603.101) (-1589.210) * (-1592.032) (-1592.763) (-1592.950) [-1595.998] -- 0:00:59
17000 -- (-1594.685) [-1593.907] (-1596.014) (-1592.258) * (-1592.172) (-1596.183) (-1592.524) [-1595.258] -- 0:00:57
17500 -- (-1591.084) (-1598.593) (-1601.205) [-1591.159] * [-1590.984] (-1595.131) (-1591.012) (-1592.553) -- 0:00:56
18000 -- [-1593.932] (-1594.044) (-1594.620) (-1594.098) * [-1594.675] (-1597.938) (-1589.352) (-1594.548) -- 0:00:54
18500 -- (-1591.300) [-1591.756] (-1593.262) (-1596.792) * (-1593.209) (-1594.847) (-1590.409) [-1593.277] -- 0:00:53
19000 -- (-1588.662) (-1598.844) (-1598.818) [-1597.366] * (-1590.730) [-1596.381] (-1590.082) (-1598.564) -- 0:00:51
19500 -- (-1591.822) [-1587.072] (-1593.665) (-1594.566) * (-1591.875) [-1588.848] (-1588.735) (-1591.539) -- 0:00:50
20000 -- (-1592.638) [-1589.709] (-1591.350) (-1599.048) * (-1598.758) [-1589.672] (-1588.764) (-1589.769) -- 0:00:49
Average standard deviation of split frequencies: 0.060026
20500 -- (-1589.978) (-1593.609) (-1597.978) [-1590.762] * (-1593.153) (-1597.346) [-1587.372] (-1597.488) -- 0:01:35
21000 -- [-1589.985] (-1596.154) (-1595.102) (-1594.804) * (-1593.674) (-1595.849) (-1591.126) [-1588.559] -- 0:01:33
21500 -- (-1589.255) [-1593.987] (-1594.463) (-1595.859) * (-1600.527) (-1594.351) (-1590.956) [-1592.711] -- 0:01:31
22000 -- (-1588.025) (-1597.156) [-1595.247] (-1603.142) * (-1593.575) [-1593.235] (-1588.217) (-1592.276) -- 0:01:28
22500 -- (-1587.642) [-1598.151] (-1592.530) (-1609.157) * [-1590.566] (-1595.802) (-1589.790) (-1597.580) -- 0:01:26
23000 -- (-1590.333) (-1588.746) [-1599.031] (-1593.379) * (-1594.478) (-1602.713) (-1591.441) [-1591.046] -- 0:01:24
23500 -- (-1589.808) [-1591.338] (-1600.013) (-1599.017) * (-1593.692) (-1599.469) (-1588.229) [-1597.991] -- 0:01:23
24000 -- (-1589.332) [-1590.503] (-1594.440) (-1609.275) * (-1597.634) [-1593.975] (-1589.842) (-1595.588) -- 0:01:21
24500 -- (-1590.029) [-1590.424] (-1596.886) (-1594.632) * [-1588.916] (-1599.079) (-1586.609) (-1594.552) -- 0:01:19
25000 -- (-1587.708) [-1590.456] (-1596.840) (-1592.624) * [-1592.549] (-1597.254) (-1590.162) (-1592.280) -- 0:01:18
Average standard deviation of split frequencies: 0.047486
25500 -- (-1588.780) (-1594.125) (-1606.455) [-1591.361] * (-1592.071) [-1594.886] (-1589.739) (-1591.454) -- 0:01:16
26000 -- [-1589.814] (-1592.416) (-1596.014) (-1599.021) * (-1600.239) (-1595.749) [-1591.099] (-1590.507) -- 0:01:14
26500 -- (-1593.715) (-1596.497) (-1594.745) [-1590.313] * (-1595.145) [-1596.258] (-1593.458) (-1588.981) -- 0:01:13
27000 -- (-1590.804) [-1589.626] (-1591.289) (-1594.822) * [-1589.966] (-1594.716) (-1589.394) (-1592.465) -- 0:01:12
27500 -- [-1592.946] (-1598.685) (-1592.771) (-1596.352) * (-1594.135) (-1595.584) [-1589.682] (-1593.491) -- 0:01:10
28000 -- (-1590.322) (-1599.710) (-1592.276) [-1589.959] * (-1606.156) (-1598.543) [-1589.917] (-1590.834) -- 0:01:09
28500 -- [-1589.115] (-1595.408) (-1588.891) (-1598.311) * [-1594.382] (-1596.943) (-1588.848) (-1591.942) -- 0:01:08
29000 -- [-1589.705] (-1593.593) (-1588.305) (-1595.200) * (-1593.781) (-1592.848) [-1589.545] (-1587.699) -- 0:01:06
29500 -- [-1587.882] (-1593.603) (-1591.608) (-1593.013) * [-1592.054] (-1597.613) (-1588.174) (-1588.858) -- 0:01:05
30000 -- (-1588.862) (-1596.795) [-1588.828] (-1594.242) * (-1597.839) (-1601.281) [-1592.434] (-1594.992) -- 0:01:04
Average standard deviation of split frequencies: 0.049776
30500 -- (-1591.566) (-1592.007) [-1588.856] (-1595.092) * [-1592.082] (-1595.620) (-1588.637) (-1588.884) -- 0:01:03
31000 -- (-1590.144) (-1592.355) (-1589.159) [-1597.920] * (-1592.235) (-1598.564) [-1590.702] (-1589.916) -- 0:01:02
31500 -- (-1591.550) (-1590.735) (-1590.614) [-1595.884] * (-1588.058) [-1593.759] (-1590.476) (-1589.763) -- 0:01:01
32000 -- [-1591.202] (-1588.364) (-1589.977) (-1594.468) * [-1591.401] (-1598.254) (-1593.494) (-1592.822) -- 0:01:00
32500 -- (-1590.841) (-1591.102) [-1589.373] (-1595.970) * (-1597.396) (-1593.707) (-1590.515) [-1589.718] -- 0:00:59
33000 -- (-1591.714) (-1591.519) [-1589.256] (-1598.409) * (-1596.816) (-1597.053) (-1591.439) [-1590.547] -- 0:00:58
33500 -- (-1590.546) (-1592.934) [-1590.072] (-1598.647) * (-1596.763) [-1592.195] (-1592.520) (-1591.969) -- 0:00:57
34000 -- (-1592.931) (-1592.121) (-1589.931) [-1596.253] * [-1591.220] (-1596.169) (-1587.887) (-1589.324) -- 0:00:56
34500 -- (-1593.480) (-1593.730) (-1591.450) [-1592.285] * [-1593.190] (-1602.942) (-1590.278) (-1588.080) -- 0:00:55
35000 -- (-1590.031) (-1590.366) (-1592.167) [-1587.822] * (-1594.687) (-1605.903) [-1589.569] (-1587.866) -- 0:00:55
Average standard deviation of split frequencies: 0.036010
35500 -- (-1593.557) [-1589.246] (-1592.619) (-1592.884) * (-1593.818) [-1590.095] (-1589.070) (-1593.589) -- 0:01:21
36000 -- (-1596.689) (-1593.205) (-1589.796) [-1593.289] * (-1595.007) [-1590.113] (-1588.775) (-1588.603) -- 0:01:20
36500 -- (-1593.766) (-1601.049) (-1591.144) [-1594.809] * (-1590.864) (-1596.915) [-1590.184] (-1591.078) -- 0:01:19
37000 -- [-1590.626] (-1588.705) (-1594.240) (-1593.709) * [-1591.775] (-1588.692) (-1588.872) (-1590.816) -- 0:01:18
37500 -- (-1588.598) [-1592.263] (-1592.435) (-1592.307) * (-1592.169) [-1610.469] (-1588.198) (-1591.071) -- 0:01:17
38000 -- (-1589.011) (-1592.428) (-1587.189) [-1590.686] * (-1586.633) (-1595.020) [-1588.451] (-1593.251) -- 0:01:15
38500 -- (-1591.562) (-1593.801) [-1590.219] (-1601.757) * (-1591.886) [-1596.185] (-1588.500) (-1590.262) -- 0:01:14
39000 -- (-1594.331) (-1593.762) (-1590.786) [-1591.811] * [-1587.913] (-1603.307) (-1592.682) (-1595.895) -- 0:01:13
39500 -- (-1591.686) (-1592.132) (-1590.776) [-1600.330] * [-1589.677] (-1595.073) (-1588.626) (-1594.959) -- 0:01:12
40000 -- [-1592.179] (-1591.536) (-1591.270) (-1598.097) * (-1594.579) (-1600.924) [-1588.518] (-1591.677) -- 0:01:12
Average standard deviation of split frequencies: 0.039657
40500 -- (-1597.985) (-1588.753) (-1598.376) [-1597.895] * (-1597.909) (-1603.543) (-1587.921) [-1588.584] -- 0:01:11
41000 -- (-1599.384) (-1588.285) [-1590.449] (-1598.885) * [-1596.423] (-1601.124) (-1588.399) (-1588.588) -- 0:01:10
41500 -- [-1595.999] (-1591.781) (-1592.997) (-1601.247) * (-1591.815) (-1597.344) (-1590.667) [-1589.271] -- 0:01:09
42000 -- (-1591.525) (-1590.626) [-1588.667] (-1590.234) * (-1590.406) [-1592.669] (-1590.881) (-1591.403) -- 0:01:08
42500 -- (-1591.853) (-1588.811) [-1588.498] (-1601.017) * (-1591.438) [-1595.534] (-1590.068) (-1588.007) -- 0:01:07
43000 -- (-1591.298) [-1588.356] (-1594.650) (-1591.640) * (-1602.603) [-1601.110] (-1591.141) (-1594.667) -- 0:01:06
43500 -- [-1593.696] (-1592.488) (-1593.003) (-1592.631) * (-1593.893) [-1592.702] (-1586.552) (-1594.732) -- 0:01:05
44000 -- (-1594.105) [-1587.791] (-1590.244) (-1593.114) * (-1597.200) [-1594.327] (-1588.281) (-1587.846) -- 0:01:05
44500 -- (-1591.582) (-1592.570) [-1588.415] (-1597.299) * (-1594.861) (-1595.637) [-1589.335] (-1592.155) -- 0:01:04
45000 -- (-1591.679) (-1592.708) [-1590.557] (-1594.365) * [-1601.752] (-1599.576) (-1590.227) (-1590.734) -- 0:01:03
Average standard deviation of split frequencies: 0.036112
45500 -- [-1590.834] (-1591.025) (-1588.553) (-1593.762) * (-1596.428) (-1593.530) (-1590.118) [-1588.196] -- 0:01:02
46000 -- (-1593.100) (-1592.895) [-1587.744] (-1598.779) * (-1594.851) (-1596.377) [-1588.960] (-1596.118) -- 0:01:02
46500 -- (-1593.517) (-1590.324) (-1591.097) [-1591.784] * (-1592.997) [-1592.704] (-1588.173) (-1590.319) -- 0:01:01
47000 -- [-1593.033] (-1590.323) (-1587.764) (-1590.477) * (-1591.126) (-1588.579) [-1586.417] (-1591.541) -- 0:01:00
47500 -- (-1592.095) (-1587.952) [-1588.080] (-1590.415) * (-1594.082) [-1593.556] (-1591.836) (-1591.098) -- 0:01:00
48000 -- (-1589.492) (-1589.848) [-1589.007] (-1593.291) * [-1593.088] (-1599.305) (-1591.217) (-1591.344) -- 0:00:59
48500 -- (-1590.115) (-1589.012) [-1588.014] (-1591.447) * (-1589.365) [-1592.768] (-1590.792) (-1590.605) -- 0:00:58
49000 -- (-1589.700) (-1590.432) (-1591.584) [-1590.169] * (-1595.435) (-1600.401) (-1589.828) [-1591.907] -- 0:00:58
49500 -- [-1589.381] (-1590.904) (-1590.219) (-1590.071) * [-1591.240] (-1590.610) (-1590.040) (-1591.339) -- 0:01:16
50000 -- (-1591.188) (-1589.546) [-1589.280] (-1588.524) * [-1591.680] (-1589.180) (-1588.608) (-1595.361) -- 0:01:16
Average standard deviation of split frequencies: 0.032141
50500 -- (-1590.526) [-1588.769] (-1588.544) (-1588.549) * (-1595.437) [-1588.357] (-1589.065) (-1590.386) -- 0:01:15
51000 -- (-1592.494) [-1587.894] (-1588.637) (-1588.432) * [-1595.122] (-1587.305) (-1589.785) (-1590.295) -- 0:01:14
51500 -- [-1588.684] (-1590.627) (-1589.023) (-1594.861) * (-1592.071) (-1592.337) (-1588.568) [-1591.561] -- 0:01:13
52000 -- [-1589.060] (-1591.860) (-1588.755) (-1594.724) * (-1590.996) (-1592.406) [-1591.924] (-1592.727) -- 0:01:12
52500 -- (-1591.181) (-1591.797) [-1589.709] (-1591.193) * (-1593.266) (-1590.145) [-1589.635] (-1591.080) -- 0:01:12
53000 -- (-1589.873) (-1593.393) [-1587.570] (-1590.150) * (-1595.508) [-1590.097] (-1590.368) (-1591.826) -- 0:01:11
53500 -- (-1589.708) (-1591.411) (-1590.494) [-1589.393] * [-1598.134] (-1589.602) (-1590.600) (-1590.759) -- 0:01:10
54000 -- (-1589.596) [-1591.412] (-1589.870) (-1588.652) * (-1600.834) [-1589.521] (-1591.192) (-1588.184) -- 0:01:10
54500 -- (-1589.474) (-1590.417) (-1589.052) [-1588.094] * (-1595.321) [-1593.034] (-1590.113) (-1589.141) -- 0:01:09
55000 -- (-1588.820) (-1590.542) (-1588.566) [-1587.735] * (-1609.200) (-1594.745) [-1587.112] (-1592.763) -- 0:01:08
Average standard deviation of split frequencies: 0.031146
55500 -- (-1588.925) (-1590.742) [-1587.537] (-1590.586) * (-1589.258) [-1587.473] (-1587.084) (-1590.501) -- 0:01:08
56000 -- (-1589.340) (-1587.681) (-1587.038) [-1587.331] * (-1590.970) (-1591.007) [-1590.911] (-1589.043) -- 0:01:07
56500 -- (-1589.240) [-1589.169] (-1589.158) (-1589.260) * (-1592.636) (-1593.074) [-1588.630] (-1591.813) -- 0:01:06
57000 -- [-1588.670] (-1591.541) (-1591.678) (-1587.333) * [-1586.902] (-1588.956) (-1588.977) (-1587.112) -- 0:01:06
57500 -- (-1589.292) (-1590.470) (-1590.642) [-1591.453] * [-1588.054] (-1590.732) (-1590.784) (-1590.105) -- 0:01:05
58000 -- [-1588.164] (-1590.689) (-1589.465) (-1590.061) * [-1588.354] (-1590.944) (-1588.922) (-1590.307) -- 0:01:04
58500 -- [-1588.296] (-1593.073) (-1589.676) (-1588.577) * (-1589.722) [-1590.385] (-1589.371) (-1588.828) -- 0:01:04
59000 -- [-1587.652] (-1594.677) (-1593.314) (-1587.610) * (-1587.844) [-1588.138] (-1592.579) (-1589.619) -- 0:01:03
59500 -- (-1591.570) (-1591.271) (-1592.378) [-1587.339] * (-1590.688) (-1588.430) [-1586.791] (-1590.286) -- 0:01:03
60000 -- [-1588.939] (-1590.573) (-1589.733) (-1590.584) * (-1589.010) (-1589.488) (-1590.396) [-1587.248] -- 0:01:02
Average standard deviation of split frequencies: 0.035989
60500 -- (-1589.381) (-1592.165) (-1589.906) [-1588.228] * (-1589.378) (-1589.599) [-1588.935] (-1594.078) -- 0:01:02
61000 -- (-1590.941) [-1595.140] (-1588.680) (-1590.158) * (-1591.995) (-1590.724) [-1589.470] (-1594.794) -- 0:01:01
61500 -- (-1586.724) (-1592.689) [-1594.391] (-1590.490) * (-1592.849) [-1587.670] (-1592.427) (-1593.222) -- 0:01:01
62000 -- [-1591.997] (-1593.812) (-1591.922) (-1588.757) * (-1592.048) [-1591.205] (-1588.535) (-1588.536) -- 0:01:00
62500 -- [-1594.162] (-1591.231) (-1591.931) (-1589.604) * (-1592.788) (-1587.748) (-1587.625) [-1587.170] -- 0:01:00
63000 -- [-1592.140] (-1592.142) (-1591.001) (-1588.879) * (-1593.221) [-1586.995] (-1591.161) (-1588.310) -- 0:00:59
63500 -- [-1591.019] (-1588.952) (-1590.714) (-1588.776) * (-1590.237) (-1588.841) [-1588.262] (-1593.764) -- 0:00:58
64000 -- (-1589.549) (-1592.361) (-1590.713) [-1591.231] * (-1591.368) [-1589.105] (-1591.464) (-1590.288) -- 0:01:13
64500 -- (-1589.760) (-1594.765) (-1592.114) [-1591.116] * (-1590.340) (-1588.744) (-1591.040) [-1591.835] -- 0:01:12
65000 -- (-1588.132) (-1592.047) (-1589.854) [-1588.848] * (-1591.447) (-1589.168) [-1588.242] (-1589.286) -- 0:01:11
Average standard deviation of split frequencies: 0.032791
65500 -- (-1589.108) (-1592.669) [-1588.040] (-1589.198) * (-1592.171) [-1587.980] (-1589.607) (-1592.735) -- 0:01:11
66000 -- (-1589.573) [-1593.649] (-1589.854) (-1590.182) * (-1590.362) [-1586.821] (-1588.396) (-1589.765) -- 0:01:10
66500 -- [-1588.962] (-1590.851) (-1593.569) (-1588.313) * (-1591.976) [-1587.994] (-1587.569) (-1590.605) -- 0:01:10
67000 -- (-1589.428) [-1590.387] (-1590.244) (-1588.909) * (-1589.621) (-1590.170) (-1587.712) [-1590.478] -- 0:01:09
67500 -- (-1588.491) (-1594.151) [-1590.892] (-1591.872) * (-1589.666) (-1590.082) [-1589.901] (-1588.440) -- 0:01:09
68000 -- (-1590.629) (-1588.416) [-1591.039] (-1589.815) * [-1587.426] (-1592.533) (-1589.690) (-1591.187) -- 0:01:08
68500 -- [-1590.788] (-1588.350) (-1592.250) (-1589.407) * (-1588.224) [-1591.859] (-1595.771) (-1589.878) -- 0:01:07
69000 -- (-1590.551) (-1589.894) [-1588.926] (-1588.700) * [-1588.058] (-1594.038) (-1588.471) (-1592.339) -- 0:01:07
69500 -- (-1589.164) [-1588.731] (-1587.706) (-1590.404) * (-1588.764) (-1595.479) (-1591.628) [-1587.563] -- 0:01:06
70000 -- (-1588.509) (-1590.555) [-1588.734] (-1587.634) * (-1596.407) [-1593.234] (-1591.605) (-1595.108) -- 0:01:06
Average standard deviation of split frequencies: 0.031448
70500 -- (-1586.682) (-1590.119) (-1589.261) [-1589.673] * (-1590.413) (-1594.479) [-1591.345] (-1591.307) -- 0:01:05
71000 -- [-1588.651] (-1588.625) (-1590.563) (-1592.455) * (-1591.228) (-1591.792) [-1590.983] (-1590.844) -- 0:01:05
71500 -- (-1593.645) [-1588.246] (-1592.374) (-1591.151) * (-1587.899) [-1588.873] (-1590.643) (-1591.640) -- 0:01:04
72000 -- (-1589.094) [-1591.759] (-1590.255) (-1589.561) * (-1592.535) (-1591.669) [-1598.611] (-1592.187) -- 0:01:04
72500 -- (-1590.572) (-1590.497) [-1591.328] (-1588.129) * (-1593.467) [-1591.355] (-1596.440) (-1589.909) -- 0:01:03
73000 -- (-1593.226) (-1593.678) [-1593.532] (-1590.849) * (-1590.619) (-1591.460) (-1592.210) [-1588.679] -- 0:01:03
73500 -- (-1590.435) [-1592.739] (-1594.215) (-1589.402) * (-1593.154) (-1592.850) [-1587.153] (-1588.867) -- 0:01:03
74000 -- [-1596.581] (-1590.439) (-1589.941) (-1592.089) * (-1603.913) [-1590.501] (-1587.666) (-1587.031) -- 0:01:02
74500 -- (-1593.376) (-1589.462) [-1588.239] (-1587.853) * (-1596.105) [-1590.944] (-1590.275) (-1587.911) -- 0:01:02
75000 -- (-1594.269) [-1589.788] (-1591.545) (-1590.192) * [-1589.035] (-1590.826) (-1588.535) (-1589.679) -- 0:01:01
Average standard deviation of split frequencies: 0.030168
75500 -- (-1591.250) [-1591.468] (-1590.498) (-1587.585) * (-1589.719) (-1588.663) (-1590.934) [-1588.964] -- 0:01:01
76000 -- (-1591.251) [-1588.755] (-1592.958) (-1599.288) * [-1589.200] (-1588.241) (-1587.259) (-1592.341) -- 0:01:00
76500 -- (-1592.648) [-1587.683] (-1594.021) (-1594.691) * (-1590.895) (-1589.902) [-1587.870] (-1592.614) -- 0:01:00
77000 -- (-1594.050) [-1590.979] (-1593.558) (-1590.441) * [-1591.311] (-1592.277) (-1589.396) (-1590.651) -- 0:00:59
77500 -- (-1592.587) [-1588.394] (-1593.493) (-1588.545) * (-1600.814) (-1592.680) [-1587.529] (-1593.014) -- 0:00:59
78000 -- (-1594.513) [-1588.930] (-1593.569) (-1589.986) * (-1590.514) (-1590.617) (-1590.174) [-1591.712] -- 0:00:59
78500 -- (-1595.732) (-1593.582) (-1590.937) [-1592.472] * [-1589.420] (-1591.288) (-1592.877) (-1592.189) -- 0:01:10
79000 -- [-1594.606] (-1596.752) (-1591.025) (-1591.190) * (-1591.803) [-1587.619] (-1593.978) (-1591.833) -- 0:01:09
79500 -- (-1592.288) [-1595.750] (-1590.793) (-1590.913) * (-1591.291) [-1590.620] (-1591.699) (-1591.218) -- 0:01:09
80000 -- [-1589.061] (-1592.035) (-1587.403) (-1594.187) * (-1587.717) (-1591.914) [-1587.768] (-1591.597) -- 0:01:09
Average standard deviation of split frequencies: 0.031557
80500 -- (-1592.195) [-1588.433] (-1592.665) (-1593.570) * (-1590.100) [-1589.226] (-1589.186) (-1595.667) -- 0:01:08
81000 -- (-1589.765) (-1589.110) [-1589.356] (-1591.604) * (-1593.041) [-1587.333] (-1589.036) (-1596.388) -- 0:01:08
81500 -- (-1590.100) (-1590.010) [-1590.901] (-1589.864) * (-1588.340) [-1588.486] (-1591.820) (-1592.770) -- 0:01:07
82000 -- (-1589.898) [-1587.815] (-1588.276) (-1590.316) * (-1594.367) (-1587.138) [-1590.736] (-1594.125) -- 0:01:07
82500 -- [-1590.199] (-1589.735) (-1587.085) (-1590.139) * (-1592.330) (-1587.021) (-1590.995) [-1590.396] -- 0:01:06
83000 -- (-1591.174) (-1591.467) (-1589.709) [-1590.650] * (-1590.812) (-1590.367) (-1589.835) [-1589.297] -- 0:01:06
83500 -- (-1589.553) [-1591.794] (-1594.715) (-1592.459) * [-1590.858] (-1590.070) (-1588.049) (-1595.413) -- 0:01:05
84000 -- (-1589.044) (-1592.650) (-1594.137) [-1591.020] * [-1591.501] (-1600.412) (-1591.416) (-1591.813) -- 0:01:05
84500 -- (-1588.971) (-1589.084) [-1591.716] (-1591.274) * [-1591.086] (-1599.810) (-1592.676) (-1588.893) -- 0:01:05
85000 -- (-1590.976) (-1592.527) (-1595.591) [-1591.758] * (-1589.105) [-1593.804] (-1593.091) (-1588.842) -- 0:01:04
Average standard deviation of split frequencies: 0.029151
85500 -- (-1590.035) (-1592.180) [-1591.073] (-1591.771) * (-1588.885) [-1589.324] (-1589.953) (-1591.381) -- 0:01:04
86000 -- (-1591.083) [-1588.822] (-1589.431) (-1589.696) * (-1588.494) [-1591.760] (-1590.088) (-1591.714) -- 0:01:03
86500 -- (-1592.475) (-1588.358) (-1588.795) [-1592.528] * (-1587.821) (-1591.219) [-1590.203] (-1594.466) -- 0:01:03
87000 -- (-1591.040) [-1587.637] (-1592.066) (-1594.577) * (-1591.259) (-1590.028) (-1588.576) [-1593.059] -- 0:01:02
87500 -- (-1590.246) [-1587.356] (-1589.755) (-1589.184) * (-1588.458) [-1589.985] (-1594.478) (-1594.774) -- 0:01:02
88000 -- (-1593.554) (-1589.393) (-1587.512) [-1590.561] * (-1588.681) [-1589.874] (-1588.678) (-1589.376) -- 0:01:02
88500 -- [-1591.266] (-1590.317) (-1589.015) (-1591.156) * [-1590.093] (-1589.875) (-1590.259) (-1593.729) -- 0:01:01
89000 -- (-1590.963) (-1591.935) [-1588.359] (-1593.575) * [-1589.575] (-1592.083) (-1589.333) (-1588.286) -- 0:01:01
89500 -- [-1596.974] (-1591.870) (-1591.365) (-1590.314) * (-1589.926) (-1587.725) [-1589.758] (-1587.911) -- 0:01:01
90000 -- (-1589.955) (-1594.709) [-1591.405] (-1590.809) * (-1593.571) [-1587.458] (-1590.591) (-1588.780) -- 0:01:00
Average standard deviation of split frequencies: 0.027730
90500 -- (-1592.895) (-1588.424) [-1591.997] (-1588.893) * [-1589.061] (-1590.003) (-1591.372) (-1589.471) -- 0:01:00
91000 -- (-1592.039) (-1587.218) [-1586.917] (-1588.373) * (-1598.155) [-1589.098] (-1588.966) (-1589.974) -- 0:00:59
91500 -- [-1588.981] (-1590.543) (-1589.894) (-1589.077) * (-1589.052) (-1590.303) [-1588.418] (-1587.706) -- 0:00:59
92000 -- (-1589.634) [-1591.202] (-1589.099) (-1592.132) * (-1594.607) (-1588.362) [-1590.334] (-1589.319) -- 0:00:59
92500 -- (-1593.399) [-1588.847] (-1588.837) (-1591.426) * [-1590.731] (-1587.084) (-1590.247) (-1590.031) -- 0:00:58
93000 -- [-1589.676] (-1590.112) (-1588.731) (-1591.510) * [-1590.609] (-1588.716) (-1592.870) (-1590.169) -- 0:01:08
93500 -- (-1589.102) [-1591.290] (-1589.877) (-1597.912) * (-1590.866) [-1590.598] (-1590.803) (-1590.347) -- 0:01:07
94000 -- [-1588.250] (-1587.935) (-1589.054) (-1591.124) * (-1589.847) [-1588.696] (-1589.601) (-1586.315) -- 0:01:07
94500 -- (-1590.658) [-1593.202] (-1592.687) (-1592.218) * (-1590.779) (-1592.902) [-1589.049] (-1589.836) -- 0:01:07
95000 -- (-1589.476) (-1588.239) [-1590.338] (-1592.167) * (-1594.316) (-1591.189) (-1589.328) [-1589.057] -- 0:01:06
Average standard deviation of split frequencies: 0.027124
95500 -- (-1591.947) (-1588.571) [-1591.595] (-1594.390) * [-1593.219] (-1591.219) (-1589.280) (-1588.760) -- 0:01:06
96000 -- (-1592.169) [-1588.559] (-1590.162) (-1594.138) * (-1593.554) (-1593.032) [-1588.140] (-1588.821) -- 0:01:05
96500 -- (-1589.264) (-1590.012) [-1592.443] (-1592.027) * (-1591.059) (-1591.261) (-1588.643) [-1591.138] -- 0:01:05
97000 -- (-1590.283) (-1590.659) [-1588.775] (-1592.444) * (-1589.013) (-1589.263) (-1591.057) [-1590.036] -- 0:01:05
97500 -- (-1587.477) [-1590.233] (-1590.164) (-1593.555) * (-1590.906) (-1594.788) [-1590.326] (-1588.940) -- 0:01:04
98000 -- (-1589.566) (-1590.923) (-1592.940) [-1592.744] * (-1593.974) (-1590.039) (-1591.006) [-1588.968] -- 0:01:04
98500 -- (-1590.038) [-1591.376] (-1596.963) (-1591.320) * (-1591.036) [-1591.847] (-1594.914) (-1591.439) -- 0:01:04
99000 -- (-1590.185) [-1591.266] (-1591.316) (-1593.436) * [-1590.922] (-1592.613) (-1594.399) (-1591.243) -- 0:01:03
99500 -- [-1586.520] (-1588.284) (-1593.246) (-1588.487) * (-1593.105) [-1589.315] (-1590.584) (-1591.143) -- 0:01:03
100000 -- (-1587.473) [-1588.429] (-1589.415) (-1590.639) * (-1596.985) (-1590.629) [-1588.837] (-1587.407) -- 0:01:02
Average standard deviation of split frequencies: 0.026536
100500 -- (-1592.549) (-1591.999) (-1590.612) [-1586.844] * (-1588.109) (-1592.102) (-1588.118) [-1591.513] -- 0:01:02
101000 -- [-1593.166] (-1589.596) (-1590.917) (-1590.800) * (-1588.545) (-1590.632) [-1588.223] (-1599.168) -- 0:01:02
101500 -- (-1594.172) (-1589.119) (-1588.409) [-1587.569] * (-1589.639) (-1590.961) [-1592.783] (-1596.519) -- 0:01:01
102000 -- (-1595.064) (-1587.630) (-1593.147) [-1589.706] * (-1591.452) (-1591.904) (-1590.456) [-1588.048] -- 0:01:01
102500 -- [-1596.061] (-1593.841) (-1590.377) (-1592.628) * (-1591.331) (-1593.962) (-1590.792) [-1588.951] -- 0:01:01
103000 -- [-1593.033] (-1589.579) (-1589.934) (-1589.048) * (-1589.203) (-1591.401) (-1592.642) [-1593.879] -- 0:01:00
103500 -- (-1591.771) (-1591.633) [-1589.038] (-1588.635) * (-1588.310) (-1590.301) [-1589.178] (-1591.386) -- 0:01:00
104000 -- [-1588.955] (-1593.891) (-1590.895) (-1589.022) * (-1589.961) (-1593.256) (-1598.392) [-1590.621] -- 0:01:00
104500 -- (-1588.786) (-1593.235) [-1588.869] (-1591.366) * (-1588.710) (-1588.409) [-1591.423] (-1589.246) -- 0:00:59
105000 -- (-1588.338) [-1589.757] (-1590.079) (-1590.037) * (-1589.894) (-1589.667) (-1593.192) [-1589.065] -- 0:00:59
Average standard deviation of split frequencies: 0.029109
105500 -- (-1588.414) (-1588.837) [-1592.047] (-1591.266) * (-1591.311) (-1590.767) [-1591.484] (-1590.085) -- 0:00:59
106000 -- (-1590.200) (-1593.409) [-1592.289] (-1588.103) * (-1589.505) [-1594.615] (-1592.156) (-1593.367) -- 0:00:59
106500 -- [-1591.526] (-1594.709) (-1593.535) (-1587.670) * (-1589.071) (-1588.996) [-1589.693] (-1588.131) -- 0:00:58
107000 -- (-1589.448) (-1592.732) (-1590.809) [-1587.012] * (-1587.599) (-1590.301) [-1590.191] (-1591.147) -- 0:00:58
107500 -- [-1589.869] (-1589.079) (-1590.378) (-1589.426) * (-1589.765) [-1587.861] (-1593.209) (-1591.576) -- 0:01:06
108000 -- (-1593.670) (-1591.736) [-1590.030] (-1587.327) * (-1588.472) (-1592.085) (-1589.969) [-1588.786] -- 0:01:06
108500 -- [-1590.374] (-1590.740) (-1588.157) (-1591.879) * [-1591.845] (-1588.979) (-1591.790) (-1590.085) -- 0:01:05
109000 -- (-1590.711) (-1589.356) [-1588.708] (-1589.998) * [-1589.400] (-1592.490) (-1592.519) (-1589.939) -- 0:01:05
109500 -- (-1594.172) [-1588.715] (-1588.680) (-1588.524) * (-1590.752) (-1594.108) [-1589.619] (-1588.812) -- 0:01:05
110000 -- (-1587.018) [-1587.748] (-1590.933) (-1591.430) * (-1589.848) (-1590.834) [-1588.445] (-1589.281) -- 0:01:04
Average standard deviation of split frequencies: 0.029412
110500 -- [-1590.247] (-1588.477) (-1589.165) (-1589.485) * (-1588.337) [-1590.268] (-1588.957) (-1591.856) -- 0:01:04
111000 -- (-1589.300) (-1590.618) [-1589.935] (-1591.543) * [-1588.855] (-1589.120) (-1592.995) (-1590.910) -- 0:01:04
111500 -- [-1589.111] (-1589.101) (-1590.631) (-1590.744) * [-1590.320] (-1590.281) (-1590.173) (-1591.775) -- 0:01:03
112000 -- (-1591.237) (-1588.202) (-1592.207) [-1589.070] * [-1592.346] (-1591.183) (-1589.600) (-1591.910) -- 0:01:03
112500 -- (-1590.024) [-1587.224] (-1593.849) (-1589.248) * (-1591.025) (-1590.538) (-1589.055) [-1588.701] -- 0:01:03
113000 -- (-1587.173) (-1590.667) (-1592.344) [-1590.260] * (-1593.345) (-1591.466) (-1592.623) [-1589.818] -- 0:01:02
113500 -- (-1591.014) (-1587.946) (-1591.130) [-1587.349] * [-1592.984] (-1591.636) (-1590.214) (-1591.040) -- 0:01:02
114000 -- [-1587.168] (-1591.465) (-1591.131) (-1587.741) * (-1590.531) (-1590.564) [-1588.805] (-1589.704) -- 0:01:02
114500 -- (-1588.987) [-1592.968] (-1592.665) (-1590.779) * [-1592.480] (-1592.300) (-1586.752) (-1591.880) -- 0:01:01
115000 -- [-1588.754] (-1598.093) (-1593.211) (-1589.266) * [-1591.760] (-1591.489) (-1587.266) (-1594.063) -- 0:01:01
Average standard deviation of split frequencies: 0.029186
115500 -- (-1591.073) [-1588.883] (-1595.601) (-1588.786) * [-1591.594] (-1593.206) (-1589.699) (-1595.167) -- 0:01:01
116000 -- (-1589.637) (-1589.948) [-1591.740] (-1590.659) * (-1595.845) [-1588.702] (-1588.942) (-1594.145) -- 0:01:00
116500 -- (-1590.465) [-1588.699] (-1592.477) (-1591.320) * (-1592.096) (-1590.855) (-1588.733) [-1591.096] -- 0:01:00
117000 -- (-1590.641) [-1589.013] (-1590.057) (-1591.314) * (-1590.066) (-1591.271) [-1590.386] (-1590.115) -- 0:01:00
117500 -- [-1589.780] (-1588.893) (-1591.315) (-1590.306) * [-1588.215] (-1592.247) (-1588.707) (-1590.022) -- 0:01:00
118000 -- (-1589.509) [-1589.826] (-1589.284) (-1594.519) * (-1588.595) (-1594.243) (-1589.258) [-1591.432] -- 0:00:59
118500 -- (-1592.803) [-1591.241] (-1589.383) (-1588.292) * (-1588.850) (-1596.244) [-1587.340] (-1591.215) -- 0:00:59
119000 -- (-1587.358) (-1590.553) (-1590.170) [-1589.593] * (-1588.710) (-1594.069) (-1589.289) [-1591.280] -- 0:00:59
119500 -- [-1586.943] (-1591.058) (-1587.769) (-1588.416) * (-1596.177) [-1588.664] (-1591.187) (-1598.931) -- 0:00:58
120000 -- (-1593.565) [-1588.497] (-1591.507) (-1587.698) * (-1589.497) (-1592.160) [-1588.720] (-1589.271) -- 0:00:58
Average standard deviation of split frequencies: 0.027905
120500 -- (-1588.571) (-1590.328) (-1595.714) [-1586.934] * (-1590.575) (-1587.642) (-1591.257) [-1590.084] -- 0:00:58
121000 -- [-1587.124] (-1591.484) (-1589.358) (-1589.195) * (-1589.473) (-1591.040) (-1590.850) [-1589.667] -- 0:00:58
121500 -- (-1586.790) (-1592.048) (-1589.263) [-1588.747] * (-1593.319) [-1588.159] (-1591.152) (-1591.787) -- 0:00:57
122000 -- (-1587.579) (-1590.871) [-1587.989] (-1589.695) * (-1590.585) (-1590.678) [-1592.874] (-1592.247) -- 0:01:04
122500 -- (-1589.413) [-1591.313] (-1589.118) (-1590.151) * [-1588.753] (-1588.237) (-1591.457) (-1590.133) -- 0:01:04
123000 -- (-1586.552) (-1590.732) [-1585.940] (-1590.952) * (-1589.868) (-1588.925) [-1591.420] (-1590.745) -- 0:01:04
123500 -- (-1589.169) (-1589.943) (-1587.413) [-1588.505] * (-1590.194) [-1592.693] (-1590.548) (-1590.201) -- 0:01:03
124000 -- (-1589.830) (-1588.432) (-1587.638) [-1589.888] * (-1591.490) (-1589.277) (-1589.136) [-1589.367] -- 0:01:03
124500 -- [-1588.246] (-1592.106) (-1589.732) (-1589.148) * (-1591.007) (-1589.284) (-1587.184) [-1591.547] -- 0:01:03
125000 -- [-1588.954] (-1593.214) (-1590.138) (-1589.154) * (-1592.954) (-1590.661) [-1587.431] (-1590.933) -- 0:01:03
Average standard deviation of split frequencies: 0.027793
125500 -- (-1589.611) (-1600.114) [-1589.287] (-1588.288) * (-1589.868) (-1595.483) (-1586.797) [-1591.609] -- 0:01:02
126000 -- (-1589.894) (-1591.596) [-1590.848] (-1588.961) * [-1590.675] (-1591.399) (-1589.646) (-1592.746) -- 0:01:02
126500 -- (-1596.418) (-1592.052) [-1590.368] (-1590.038) * (-1590.989) (-1591.174) (-1590.361) [-1590.529] -- 0:01:02
127000 -- (-1588.406) (-1591.911) [-1589.482] (-1588.427) * [-1593.028] (-1589.628) (-1592.088) (-1591.772) -- 0:01:01
127500 -- [-1589.136] (-1590.008) (-1588.445) (-1588.638) * (-1593.660) (-1588.565) (-1590.548) [-1589.453] -- 0:01:01
128000 -- (-1588.918) (-1590.618) [-1590.384] (-1587.661) * (-1591.049) (-1593.952) (-1590.970) [-1589.217] -- 0:01:01
128500 -- (-1590.806) (-1589.199) (-1592.212) [-1592.051] * [-1589.992] (-1589.438) (-1588.394) (-1590.585) -- 0:01:01
129000 -- (-1590.771) (-1592.526) (-1591.918) [-1588.535] * (-1591.279) [-1589.848] (-1589.112) (-1588.640) -- 0:01:00
129500 -- [-1590.244] (-1588.284) (-1589.237) (-1589.350) * (-1591.695) [-1587.114] (-1588.038) (-1590.728) -- 0:01:00
130000 -- (-1590.913) (-1590.812) (-1591.649) [-1588.128] * (-1593.257) [-1590.010] (-1587.273) (-1594.934) -- 0:01:00
Average standard deviation of split frequencies: 0.027058
130500 -- (-1589.927) [-1591.962] (-1590.034) (-1588.140) * (-1588.337) (-1589.038) [-1586.213] (-1592.897) -- 0:00:59
131000 -- (-1588.087) (-1589.941) (-1588.454) [-1587.586] * (-1589.385) [-1589.561] (-1589.746) (-1588.430) -- 0:00:59
131500 -- (-1592.378) (-1588.015) [-1588.243] (-1587.924) * (-1592.980) (-1590.160) (-1590.254) [-1589.402] -- 0:00:59
132000 -- (-1591.520) [-1590.155] (-1589.229) (-1590.041) * (-1589.592) (-1591.170) [-1593.096] (-1590.167) -- 0:00:59
132500 -- (-1587.517) [-1590.801] (-1592.175) (-1586.918) * (-1589.229) (-1591.634) [-1590.880] (-1590.097) -- 0:00:58
133000 -- [-1589.178] (-1588.895) (-1588.198) (-1593.579) * (-1586.595) (-1593.151) [-1594.704] (-1590.600) -- 0:00:58
133500 -- (-1592.804) (-1591.065) (-1589.287) [-1592.054] * (-1589.359) (-1593.739) [-1588.348] (-1591.135) -- 0:00:58
134000 -- (-1590.178) [-1588.980] (-1592.665) (-1588.628) * (-1591.392) [-1590.875] (-1588.452) (-1590.009) -- 0:00:58
134500 -- (-1587.995) [-1589.693] (-1587.659) (-1588.457) * (-1592.826) (-1588.708) (-1591.873) [-1593.440] -- 0:00:57
135000 -- (-1588.517) (-1590.332) (-1589.945) [-1590.598] * (-1590.839) (-1589.781) (-1592.470) [-1589.924] -- 0:00:57
Average standard deviation of split frequencies: 0.024263
135500 -- [-1586.611] (-1588.336) (-1587.790) (-1591.155) * [-1590.778] (-1589.547) (-1590.009) (-1590.175) -- 0:00:57
136000 -- (-1587.831) (-1588.754) [-1588.433] (-1592.310) * (-1591.247) (-1587.852) [-1587.408] (-1589.921) -- 0:00:57
136500 -- [-1588.323] (-1592.173) (-1588.649) (-1591.746) * (-1588.468) (-1589.903) (-1587.172) [-1590.453] -- 0:01:03
137000 -- (-1587.003) (-1589.566) [-1587.997] (-1591.188) * (-1588.809) [-1590.307] (-1590.087) (-1589.701) -- 0:01:02
137500 -- (-1590.158) (-1591.305) [-1588.977] (-1588.101) * [-1588.971] (-1593.130) (-1591.053) (-1589.554) -- 0:01:02
138000 -- (-1589.461) (-1591.662) (-1587.886) [-1588.093] * (-1589.540) (-1593.152) (-1590.819) [-1591.959] -- 0:01:02
138500 -- (-1588.539) [-1589.051] (-1589.946) (-1588.666) * (-1588.849) [-1588.730] (-1591.268) (-1591.781) -- 0:01:02
139000 -- (-1588.961) [-1589.231] (-1590.446) (-1590.970) * (-1592.323) (-1591.953) [-1594.436] (-1590.057) -- 0:01:01
139500 -- [-1593.129] (-1590.932) (-1588.692) (-1587.345) * (-1593.220) [-1589.655] (-1589.563) (-1589.412) -- 0:01:01
140000 -- (-1589.776) [-1590.425] (-1589.370) (-1587.965) * [-1586.966] (-1593.128) (-1592.300) (-1592.128) -- 0:01:01
Average standard deviation of split frequencies: 0.022956
140500 -- (-1594.875) (-1589.534) [-1591.841] (-1588.799) * [-1588.879] (-1593.174) (-1594.379) (-1589.993) -- 0:01:01
141000 -- (-1592.655) (-1589.186) (-1591.331) [-1588.642] * (-1587.455) [-1588.820] (-1590.148) (-1591.907) -- 0:01:00
141500 -- (-1591.144) (-1589.908) (-1590.666) [-1586.397] * [-1587.422] (-1587.436) (-1588.501) (-1589.416) -- 0:01:00
142000 -- (-1588.841) [-1590.045] (-1590.715) (-1587.247) * (-1589.459) [-1586.520] (-1592.096) (-1590.390) -- 0:01:00
142500 -- (-1594.985) [-1590.744] (-1593.745) (-1592.158) * (-1588.606) (-1587.980) (-1590.261) [-1590.972] -- 0:01:00
143000 -- [-1588.731] (-1591.583) (-1594.970) (-1588.710) * (-1587.240) (-1591.882) (-1588.796) [-1592.507] -- 0:00:59
143500 -- (-1590.345) (-1595.315) (-1589.933) [-1588.243] * [-1589.305] (-1590.543) (-1589.666) (-1590.916) -- 0:00:59
144000 -- (-1589.834) (-1592.686) (-1588.465) [-1588.824] * (-1589.274) (-1592.096) (-1591.509) [-1591.481] -- 0:00:59
144500 -- (-1592.062) [-1589.869] (-1597.717) (-1588.748) * [-1590.253] (-1597.446) (-1588.893) (-1590.964) -- 0:00:59
145000 -- [-1587.388] (-1596.648) (-1590.780) (-1589.903) * [-1589.409] (-1591.114) (-1590.732) (-1591.964) -- 0:00:58
Average standard deviation of split frequencies: 0.022308
145500 -- [-1588.906] (-1589.064) (-1590.838) (-1589.862) * [-1591.998] (-1591.473) (-1592.019) (-1593.798) -- 0:00:58
146000 -- [-1586.514] (-1589.301) (-1591.064) (-1591.367) * (-1591.571) (-1594.763) (-1593.532) [-1588.852] -- 0:00:58
146500 -- [-1587.712] (-1589.043) (-1590.231) (-1591.322) * [-1592.284] (-1590.712) (-1588.627) (-1589.959) -- 0:00:58
147000 -- (-1588.097) (-1588.079) (-1588.412) [-1589.313] * (-1587.905) (-1590.608) (-1591.266) [-1587.240] -- 0:00:58
147500 -- (-1588.687) (-1590.562) [-1588.331] (-1591.152) * [-1588.276] (-1591.259) (-1591.750) (-1588.604) -- 0:00:57
148000 -- (-1589.459) (-1593.822) (-1587.183) [-1589.709] * (-1590.286) (-1594.891) (-1591.597) [-1589.739] -- 0:00:57
148500 -- [-1593.486] (-1592.726) (-1589.470) (-1593.259) * (-1590.727) (-1590.630) (-1592.027) [-1588.781] -- 0:00:57
149000 -- (-1590.658) (-1590.140) [-1589.212] (-1590.249) * (-1592.209) (-1591.096) (-1592.458) [-1590.375] -- 0:00:57
149500 -- [-1589.280] (-1594.842) (-1593.800) (-1588.202) * (-1587.846) (-1591.220) (-1592.714) [-1591.980] -- 0:00:56
150000 -- (-1594.024) (-1592.333) [-1591.701] (-1591.058) * (-1590.067) (-1589.680) [-1590.412] (-1589.734) -- 0:00:56
Average standard deviation of split frequencies: 0.019242
150500 -- (-1592.418) (-1592.944) (-1588.564) [-1588.247] * [-1588.580] (-1589.812) (-1596.517) (-1588.748) -- 0:00:56
151000 -- [-1590.835] (-1593.175) (-1589.742) (-1588.579) * (-1591.107) [-1587.982] (-1591.652) (-1594.796) -- 0:01:01
151500 -- (-1591.330) (-1588.943) (-1591.877) [-1588.754] * (-1589.536) (-1589.999) [-1588.329] (-1591.323) -- 0:01:01
152000 -- (-1590.608) (-1588.568) (-1587.785) [-1586.436] * [-1587.664] (-1589.826) (-1590.802) (-1589.539) -- 0:01:01
152500 -- (-1587.680) (-1588.322) [-1590.061] (-1587.548) * (-1587.013) [-1590.266] (-1591.116) (-1590.902) -- 0:01:01
153000 -- [-1586.232] (-1591.248) (-1591.976) (-1588.249) * (-1588.991) (-1591.590) [-1591.436] (-1590.722) -- 0:01:00
153500 -- (-1596.468) [-1591.108] (-1590.757) (-1588.538) * (-1588.514) (-1590.959) [-1587.860] (-1590.703) -- 0:01:00
154000 -- [-1589.415] (-1588.764) (-1588.639) (-1586.993) * (-1592.508) (-1591.028) (-1589.375) [-1591.868] -- 0:01:00
154500 -- (-1588.418) (-1589.095) (-1591.149) [-1587.390] * (-1587.266) (-1591.721) [-1592.180] (-1595.654) -- 0:01:00
155000 -- [-1587.752] (-1594.560) (-1591.731) (-1588.487) * (-1590.288) (-1589.232) [-1590.705] (-1595.061) -- 0:00:59
Average standard deviation of split frequencies: 0.017972
155500 -- (-1589.210) (-1593.503) (-1592.216) [-1587.615] * (-1587.676) [-1591.083] (-1590.465) (-1590.840) -- 0:00:59
156000 -- (-1591.402) [-1591.780] (-1589.576) (-1590.357) * [-1589.460] (-1592.106) (-1592.898) (-1587.890) -- 0:00:59
156500 -- (-1590.355) [-1590.580] (-1593.739) (-1586.088) * (-1591.441) (-1595.088) [-1587.423] (-1589.213) -- 0:00:59
157000 -- [-1589.049] (-1589.931) (-1587.046) (-1588.126) * (-1590.747) (-1595.033) [-1592.439] (-1590.151) -- 0:00:59
157500 -- (-1589.385) (-1588.548) (-1589.886) [-1587.829] * (-1590.541) (-1591.752) (-1592.414) [-1588.836] -- 0:00:58
158000 -- (-1590.103) [-1593.120] (-1593.450) (-1588.194) * (-1591.972) (-1588.543) [-1590.601] (-1591.677) -- 0:00:58
158500 -- (-1591.812) (-1593.355) [-1593.114] (-1588.225) * (-1589.349) [-1586.827] (-1592.473) (-1594.790) -- 0:00:58
159000 -- (-1590.852) [-1593.818] (-1593.813) (-1586.796) * (-1588.039) [-1588.665] (-1588.539) (-1591.256) -- 0:00:58
159500 -- (-1588.308) (-1593.933) (-1588.869) [-1589.373] * (-1587.827) [-1588.384] (-1590.104) (-1594.043) -- 0:00:57
160000 -- (-1589.724) [-1590.826] (-1588.216) (-1589.455) * (-1591.152) (-1590.211) (-1589.881) [-1591.080] -- 0:00:57
Average standard deviation of split frequencies: 0.020075
160500 -- (-1589.987) (-1591.178) (-1589.505) [-1587.350] * (-1589.321) [-1589.735] (-1589.425) (-1588.230) -- 0:00:57
161000 -- [-1590.552] (-1590.421) (-1587.908) (-1590.149) * [-1594.399] (-1588.376) (-1587.769) (-1588.977) -- 0:00:57
161500 -- (-1591.652) [-1595.569] (-1588.943) (-1595.375) * (-1593.172) (-1589.477) (-1590.362) [-1587.763] -- 0:00:57
162000 -- [-1592.273] (-1591.961) (-1587.741) (-1589.663) * (-1591.173) (-1589.984) (-1591.984) [-1588.444] -- 0:00:56
162500 -- (-1587.963) [-1593.078] (-1588.410) (-1594.220) * (-1591.060) (-1588.429) (-1594.738) [-1590.782] -- 0:00:56
163000 -- (-1590.547) (-1591.040) (-1589.608) [-1589.188] * (-1589.050) (-1590.035) (-1594.331) [-1588.971] -- 0:00:56
163500 -- [-1588.218] (-1591.178) (-1589.083) (-1589.978) * (-1588.996) [-1588.017] (-1591.070) (-1588.892) -- 0:00:56
164000 -- (-1591.015) (-1589.534) (-1591.553) [-1588.070] * (-1587.512) [-1586.791] (-1589.706) (-1586.844) -- 0:00:56
164500 -- (-1590.814) [-1590.434] (-1590.689) (-1587.170) * (-1589.815) [-1591.798] (-1591.160) (-1588.422) -- 0:00:55
165000 -- (-1591.068) (-1594.110) [-1594.557] (-1592.166) * [-1586.997] (-1589.195) (-1589.622) (-1592.514) -- 0:00:55
Average standard deviation of split frequencies: 0.019595
165500 -- (-1596.963) (-1592.622) (-1587.595) [-1593.106] * (-1588.425) (-1588.374) (-1590.459) [-1589.363] -- 0:01:00
166000 -- (-1593.415) [-1591.774] (-1591.375) (-1591.003) * (-1589.281) (-1588.442) [-1588.991] (-1587.779) -- 0:01:00
166500 -- (-1590.876) (-1590.355) [-1591.249] (-1594.543) * (-1590.331) (-1590.204) (-1592.282) [-1589.467] -- 0:01:00
167000 -- (-1592.261) (-1588.910) (-1591.542) [-1591.401] * [-1588.250] (-1595.168) (-1589.247) (-1588.836) -- 0:00:59
167500 -- (-1592.651) (-1589.498) [-1588.089] (-1595.626) * [-1588.586] (-1592.021) (-1591.409) (-1590.559) -- 0:00:59
168000 -- (-1590.548) (-1590.185) [-1589.396] (-1595.503) * (-1591.006) (-1590.285) [-1590.996] (-1588.907) -- 0:00:59
168500 -- (-1594.650) [-1592.024] (-1590.264) (-1588.245) * [-1589.212] (-1591.646) (-1591.115) (-1590.601) -- 0:00:59
169000 -- (-1589.429) (-1594.179) [-1586.753] (-1589.094) * (-1591.017) (-1591.522) [-1589.068] (-1587.890) -- 0:00:59
169500 -- (-1589.084) [-1588.436] (-1587.802) (-1589.288) * [-1594.773] (-1591.275) (-1589.621) (-1591.228) -- 0:00:58
170000 -- (-1589.446) (-1590.768) (-1588.504) [-1592.530] * (-1590.981) [-1591.310] (-1588.652) (-1591.554) -- 0:00:58
Average standard deviation of split frequencies: 0.019611
170500 -- (-1588.449) (-1588.493) (-1590.482) [-1587.757] * [-1588.967] (-1591.821) (-1590.551) (-1588.547) -- 0:00:58
171000 -- [-1592.978] (-1589.522) (-1589.079) (-1590.901) * [-1589.733] (-1590.606) (-1591.346) (-1588.480) -- 0:00:58
171500 -- (-1591.870) [-1590.475] (-1588.812) (-1592.225) * (-1590.617) (-1590.605) [-1589.484] (-1590.137) -- 0:00:57
172000 -- (-1591.492) [-1590.429] (-1589.071) (-1590.759) * (-1589.304) (-1592.491) (-1589.666) [-1588.825] -- 0:00:57
172500 -- (-1590.604) (-1590.547) [-1587.756] (-1590.405) * [-1590.443] (-1593.141) (-1588.730) (-1588.824) -- 0:00:57
173000 -- (-1592.141) (-1590.818) (-1594.151) [-1587.784] * (-1590.636) [-1590.631] (-1589.633) (-1591.366) -- 0:00:57
173500 -- [-1591.413] (-1590.515) (-1588.572) (-1590.643) * (-1592.677) (-1589.068) (-1592.836) [-1587.043] -- 0:00:57
174000 -- (-1593.401) [-1590.073] (-1588.098) (-1590.293) * [-1589.695] (-1590.178) (-1588.778) (-1586.894) -- 0:00:56
174500 -- (-1590.307) (-1590.778) [-1587.773] (-1590.085) * (-1589.117) (-1592.239) (-1591.726) [-1586.477] -- 0:00:56
175000 -- (-1590.481) (-1587.354) [-1588.036] (-1588.946) * [-1588.830] (-1589.249) (-1591.103) (-1593.395) -- 0:00:56
Average standard deviation of split frequencies: 0.017903
175500 -- (-1589.441) (-1587.548) (-1593.861) [-1587.173] * (-1590.860) (-1595.422) [-1590.059] (-1588.014) -- 0:00:56
176000 -- (-1590.805) (-1591.144) (-1592.367) [-1586.525] * (-1591.342) (-1597.229) (-1594.386) [-1586.461] -- 0:00:56
176500 -- (-1589.113) (-1592.730) (-1588.330) [-1587.866] * (-1588.802) [-1592.039] (-1594.436) (-1589.620) -- 0:00:55
177000 -- (-1590.028) [-1591.848] (-1587.524) (-1589.764) * (-1589.549) (-1591.451) [-1593.550] (-1589.564) -- 0:00:55
177500 -- (-1589.585) [-1590.706] (-1591.329) (-1593.334) * (-1589.552) (-1589.050) (-1588.207) [-1589.319] -- 0:00:55
178000 -- (-1591.005) [-1590.670] (-1587.529) (-1591.871) * (-1587.634) (-1590.094) (-1589.871) [-1588.675] -- 0:00:55
178500 -- (-1592.206) (-1591.010) (-1589.579) [-1590.866] * (-1590.593) (-1588.994) [-1589.172] (-1591.007) -- 0:00:55
179000 -- (-1591.429) (-1593.867) (-1591.171) [-1591.154] * (-1587.798) (-1590.720) (-1587.429) [-1587.693] -- 0:00:55
179500 -- [-1590.464] (-1594.195) (-1588.409) (-1588.680) * [-1588.537] (-1590.705) (-1590.483) (-1591.192) -- 0:00:54
180000 -- (-1590.816) (-1592.851) [-1589.194] (-1590.122) * (-1589.289) (-1590.993) (-1589.390) [-1587.300] -- 0:00:54
Average standard deviation of split frequencies: 0.016479
180500 -- (-1588.553) (-1591.273) (-1590.137) [-1591.951] * (-1588.269) [-1589.865] (-1593.765) (-1588.886) -- 0:00:59
181000 -- (-1589.809) (-1587.746) (-1593.347) [-1591.136] * [-1588.895] (-1590.727) (-1594.274) (-1587.552) -- 0:00:58
181500 -- (-1587.686) (-1589.551) (-1592.254) [-1591.821] * (-1591.963) (-1590.592) (-1589.915) [-1591.482] -- 0:00:58
182000 -- [-1588.502] (-1588.682) (-1589.776) (-1588.743) * (-1587.565) (-1589.287) (-1591.064) [-1591.919] -- 0:00:58
182500 -- (-1589.674) [-1590.330] (-1591.602) (-1589.687) * (-1587.693) (-1589.942) (-1591.845) [-1593.173] -- 0:00:58
183000 -- (-1591.608) [-1590.409] (-1591.639) (-1591.695) * (-1588.965) [-1588.646] (-1591.368) (-1595.921) -- 0:00:58
183500 -- (-1593.470) [-1589.230] (-1590.237) (-1592.469) * (-1590.066) [-1593.390] (-1586.942) (-1593.232) -- 0:00:57
184000 -- (-1588.740) (-1590.812) [-1591.510] (-1590.955) * (-1590.471) (-1592.938) [-1589.594] (-1595.244) -- 0:00:57
184500 -- (-1588.776) (-1593.386) [-1591.941] (-1589.634) * (-1590.687) (-1592.488) [-1590.377] (-1592.631) -- 0:00:57
185000 -- (-1590.733) (-1590.190) [-1589.315] (-1589.093) * [-1593.896] (-1591.914) (-1591.159) (-1591.773) -- 0:00:57
Average standard deviation of split frequencies: 0.016407
185500 -- (-1590.233) (-1588.905) (-1591.885) [-1592.117] * (-1593.212) (-1589.369) (-1590.510) [-1589.394] -- 0:00:57
186000 -- (-1587.465) (-1590.124) [-1590.695] (-1593.902) * (-1593.893) [-1591.023] (-1592.030) (-1593.719) -- 0:00:56
186500 -- (-1588.292) [-1587.306] (-1587.834) (-1590.776) * (-1589.929) (-1592.225) [-1590.273] (-1591.413) -- 0:00:56
187000 -- [-1589.681] (-1592.206) (-1588.941) (-1590.110) * [-1591.952] (-1592.465) (-1592.554) (-1590.620) -- 0:00:56
187500 -- (-1591.020) [-1591.878] (-1589.858) (-1588.830) * [-1588.678] (-1592.344) (-1593.857) (-1589.658) -- 0:00:56
188000 -- (-1595.208) (-1595.324) (-1591.113) [-1589.573] * (-1587.359) [-1590.923] (-1591.446) (-1591.699) -- 0:00:56
188500 -- (-1592.852) (-1593.040) [-1590.183] (-1588.317) * [-1588.757] (-1588.516) (-1589.810) (-1591.288) -- 0:00:55
189000 -- (-1589.652) (-1592.348) (-1590.552) [-1592.125] * (-1590.352) [-1590.567] (-1588.969) (-1595.573) -- 0:00:55
189500 -- [-1588.639] (-1592.431) (-1590.400) (-1591.818) * [-1589.788] (-1591.528) (-1589.366) (-1591.947) -- 0:00:55
190000 -- [-1588.926] (-1592.316) (-1590.962) (-1592.303) * (-1591.421) [-1590.826] (-1587.809) (-1594.212) -- 0:00:55
Average standard deviation of split frequencies: 0.016136
190500 -- (-1592.465) (-1591.353) [-1592.091] (-1591.074) * (-1592.559) (-1590.792) (-1590.973) [-1591.792] -- 0:00:55
191000 -- [-1592.078] (-1591.179) (-1591.260) (-1587.821) * (-1594.166) (-1592.725) [-1590.403] (-1590.541) -- 0:00:55
191500 -- (-1590.410) (-1594.816) (-1591.154) [-1587.345] * (-1589.776) [-1588.786] (-1595.464) (-1590.743) -- 0:00:54
192000 -- (-1589.295) (-1588.075) (-1593.026) [-1590.732] * (-1589.708) (-1592.232) [-1592.546] (-1590.800) -- 0:00:54
192500 -- (-1591.321) (-1589.480) (-1591.702) [-1590.888] * [-1593.288] (-1592.463) (-1594.014) (-1590.290) -- 0:00:54
193000 -- (-1592.445) [-1589.346] (-1589.092) (-1594.516) * (-1593.931) (-1589.532) [-1590.087] (-1588.744) -- 0:00:54
193500 -- (-1590.972) (-1587.830) [-1594.007] (-1591.185) * (-1592.623) [-1590.923] (-1591.133) (-1592.311) -- 0:00:54
194000 -- [-1590.558] (-1588.032) (-1591.663) (-1589.349) * [-1590.017] (-1593.907) (-1589.989) (-1587.405) -- 0:00:54
194500 -- [-1590.631] (-1591.248) (-1590.493) (-1587.265) * (-1589.160) [-1592.546] (-1595.517) (-1593.649) -- 0:00:53
195000 -- (-1590.777) (-1588.140) [-1589.326] (-1588.132) * (-1589.584) (-1592.227) (-1595.341) [-1591.134] -- 0:00:57
Average standard deviation of split frequencies: 0.015064
195500 -- (-1590.674) (-1592.121) (-1591.573) [-1588.964] * [-1590.251] (-1592.049) (-1591.103) (-1587.161) -- 0:00:57
196000 -- (-1591.475) (-1593.597) (-1590.561) [-1591.069] * (-1591.290) (-1590.676) (-1593.452) [-1590.746] -- 0:00:57
196500 -- (-1591.873) (-1588.258) (-1592.409) [-1589.093] * (-1592.203) [-1590.896] (-1587.218) (-1592.553) -- 0:00:57
197000 -- (-1591.463) (-1588.254) (-1590.682) [-1587.186] * (-1592.056) (-1589.653) [-1587.891] (-1591.554) -- 0:00:57
197500 -- (-1594.009) (-1589.863) (-1593.038) [-1586.672] * (-1589.879) (-1589.970) (-1591.685) [-1592.890] -- 0:00:56
198000 -- (-1594.179) (-1589.185) (-1596.039) [-1591.638] * [-1590.553] (-1589.792) (-1591.731) (-1591.293) -- 0:00:56
198500 -- (-1591.475) (-1590.314) (-1590.663) [-1588.069] * [-1592.156] (-1590.989) (-1592.177) (-1590.340) -- 0:00:56
199000 -- (-1593.059) (-1587.854) [-1596.915] (-1587.082) * [-1588.431] (-1592.031) (-1590.754) (-1591.304) -- 0:00:56
199500 -- (-1592.094) (-1586.656) [-1591.920] (-1590.509) * (-1590.637) (-1592.075) (-1589.976) [-1589.622] -- 0:00:56
200000 -- (-1591.048) [-1587.640] (-1589.111) (-1593.625) * [-1592.029] (-1590.986) (-1591.419) (-1589.844) -- 0:00:55
Average standard deviation of split frequencies: 0.013965
200500 -- (-1590.882) (-1590.320) (-1589.828) [-1587.878] * (-1593.192) (-1590.439) [-1590.280] (-1589.433) -- 0:00:55
201000 -- [-1594.540] (-1590.969) (-1592.388) (-1592.561) * (-1589.100) (-1591.566) (-1590.056) [-1590.224] -- 0:00:55
201500 -- (-1590.513) [-1589.896] (-1590.698) (-1593.049) * (-1591.573) (-1591.902) [-1592.416] (-1593.070) -- 0:00:55
202000 -- (-1590.832) (-1587.568) (-1591.000) [-1595.335] * (-1591.574) [-1591.602] (-1588.999) (-1594.293) -- 0:00:55
202500 -- (-1595.430) [-1588.750] (-1597.213) (-1591.768) * (-1588.436) (-1590.900) [-1587.225] (-1593.309) -- 0:00:55
203000 -- (-1593.154) (-1591.290) [-1593.545] (-1587.884) * (-1590.234) [-1591.749] (-1595.322) (-1589.511) -- 0:00:54
203500 -- (-1591.365) (-1591.889) [-1590.494] (-1587.063) * (-1590.590) (-1593.772) (-1588.355) [-1590.132] -- 0:00:54
204000 -- (-1590.105) [-1592.556] (-1591.766) (-1588.618) * (-1589.851) (-1590.222) [-1586.685] (-1590.466) -- 0:00:54
204500 -- (-1593.022) [-1588.943] (-1591.949) (-1589.206) * (-1589.530) (-1591.631) (-1589.217) [-1589.792] -- 0:00:54
205000 -- (-1591.394) (-1589.291) (-1590.507) [-1590.492] * (-1589.122) [-1589.169] (-1589.163) (-1592.463) -- 0:00:54
Average standard deviation of split frequencies: 0.012586
205500 -- (-1591.492) (-1589.234) [-1589.932] (-1588.518) * (-1587.204) (-1589.725) [-1592.323] (-1587.745) -- 0:00:54
206000 -- (-1590.630) [-1590.249] (-1590.374) (-1586.360) * (-1589.296) [-1587.375] (-1591.342) (-1594.734) -- 0:00:53
206500 -- [-1588.299] (-1592.631) (-1590.544) (-1588.359) * (-1587.889) [-1587.820] (-1590.120) (-1593.598) -- 0:00:53
207000 -- (-1591.275) (-1592.368) [-1590.392] (-1590.645) * (-1587.347) (-1589.734) (-1591.559) [-1588.721] -- 0:00:53
207500 -- (-1593.338) (-1591.594) (-1589.900) [-1589.893] * [-1589.624] (-1588.437) (-1586.519) (-1591.761) -- 0:00:53
208000 -- (-1587.769) [-1596.979] (-1588.993) (-1588.129) * [-1587.767] (-1589.614) (-1590.522) (-1590.965) -- 0:00:53
208500 -- [-1594.184] (-1594.996) (-1592.872) (-1590.923) * (-1590.811) [-1586.255] (-1591.472) (-1590.170) -- 0:00:53
209000 -- (-1591.577) (-1593.634) (-1590.409) [-1592.898] * (-1590.389) (-1586.956) [-1586.982] (-1593.103) -- 0:00:52
209500 -- (-1599.067) (-1592.626) (-1590.885) [-1591.259] * (-1591.633) (-1587.887) (-1587.874) [-1592.266] -- 0:00:56
210000 -- (-1590.040) [-1591.300] (-1591.069) (-1590.646) * (-1594.244) (-1587.577) [-1588.409] (-1593.188) -- 0:00:56
Average standard deviation of split frequencies: 0.012805
210500 -- [-1590.766] (-1592.803) (-1589.246) (-1592.806) * (-1588.776) [-1589.940] (-1587.033) (-1590.606) -- 0:00:56
211000 -- (-1590.566) [-1594.204] (-1589.621) (-1589.745) * (-1590.557) (-1590.413) (-1589.169) [-1592.269] -- 0:00:56
211500 -- (-1590.389) (-1592.997) (-1590.014) [-1588.951] * (-1590.760) (-1593.932) (-1590.693) [-1587.234] -- 0:00:55
212000 -- (-1589.873) [-1590.907] (-1590.867) (-1588.455) * (-1590.716) (-1593.522) (-1592.104) [-1586.488] -- 0:00:55
212500 -- (-1588.300) (-1588.651) (-1596.949) [-1588.280] * [-1588.671] (-1595.101) (-1590.517) (-1587.699) -- 0:00:55
213000 -- [-1593.562] (-1592.590) (-1594.061) (-1590.917) * [-1589.590] (-1589.117) (-1590.843) (-1589.687) -- 0:00:55
213500 -- (-1590.902) (-1590.944) (-1589.717) [-1587.890] * (-1587.306) (-1593.416) [-1592.367] (-1592.642) -- 0:00:55
214000 -- (-1594.210) [-1590.954] (-1589.863) (-1588.617) * (-1589.400) (-1590.620) (-1593.928) [-1590.537] -- 0:00:55
214500 -- [-1593.134] (-1589.690) (-1592.381) (-1588.999) * (-1590.763) (-1592.851) (-1591.158) [-1589.456] -- 0:00:54
215000 -- (-1590.216) (-1590.880) (-1591.261) [-1588.128] * [-1589.335] (-1592.145) (-1591.411) (-1587.431) -- 0:00:54
Average standard deviation of split frequencies: 0.012973
215500 -- (-1591.244) (-1591.125) (-1590.974) [-1587.045] * (-1588.938) [-1587.638] (-1590.064) (-1587.216) -- 0:00:54
216000 -- (-1591.693) (-1589.938) [-1588.080] (-1589.173) * (-1592.034) [-1591.834] (-1593.608) (-1589.448) -- 0:00:54
216500 -- (-1590.916) (-1589.089) (-1592.901) [-1586.914] * (-1591.405) (-1590.786) (-1590.669) [-1592.691] -- 0:00:54
217000 -- (-1590.895) (-1591.274) (-1596.805) [-1590.354] * (-1591.810) (-1587.877) (-1591.806) [-1587.572] -- 0:00:54
217500 -- (-1595.318) (-1588.543) (-1591.505) [-1588.998] * [-1588.820] (-1590.306) (-1590.071) (-1588.725) -- 0:00:53
218000 -- (-1591.409) (-1588.594) [-1588.797] (-1590.353) * [-1588.399] (-1593.762) (-1590.936) (-1587.622) -- 0:00:53
218500 -- [-1592.285] (-1592.427) (-1591.564) (-1591.535) * (-1589.069) [-1589.334] (-1590.197) (-1587.311) -- 0:00:53
219000 -- (-1592.399) [-1591.645] (-1591.853) (-1589.462) * (-1591.925) (-1589.190) (-1591.543) [-1588.935] -- 0:00:53
219500 -- (-1590.873) (-1589.768) (-1591.848) [-1590.207] * (-1590.305) [-1590.176] (-1592.661) (-1589.855) -- 0:00:53
220000 -- (-1591.662) [-1587.844] (-1589.023) (-1589.898) * (-1590.045) [-1588.711] (-1589.634) (-1588.131) -- 0:00:53
Average standard deviation of split frequencies: 0.013886
220500 -- [-1593.943] (-1588.210) (-1590.080) (-1591.959) * (-1600.641) (-1591.677) [-1587.420] (-1588.483) -- 0:00:53
221000 -- (-1592.063) (-1589.208) (-1590.891) [-1589.586] * (-1592.804) (-1590.548) (-1587.814) [-1591.044] -- 0:00:52
221500 -- (-1591.190) [-1587.643] (-1591.282) (-1593.760) * (-1588.841) [-1590.024] (-1586.939) (-1591.308) -- 0:00:52
222000 -- (-1588.235) (-1587.618) [-1590.432] (-1597.945) * (-1590.329) (-1590.019) [-1587.959] (-1589.835) -- 0:00:52
222500 -- (-1592.165) (-1590.910) (-1590.787) [-1591.728] * [-1589.343] (-1590.794) (-1593.632) (-1591.844) -- 0:00:52
223000 -- (-1590.664) (-1589.482) [-1590.726] (-1589.965) * (-1591.852) [-1590.847] (-1591.615) (-1591.720) -- 0:00:52
223500 -- [-1591.329] (-1589.047) (-1588.119) (-1591.415) * (-1590.704) (-1592.026) [-1588.029] (-1587.752) -- 0:00:52
224000 -- (-1595.129) (-1589.465) [-1591.476] (-1591.527) * (-1589.340) (-1591.930) [-1587.448] (-1590.187) -- 0:00:51
224500 -- (-1589.321) (-1588.784) (-1589.060) [-1590.778] * [-1593.644] (-1591.284) (-1589.534) (-1589.602) -- 0:00:55
225000 -- (-1591.601) [-1588.356] (-1590.201) (-1592.518) * [-1589.739] (-1592.192) (-1587.758) (-1590.177) -- 0:00:55
Average standard deviation of split frequencies: 0.015369
225500 -- [-1587.840] (-1590.706) (-1590.897) (-1592.182) * (-1588.334) (-1589.671) (-1591.520) [-1590.612] -- 0:00:54
226000 -- (-1589.843) [-1588.676] (-1588.177) (-1593.789) * (-1590.800) (-1590.617) [-1587.712] (-1591.274) -- 0:00:54
226500 -- (-1591.442) (-1589.093) [-1588.330] (-1597.625) * (-1593.958) (-1590.133) (-1591.281) [-1591.152] -- 0:00:54
227000 -- [-1593.584] (-1590.589) (-1588.974) (-1592.415) * (-1590.730) [-1593.692] (-1595.792) (-1589.206) -- 0:00:54
227500 -- (-1598.102) (-1588.355) [-1591.296] (-1591.029) * (-1591.709) [-1588.144] (-1590.940) (-1590.886) -- 0:00:54
228000 -- (-1590.868) (-1588.290) [-1589.570] (-1594.252) * [-1588.175] (-1591.790) (-1591.028) (-1591.243) -- 0:00:54
228500 -- (-1592.166) (-1587.218) [-1587.895] (-1589.699) * (-1590.066) (-1592.451) [-1590.190] (-1589.127) -- 0:00:54
229000 -- [-1589.012] (-1592.966) (-1590.690) (-1590.118) * (-1592.644) (-1591.331) [-1590.819] (-1591.518) -- 0:00:53
229500 -- (-1591.663) (-1590.395) [-1590.290] (-1592.122) * [-1589.324] (-1587.690) (-1594.281) (-1591.729) -- 0:00:53
230000 -- [-1592.024] (-1588.461) (-1593.052) (-1591.395) * (-1589.284) [-1591.571] (-1596.121) (-1591.772) -- 0:00:53
Average standard deviation of split frequencies: 0.014817
230500 -- [-1589.150] (-1590.053) (-1590.297) (-1593.873) * (-1591.622) [-1587.132] (-1588.982) (-1591.674) -- 0:00:53
231000 -- (-1592.486) [-1588.847] (-1592.489) (-1591.149) * (-1588.398) (-1588.454) (-1595.649) [-1589.666] -- 0:00:53
231500 -- (-1593.772) (-1588.233) (-1593.184) [-1592.060] * (-1587.846) [-1593.602] (-1589.150) (-1591.000) -- 0:00:53
232000 -- [-1590.855] (-1589.179) (-1592.234) (-1591.539) * [-1589.391] (-1587.444) (-1589.258) (-1592.452) -- 0:00:52
232500 -- (-1590.473) (-1590.866) [-1588.229] (-1591.234) * (-1591.589) (-1589.095) (-1588.178) [-1592.333] -- 0:00:52
233000 -- (-1590.379) [-1587.171] (-1587.724) (-1589.457) * (-1592.707) (-1591.776) (-1589.995) [-1588.594] -- 0:00:52
233500 -- (-1590.931) (-1590.138) [-1590.949] (-1589.386) * (-1589.743) (-1590.355) [-1587.018] (-1588.970) -- 0:00:52
234000 -- [-1590.802] (-1587.929) (-1590.586) (-1589.496) * (-1590.847) (-1589.691) [-1586.593] (-1593.638) -- 0:00:52
234500 -- (-1591.962) (-1593.669) [-1590.800] (-1590.590) * (-1588.383) [-1591.311] (-1594.709) (-1589.728) -- 0:00:52
235000 -- [-1596.333] (-1591.641) (-1587.670) (-1589.280) * (-1592.815) (-1591.165) (-1587.648) [-1589.875] -- 0:00:52
Average standard deviation of split frequencies: 0.016979
235500 -- (-1592.483) [-1591.977] (-1590.049) (-1591.039) * (-1592.040) [-1589.665] (-1590.896) (-1590.454) -- 0:00:51
236000 -- [-1594.186] (-1587.593) (-1594.168) (-1590.917) * [-1590.195] (-1589.358) (-1588.379) (-1588.453) -- 0:00:51
236500 -- [-1589.457] (-1590.684) (-1589.798) (-1593.913) * (-1590.077) [-1588.670] (-1589.053) (-1590.403) -- 0:00:51
237000 -- (-1590.825) [-1591.082] (-1592.519) (-1587.726) * (-1588.730) [-1587.954] (-1589.771) (-1590.723) -- 0:00:51
237500 -- (-1588.829) (-1590.540) [-1588.105] (-1590.801) * [-1589.746] (-1589.969) (-1594.185) (-1588.545) -- 0:00:51
238000 -- (-1590.247) [-1589.921] (-1591.199) (-1592.487) * [-1591.390] (-1590.752) (-1591.490) (-1590.082) -- 0:00:51
238500 -- (-1588.837) [-1587.224] (-1588.938) (-1591.353) * (-1590.055) [-1591.182] (-1591.091) (-1589.914) -- 0:00:51
239000 -- (-1589.352) (-1588.616) (-1588.624) [-1589.140] * (-1591.408) (-1594.573) (-1590.519) [-1588.870] -- 0:00:54
239500 -- (-1592.662) (-1591.418) [-1588.062] (-1589.187) * (-1590.583) (-1588.710) [-1592.016] (-1596.583) -- 0:00:53
240000 -- [-1593.638] (-1590.930) (-1591.843) (-1590.825) * (-1588.348) [-1588.936] (-1591.985) (-1592.239) -- 0:00:53
Average standard deviation of split frequencies: 0.014639
240500 -- [-1589.905] (-1588.755) (-1591.771) (-1590.295) * (-1592.315) (-1589.826) [-1591.294] (-1591.503) -- 0:00:53
241000 -- (-1593.340) (-1588.513) [-1590.555] (-1589.726) * (-1590.086) (-1590.773) [-1590.797] (-1590.721) -- 0:00:53
241500 -- (-1590.849) [-1591.174] (-1587.420) (-1593.939) * (-1590.480) (-1586.898) (-1591.954) [-1592.092] -- 0:00:53
242000 -- (-1594.806) (-1589.837) (-1589.066) [-1590.828] * (-1592.337) [-1587.100] (-1592.801) (-1589.591) -- 0:00:53
242500 -- (-1591.687) [-1588.871] (-1590.299) (-1586.770) * (-1594.136) (-1591.217) (-1592.359) [-1590.382] -- 0:00:53
243000 -- (-1591.683) [-1589.667] (-1590.991) (-1589.653) * [-1588.548] (-1595.265) (-1589.790) (-1587.185) -- 0:00:52
243500 -- (-1591.736) (-1593.226) (-1593.531) [-1589.752] * (-1592.682) (-1588.851) [-1589.312] (-1590.691) -- 0:00:52
244000 -- (-1591.713) (-1593.203) [-1592.174] (-1592.486) * (-1592.667) (-1591.710) [-1588.326] (-1593.021) -- 0:00:52
244500 -- [-1592.996] (-1592.214) (-1595.489) (-1594.571) * (-1589.305) (-1590.195) [-1591.633] (-1592.176) -- 0:00:52
245000 -- [-1592.290] (-1589.747) (-1589.429) (-1596.210) * [-1593.771] (-1587.446) (-1592.229) (-1590.630) -- 0:00:52
Average standard deviation of split frequencies: 0.016480
245500 -- (-1592.886) (-1590.652) [-1587.270] (-1591.960) * (-1592.931) [-1590.774] (-1592.314) (-1590.891) -- 0:00:52
246000 -- (-1592.460) (-1589.956) (-1590.625) [-1593.920] * [-1592.454] (-1593.474) (-1588.573) (-1590.922) -- 0:00:52
246500 -- (-1594.932) (-1588.653) [-1588.764] (-1591.049) * (-1595.318) (-1592.345) [-1589.558] (-1590.602) -- 0:00:51
247000 -- (-1594.683) (-1589.320) (-1589.915) [-1592.148] * (-1593.216) [-1589.144] (-1590.985) (-1589.079) -- 0:00:51
247500 -- (-1592.816) (-1590.022) [-1592.226] (-1589.105) * (-1587.812) (-1591.283) (-1590.946) [-1591.034] -- 0:00:51
248000 -- (-1591.890) (-1589.090) (-1587.827) [-1589.402] * [-1589.988] (-1590.208) (-1589.565) (-1591.090) -- 0:00:51
248500 -- (-1588.261) (-1591.073) [-1588.948] (-1590.803) * [-1588.413] (-1590.410) (-1587.218) (-1591.165) -- 0:00:51
249000 -- (-1591.215) (-1595.268) [-1588.476] (-1594.110) * (-1590.654) [-1589.807] (-1589.619) (-1593.040) -- 0:00:51
249500 -- (-1592.791) (-1591.675) (-1589.927) [-1589.916] * (-1589.184) (-1591.458) (-1590.964) [-1591.207] -- 0:00:51
250000 -- (-1590.886) (-1590.939) (-1589.210) [-1591.663] * (-1588.989) (-1587.293) [-1589.038] (-1593.820) -- 0:00:51
Average standard deviation of split frequencies: 0.019464
250500 -- (-1592.461) [-1591.099] (-1590.318) (-1590.030) * (-1590.846) (-1585.943) [-1587.622] (-1591.114) -- 0:00:50
251000 -- (-1589.759) [-1589.411] (-1588.436) (-1599.858) * (-1590.038) (-1589.105) [-1587.456] (-1590.462) -- 0:00:50
251500 -- [-1592.828] (-1593.868) (-1591.502) (-1588.178) * [-1589.350] (-1589.134) (-1596.010) (-1588.420) -- 0:00:50
252000 -- (-1590.728) [-1591.829] (-1596.304) (-1589.349) * (-1589.919) [-1587.022] (-1593.672) (-1588.160) -- 0:00:50
252500 -- (-1590.641) (-1588.897) [-1592.502] (-1589.803) * (-1589.887) (-1587.595) (-1592.733) [-1591.489] -- 0:00:50
253000 -- (-1589.701) (-1589.205) [-1590.370] (-1595.448) * [-1592.375] (-1588.802) (-1589.591) (-1592.544) -- 0:00:50
253500 -- (-1589.747) (-1592.333) [-1592.918] (-1590.442) * [-1590.748] (-1589.549) (-1589.514) (-1592.401) -- 0:00:53
254000 -- [-1589.746] (-1588.865) (-1590.487) (-1590.154) * (-1587.569) [-1587.570] (-1588.552) (-1589.943) -- 0:00:52
254500 -- [-1588.233] (-1588.522) (-1591.279) (-1589.100) * (-1588.535) [-1587.823] (-1592.885) (-1591.230) -- 0:00:52
255000 -- (-1592.452) [-1587.621] (-1591.632) (-1590.328) * (-1592.167) (-1593.230) (-1589.387) [-1589.795] -- 0:00:52
Average standard deviation of split frequencies: 0.021031
255500 -- [-1588.647] (-1587.593) (-1590.607) (-1588.198) * (-1589.386) (-1588.820) [-1589.362] (-1593.164) -- 0:00:52
256000 -- (-1589.202) [-1586.658] (-1595.153) (-1590.036) * [-1590.122] (-1590.523) (-1590.109) (-1593.257) -- 0:00:52
256500 -- (-1588.412) (-1588.102) (-1592.355) [-1587.272] * (-1590.031) [-1588.449] (-1591.084) (-1590.845) -- 0:00:52
257000 -- (-1588.092) (-1588.996) [-1592.221] (-1588.996) * [-1589.916] (-1590.629) (-1591.676) (-1596.153) -- 0:00:52
257500 -- (-1589.686) [-1589.023] (-1589.329) (-1589.750) * (-1588.831) [-1589.606] (-1587.452) (-1591.163) -- 0:00:51
258000 -- (-1589.194) (-1587.114) (-1591.261) [-1586.707] * [-1586.183] (-1593.718) (-1594.087) (-1590.967) -- 0:00:51
258500 -- [-1589.868] (-1590.077) (-1588.521) (-1590.663) * [-1591.488] (-1595.681) (-1589.028) (-1591.481) -- 0:00:51
259000 -- (-1590.648) (-1587.996) [-1591.351] (-1589.878) * [-1591.957] (-1596.458) (-1589.433) (-1591.935) -- 0:00:51
259500 -- (-1592.937) [-1589.509] (-1592.712) (-1589.139) * [-1588.495] (-1591.362) (-1590.727) (-1595.468) -- 0:00:51
260000 -- (-1593.482) [-1588.022] (-1594.691) (-1588.078) * [-1587.500] (-1589.319) (-1587.626) (-1593.188) -- 0:00:51
Average standard deviation of split frequencies: 0.021701
260500 -- (-1593.652) [-1588.691] (-1593.209) (-1588.646) * (-1590.290) [-1590.565] (-1593.563) (-1594.198) -- 0:00:51
261000 -- [-1594.035] (-1589.409) (-1591.359) (-1589.733) * (-1587.204) (-1588.535) [-1593.450] (-1600.210) -- 0:00:50
261500 -- [-1591.791] (-1587.393) (-1590.687) (-1590.473) * [-1590.571] (-1592.471) (-1589.698) (-1590.098) -- 0:00:50
262000 -- [-1591.232] (-1590.760) (-1589.140) (-1591.379) * (-1593.383) (-1589.406) [-1591.307] (-1590.765) -- 0:00:50
262500 -- (-1592.025) (-1589.486) [-1595.105] (-1591.490) * (-1592.705) (-1590.621) [-1592.427] (-1590.123) -- 0:00:50
263000 -- (-1591.784) (-1589.500) [-1593.027] (-1589.579) * (-1592.330) (-1589.859) [-1592.421] (-1589.708) -- 0:00:50
263500 -- (-1591.198) (-1588.216) (-1588.880) [-1588.690] * (-1589.057) (-1588.832) (-1588.909) [-1593.395] -- 0:00:50
264000 -- (-1590.526) (-1595.735) (-1594.981) [-1587.382] * (-1593.058) (-1593.779) [-1588.283] (-1593.438) -- 0:00:50
264500 -- (-1590.739) (-1596.379) [-1588.805] (-1589.708) * (-1590.490) (-1591.037) (-1586.543) [-1592.385] -- 0:00:50
265000 -- [-1587.511] (-1596.515) (-1590.176) (-1590.914) * [-1588.018] (-1590.743) (-1591.109) (-1591.184) -- 0:00:49
Average standard deviation of split frequencies: 0.019583
265500 -- (-1590.365) (-1592.874) [-1589.511] (-1588.762) * [-1587.604] (-1590.409) (-1588.067) (-1591.830) -- 0:00:49
266000 -- (-1592.415) [-1591.087] (-1594.878) (-1592.288) * [-1589.137] (-1589.527) (-1590.706) (-1593.196) -- 0:00:49
266500 -- [-1589.412] (-1594.117) (-1590.085) (-1589.932) * (-1586.617) [-1592.018] (-1587.799) (-1591.385) -- 0:00:49
267000 -- (-1590.369) [-1591.244] (-1588.945) (-1593.597) * [-1588.319] (-1589.192) (-1593.801) (-1591.235) -- 0:00:49
267500 -- (-1593.802) (-1593.809) [-1588.706] (-1596.084) * [-1587.624] (-1588.322) (-1590.638) (-1590.828) -- 0:00:49
268000 -- (-1594.033) [-1591.603] (-1587.570) (-1594.733) * [-1587.328] (-1591.299) (-1590.996) (-1592.950) -- 0:00:51
268500 -- (-1591.728) (-1592.228) (-1591.121) [-1590.611] * (-1587.647) (-1590.707) [-1588.971] (-1592.291) -- 0:00:51
269000 -- (-1594.686) (-1589.669) [-1591.154] (-1587.560) * (-1590.900) [-1590.618] (-1587.938) (-1589.145) -- 0:00:51
269500 -- [-1593.907] (-1591.154) (-1590.409) (-1587.818) * (-1589.559) (-1592.070) [-1587.046] (-1591.319) -- 0:00:51
270000 -- (-1596.344) (-1593.806) [-1590.073] (-1588.428) * (-1588.423) [-1587.117] (-1590.139) (-1594.728) -- 0:00:51
Average standard deviation of split frequencies: 0.020716
270500 -- (-1594.690) (-1592.335) [-1589.892] (-1591.696) * [-1592.805] (-1591.647) (-1587.628) (-1590.360) -- 0:00:51
271000 -- (-1590.705) [-1592.224] (-1589.621) (-1587.135) * [-1588.771] (-1589.610) (-1592.014) (-1593.243) -- 0:00:51
271500 -- (-1590.190) (-1592.121) [-1589.153] (-1589.140) * [-1587.560] (-1590.542) (-1588.774) (-1589.537) -- 0:00:50
272000 -- (-1591.225) [-1590.271] (-1590.409) (-1591.898) * [-1590.211] (-1590.752) (-1590.873) (-1594.345) -- 0:00:50
272500 -- (-1590.673) (-1592.167) [-1592.216] (-1590.997) * (-1589.737) [-1586.799] (-1594.324) (-1590.274) -- 0:00:50
273000 -- (-1591.542) [-1590.716] (-1593.386) (-1590.110) * (-1589.942) [-1591.105] (-1594.897) (-1593.931) -- 0:00:50
273500 -- [-1588.591] (-1590.398) (-1591.702) (-1590.720) * (-1588.581) (-1588.924) [-1593.452] (-1595.426) -- 0:00:50
274000 -- (-1590.110) (-1588.224) (-1589.701) [-1591.041] * (-1588.354) (-1590.344) [-1591.516] (-1588.372) -- 0:00:50
274500 -- (-1587.818) [-1588.421] (-1593.365) (-1588.554) * (-1588.592) (-1589.290) [-1588.266] (-1588.557) -- 0:00:50
275000 -- (-1589.589) [-1589.155] (-1594.816) (-1589.167) * (-1587.278) (-1589.071) (-1593.793) [-1588.772] -- 0:00:50
Average standard deviation of split frequencies: 0.020226
275500 -- [-1588.597] (-1597.103) (-1588.359) (-1589.686) * (-1590.376) (-1589.508) (-1589.968) [-1589.484] -- 0:00:49
276000 -- (-1591.729) (-1591.679) (-1589.172) [-1589.247] * (-1588.364) (-1589.551) [-1591.058] (-1593.338) -- 0:00:49
276500 -- (-1592.596) (-1594.153) (-1587.591) [-1593.016] * (-1592.048) (-1591.504) [-1591.072] (-1591.259) -- 0:00:49
277000 -- (-1592.249) (-1593.174) (-1588.459) [-1590.073] * [-1589.924] (-1590.840) (-1589.157) (-1590.085) -- 0:00:49
277500 -- (-1594.197) [-1590.758] (-1587.075) (-1590.367) * (-1592.885) [-1590.641] (-1592.326) (-1593.468) -- 0:00:49
278000 -- [-1593.762] (-1590.108) (-1589.642) (-1591.454) * (-1590.521) (-1588.986) (-1591.171) [-1589.260] -- 0:00:49
278500 -- (-1591.419) [-1594.242] (-1589.634) (-1588.770) * (-1589.495) (-1590.989) [-1588.151] (-1595.208) -- 0:00:49
279000 -- [-1589.961] (-1592.294) (-1592.164) (-1591.059) * (-1589.697) (-1590.807) (-1593.749) [-1590.747] -- 0:00:49
279500 -- (-1594.369) (-1588.569) (-1595.029) [-1594.620] * (-1595.653) (-1587.797) [-1588.417] (-1590.148) -- 0:00:48
280000 -- (-1594.277) [-1588.650] (-1594.161) (-1592.825) * (-1586.999) (-1591.580) [-1589.830] (-1589.331) -- 0:00:48
Average standard deviation of split frequencies: 0.021039
280500 -- [-1590.857] (-1589.219) (-1590.714) (-1594.125) * (-1587.823) (-1588.927) (-1593.443) [-1590.929] -- 0:00:48
281000 -- (-1590.361) (-1591.158) [-1589.716] (-1599.270) * (-1588.806) [-1589.030] (-1593.441) (-1598.614) -- 0:00:48
281500 -- (-1588.139) (-1590.192) (-1587.922) [-1594.109] * (-1589.393) [-1593.713] (-1591.994) (-1592.555) -- 0:00:48
282000 -- (-1593.174) (-1589.652) [-1593.570] (-1590.498) * [-1589.723] (-1591.593) (-1590.332) (-1591.393) -- 0:00:48
282500 -- (-1593.688) [-1590.459] (-1590.265) (-1591.134) * (-1589.176) (-1587.918) (-1588.757) [-1590.154] -- 0:00:50
283000 -- (-1590.181) [-1589.820] (-1587.131) (-1589.986) * (-1589.583) (-1591.387) [-1589.144] (-1590.108) -- 0:00:50
283500 -- (-1591.200) (-1588.625) (-1592.289) [-1590.413] * (-1587.834) [-1585.533] (-1590.798) (-1590.698) -- 0:00:50
284000 -- (-1591.318) (-1591.014) [-1586.911] (-1591.859) * [-1589.813] (-1588.947) (-1588.493) (-1589.938) -- 0:00:50
284500 -- [-1590.971] (-1588.574) (-1589.309) (-1594.030) * (-1588.185) [-1588.381] (-1587.962) (-1591.308) -- 0:00:50
285000 -- (-1591.451) (-1592.534) (-1588.987) [-1591.949] * (-1587.205) [-1593.472] (-1591.734) (-1589.144) -- 0:00:50
Average standard deviation of split frequencies: 0.020733
285500 -- (-1591.502) (-1590.825) [-1590.914] (-1591.778) * (-1590.117) (-1594.380) (-1592.271) [-1591.856] -- 0:00:50
286000 -- [-1591.247] (-1590.789) (-1590.638) (-1591.485) * (-1592.339) (-1590.040) (-1592.089) [-1594.216] -- 0:00:49
286500 -- (-1592.656) (-1591.766) (-1593.900) [-1591.303] * [-1591.120] (-1590.281) (-1589.214) (-1593.820) -- 0:00:49
287000 -- [-1591.371] (-1592.106) (-1592.055) (-1595.069) * (-1591.148) (-1589.200) [-1593.064] (-1592.973) -- 0:00:49
287500 -- (-1593.999) (-1592.444) [-1591.878] (-1593.565) * (-1589.997) (-1590.109) [-1589.709] (-1590.661) -- 0:00:49
288000 -- (-1591.341) (-1593.440) [-1588.289] (-1592.008) * (-1591.216) [-1588.212] (-1587.107) (-1592.941) -- 0:00:49
288500 -- (-1587.109) [-1589.320] (-1591.822) (-1594.195) * [-1591.451] (-1586.923) (-1588.919) (-1591.771) -- 0:00:49
289000 -- [-1587.247] (-1589.918) (-1594.083) (-1593.383) * (-1589.061) (-1591.274) (-1589.903) [-1588.907] -- 0:00:49
289500 -- [-1589.023] (-1587.904) (-1590.834) (-1592.137) * (-1588.293) (-1587.945) [-1586.897] (-1592.831) -- 0:00:49
290000 -- (-1593.925) [-1592.998] (-1589.873) (-1592.680) * (-1590.163) (-1591.175) (-1589.356) [-1591.295] -- 0:00:48
Average standard deviation of split frequencies: 0.020401
290500 -- [-1587.712] (-1592.442) (-1590.386) (-1590.353) * (-1591.169) (-1589.878) (-1589.030) [-1588.931] -- 0:00:48
291000 -- (-1588.195) [-1590.949] (-1593.257) (-1590.102) * (-1595.300) (-1591.408) (-1590.685) [-1588.434] -- 0:00:48
291500 -- (-1589.149) (-1591.786) [-1587.342] (-1589.816) * [-1588.647] (-1591.752) (-1591.640) (-1590.387) -- 0:00:48
292000 -- (-1587.635) (-1594.958) [-1590.089] (-1589.168) * [-1588.471] (-1591.183) (-1591.113) (-1590.507) -- 0:00:48
292500 -- [-1589.791] (-1591.809) (-1590.484) (-1592.217) * (-1589.025) (-1590.611) [-1590.339] (-1591.471) -- 0:00:48
293000 -- [-1588.311] (-1594.472) (-1590.670) (-1591.596) * [-1590.320] (-1591.302) (-1593.026) (-1588.629) -- 0:00:48
293500 -- (-1592.908) (-1592.463) (-1592.577) [-1590.337] * [-1594.762] (-1591.102) (-1591.334) (-1587.244) -- 0:00:48
294000 -- (-1590.158) (-1595.620) (-1590.341) [-1590.264] * (-1588.439) (-1589.154) (-1589.793) [-1588.412] -- 0:00:48
294500 -- [-1588.498] (-1590.939) (-1590.457) (-1591.239) * [-1588.981] (-1591.882) (-1589.378) (-1590.112) -- 0:00:47
295000 -- (-1589.479) (-1592.088) (-1590.920) [-1589.330] * [-1590.669] (-1594.936) (-1588.704) (-1590.885) -- 0:00:47
Average standard deviation of split frequencies: 0.020704
295500 -- (-1593.352) (-1589.752) [-1590.428] (-1590.900) * (-1589.163) (-1593.794) [-1589.923] (-1589.935) -- 0:00:47
296000 -- (-1589.279) (-1589.956) [-1587.913] (-1590.643) * (-1587.954) (-1590.709) (-1592.199) [-1588.369] -- 0:00:47
296500 -- [-1586.673] (-1592.502) (-1590.946) (-1590.694) * (-1586.476) (-1591.657) (-1591.634) [-1588.075] -- 0:00:47
297000 -- (-1587.500) (-1597.738) [-1590.780] (-1592.173) * (-1587.157) (-1591.742) (-1595.200) [-1587.207] -- 0:00:49
297500 -- (-1587.187) (-1589.768) [-1590.594] (-1590.574) * (-1593.265) (-1588.004) [-1588.150] (-1595.086) -- 0:00:49
298000 -- [-1590.773] (-1592.408) (-1590.910) (-1590.343) * (-1590.332) (-1589.977) (-1591.221) [-1588.792] -- 0:00:49
298500 -- [-1588.936] (-1592.312) (-1591.347) (-1589.247) * (-1588.691) (-1596.283) (-1591.173) [-1589.368] -- 0:00:49
299000 -- [-1594.382] (-1593.246) (-1591.255) (-1588.851) * [-1590.123] (-1590.551) (-1589.786) (-1588.620) -- 0:00:49
299500 -- (-1591.529) [-1589.564] (-1591.573) (-1590.290) * (-1592.730) (-1589.250) [-1590.630] (-1587.201) -- 0:00:49
300000 -- (-1593.753) [-1587.793] (-1591.245) (-1591.040) * (-1592.697) [-1588.114] (-1590.452) (-1589.357) -- 0:00:48
Average standard deviation of split frequencies: 0.020295
300500 -- (-1591.920) (-1589.590) (-1587.277) [-1591.097] * (-1591.022) (-1590.184) (-1587.731) [-1589.659] -- 0:00:48
301000 -- [-1592.520] (-1587.206) (-1587.817) (-1591.234) * (-1591.727) (-1589.873) (-1590.579) [-1589.423] -- 0:00:48
301500 -- (-1591.578) [-1588.708] (-1589.713) (-1589.537) * (-1590.150) (-1590.424) (-1592.113) [-1589.675] -- 0:00:48
302000 -- (-1591.371) [-1587.116] (-1589.690) (-1590.682) * (-1589.415) [-1591.288] (-1594.533) (-1591.709) -- 0:00:48
302500 -- (-1591.418) (-1590.028) [-1588.706] (-1592.042) * (-1593.445) (-1587.995) [-1591.636] (-1591.627) -- 0:00:48
303000 -- (-1594.198) (-1589.997) [-1587.856] (-1592.385) * (-1590.242) (-1588.721) (-1591.495) [-1590.320] -- 0:00:48
303500 -- (-1590.764) (-1587.994) [-1589.999] (-1592.597) * (-1587.823) (-1586.880) (-1595.709) [-1592.264] -- 0:00:48
304000 -- [-1591.207] (-1593.775) (-1589.349) (-1591.879) * [-1588.129] (-1590.189) (-1591.775) (-1590.279) -- 0:00:48
304500 -- [-1589.551] (-1594.453) (-1589.187) (-1591.218) * (-1590.472) (-1590.966) (-1588.656) [-1587.689] -- 0:00:47
305000 -- [-1591.204] (-1593.356) (-1589.729) (-1591.500) * (-1590.421) [-1590.797] (-1589.506) (-1589.111) -- 0:00:47
Average standard deviation of split frequencies: 0.019796
305500 -- [-1592.603] (-1592.082) (-1586.660) (-1594.127) * [-1589.787] (-1587.772) (-1588.600) (-1590.246) -- 0:00:47
306000 -- [-1587.486] (-1591.439) (-1588.553) (-1588.483) * [-1593.216] (-1593.086) (-1592.623) (-1589.479) -- 0:00:47
306500 -- [-1589.525] (-1592.065) (-1591.377) (-1591.677) * (-1592.021) (-1590.562) (-1590.612) [-1590.793] -- 0:00:47
307000 -- (-1588.912) (-1589.441) [-1592.845] (-1592.023) * (-1592.810) [-1590.355] (-1588.677) (-1593.566) -- 0:00:47
307500 -- (-1589.856) (-1589.079) (-1590.025) [-1590.162] * (-1591.394) (-1588.540) (-1587.912) [-1589.428] -- 0:00:47
308000 -- (-1590.247) [-1588.395] (-1588.102) (-1588.355) * (-1589.673) [-1589.035] (-1588.098) (-1593.038) -- 0:00:47
308500 -- (-1591.792) (-1589.064) (-1587.761) [-1589.604] * (-1589.412) (-1590.128) (-1590.583) [-1586.978] -- 0:00:47
309000 -- (-1590.412) (-1588.510) [-1587.466] (-1589.452) * (-1588.296) [-1589.129] (-1590.748) (-1589.693) -- 0:00:46
309500 -- (-1589.175) (-1591.211) (-1588.063) [-1592.695] * (-1587.564) (-1589.465) [-1587.262] (-1588.709) -- 0:00:46
310000 -- (-1590.488) [-1590.468] (-1587.510) (-1591.478) * (-1586.858) [-1596.406] (-1587.384) (-1595.407) -- 0:00:46
Average standard deviation of split frequencies: 0.019043
310500 -- (-1590.091) (-1587.669) (-1588.658) [-1589.112] * (-1591.507) (-1589.747) [-1589.077] (-1590.444) -- 0:00:46
311000 -- (-1589.940) (-1592.574) (-1589.415) [-1586.960] * (-1592.090) (-1592.849) (-1590.894) [-1588.324] -- 0:00:46
311500 -- (-1592.569) (-1592.045) (-1589.946) [-1590.189] * [-1591.747] (-1592.402) (-1592.502) (-1590.354) -- 0:00:46
312000 -- (-1591.351) (-1589.181) [-1590.819] (-1589.688) * (-1592.175) (-1592.819) [-1591.209] (-1590.156) -- 0:00:48
312500 -- (-1591.260) (-1591.341) [-1590.830] (-1590.443) * (-1588.887) (-1591.089) [-1589.637] (-1590.638) -- 0:00:48
313000 -- (-1589.810) (-1595.479) [-1591.552] (-1589.852) * (-1590.471) (-1593.410) (-1594.344) [-1592.591] -- 0:00:48
313500 -- (-1591.229) (-1590.381) (-1590.990) [-1590.460] * (-1591.328) (-1592.855) [-1589.433] (-1591.451) -- 0:00:48
314000 -- (-1593.276) [-1590.163] (-1590.623) (-1591.493) * [-1589.258] (-1591.503) (-1591.021) (-1591.807) -- 0:00:48
314500 -- (-1591.820) (-1591.250) (-1589.210) [-1590.912] * (-1589.304) [-1588.749] (-1586.901) (-1588.170) -- 0:00:47
315000 -- [-1592.118] (-1591.191) (-1590.286) (-1590.034) * (-1591.284) (-1592.577) [-1589.362] (-1588.412) -- 0:00:47
Average standard deviation of split frequencies: 0.020288
315500 -- (-1593.095) [-1587.303] (-1592.160) (-1588.221) * (-1591.312) (-1591.346) (-1588.688) [-1590.945] -- 0:00:47
316000 -- (-1590.265) [-1589.206] (-1592.093) (-1588.639) * [-1589.545] (-1589.547) (-1593.211) (-1589.988) -- 0:00:47
316500 -- [-1590.560] (-1591.257) (-1593.179) (-1588.898) * [-1593.366] (-1592.995) (-1590.098) (-1589.214) -- 0:00:47
317000 -- (-1588.763) (-1592.302) [-1591.864] (-1587.967) * (-1591.358) (-1589.570) [-1590.312] (-1591.614) -- 0:00:47
317500 -- [-1590.463] (-1589.367) (-1588.407) (-1589.038) * (-1590.822) (-1589.039) [-1588.318] (-1589.511) -- 0:00:47
318000 -- (-1589.915) (-1588.068) (-1589.494) [-1589.175] * (-1590.682) [-1587.681] (-1590.082) (-1591.622) -- 0:00:47
318500 -- (-1590.856) [-1589.912] (-1592.369) (-1592.109) * (-1589.164) [-1593.324] (-1586.449) (-1591.570) -- 0:00:47
319000 -- [-1590.883] (-1589.221) (-1591.670) (-1593.249) * (-1591.489) [-1589.821] (-1587.111) (-1590.479) -- 0:00:46
319500 -- [-1590.169] (-1587.258) (-1589.279) (-1587.880) * [-1596.247] (-1591.498) (-1589.737) (-1590.599) -- 0:00:46
320000 -- [-1589.427] (-1589.192) (-1588.863) (-1590.217) * (-1592.909) [-1589.593] (-1586.194) (-1591.435) -- 0:00:46
Average standard deviation of split frequencies: 0.020826
320500 -- (-1591.265) [-1589.320] (-1589.911) (-1589.681) * (-1591.794) (-1589.545) [-1587.751] (-1594.171) -- 0:00:46
321000 -- [-1588.830] (-1590.140) (-1589.157) (-1590.095) * (-1592.700) [-1589.253] (-1590.680) (-1595.592) -- 0:00:46
321500 -- [-1590.899] (-1589.137) (-1588.700) (-1589.873) * (-1590.601) (-1589.021) [-1588.763] (-1590.905) -- 0:00:46
322000 -- (-1590.461) (-1587.341) (-1589.324) [-1590.329] * (-1589.677) (-1589.079) [-1587.375] (-1592.985) -- 0:00:46
322500 -- (-1590.080) (-1594.529) (-1590.680) [-1587.826] * (-1588.048) [-1589.782] (-1587.426) (-1590.406) -- 0:00:46
323000 -- (-1590.027) [-1589.855] (-1590.818) (-1587.247) * (-1590.510) (-1589.003) [-1595.867] (-1589.465) -- 0:00:46
323500 -- (-1590.866) [-1590.786] (-1591.128) (-1589.147) * [-1588.698] (-1590.893) (-1589.373) (-1597.795) -- 0:00:46
324000 -- (-1593.410) [-1589.244] (-1592.813) (-1590.072) * (-1587.715) (-1593.928) [-1590.551] (-1592.413) -- 0:00:45
324500 -- (-1590.368) (-1593.376) (-1588.738) [-1591.504] * (-1592.757) (-1590.121) [-1588.494] (-1591.885) -- 0:00:45
325000 -- (-1589.550) [-1587.824] (-1591.403) (-1592.200) * (-1591.087) (-1591.468) (-1589.233) [-1589.969] -- 0:00:45
Average standard deviation of split frequencies: 0.021005
325500 -- (-1587.685) (-1590.708) (-1591.597) [-1590.505] * (-1588.025) (-1595.721) [-1587.494] (-1591.917) -- 0:00:45
326000 -- (-1590.265) [-1590.297] (-1590.979) (-1590.709) * (-1588.692) (-1598.898) [-1589.758] (-1593.344) -- 0:00:45
326500 -- [-1590.170] (-1588.169) (-1591.837) (-1590.605) * [-1588.102] (-1591.254) (-1590.389) (-1593.471) -- 0:00:47
327000 -- (-1588.741) (-1588.537) (-1587.849) [-1591.578] * (-1588.856) [-1589.814] (-1586.499) (-1588.295) -- 0:00:47
327500 -- [-1593.081] (-1589.284) (-1587.888) (-1591.542) * (-1588.414) (-1592.411) [-1586.950] (-1588.853) -- 0:00:47
328000 -- [-1590.202] (-1590.539) (-1588.500) (-1593.437) * (-1591.331) (-1590.630) [-1588.310] (-1593.354) -- 0:00:47
328500 -- (-1592.473) (-1589.246) [-1588.036] (-1591.262) * (-1591.879) [-1589.607] (-1587.457) (-1589.254) -- 0:00:47
329000 -- (-1589.457) (-1590.989) [-1590.376] (-1593.029) * (-1591.096) [-1592.023] (-1592.513) (-1592.021) -- 0:00:46
329500 -- (-1590.781) [-1589.933] (-1587.789) (-1590.556) * (-1592.014) [-1593.469] (-1590.694) (-1591.889) -- 0:00:46
330000 -- (-1587.918) [-1590.151] (-1587.460) (-1593.759) * [-1591.849] (-1593.040) (-1591.242) (-1593.376) -- 0:00:46
Average standard deviation of split frequencies: 0.019325
330500 -- [-1588.607] (-1591.056) (-1589.435) (-1591.562) * [-1591.190] (-1587.569) (-1593.367) (-1589.296) -- 0:00:46
331000 -- (-1589.797) (-1596.109) [-1590.503] (-1593.176) * (-1589.938) (-1591.571) (-1587.199) [-1590.283] -- 0:00:46
331500 -- (-1588.124) [-1592.786] (-1590.074) (-1591.587) * (-1589.740) (-1589.811) (-1589.272) [-1590.592] -- 0:00:46
332000 -- (-1591.420) (-1594.430) (-1593.332) [-1592.871] * (-1588.501) (-1590.109) (-1590.084) [-1590.830] -- 0:00:46
332500 -- (-1589.016) (-1591.035) [-1590.964] (-1592.992) * (-1589.865) (-1591.421) (-1592.104) [-1590.652] -- 0:00:46
333000 -- [-1592.283] (-1592.231) (-1592.073) (-1594.599) * [-1591.109] (-1593.868) (-1589.708) (-1593.797) -- 0:00:46
333500 -- (-1592.276) (-1591.254) (-1592.030) [-1588.523] * [-1591.779] (-1591.683) (-1589.778) (-1592.233) -- 0:00:45
334000 -- (-1594.277) (-1591.662) [-1592.131] (-1593.232) * (-1594.160) (-1588.467) [-1588.792] (-1589.151) -- 0:00:45
334500 -- [-1592.427] (-1591.861) (-1591.082) (-1592.035) * [-1589.692] (-1592.369) (-1591.845) (-1588.453) -- 0:00:45
335000 -- [-1588.747] (-1588.916) (-1592.910) (-1589.890) * [-1588.782] (-1591.737) (-1588.991) (-1588.168) -- 0:00:45
Average standard deviation of split frequencies: 0.019096
335500 -- (-1591.129) (-1589.247) (-1589.815) [-1589.787] * (-1589.844) (-1591.944) (-1589.342) [-1587.114] -- 0:00:45
336000 -- [-1589.229] (-1590.376) (-1589.330) (-1588.084) * (-1592.771) (-1588.904) (-1597.606) [-1588.272] -- 0:00:45
336500 -- (-1591.076) (-1589.846) [-1593.153] (-1591.672) * [-1590.519] (-1589.789) (-1596.250) (-1590.004) -- 0:00:45
337000 -- [-1589.440] (-1591.687) (-1592.249) (-1589.666) * (-1593.565) (-1593.412) [-1594.843] (-1590.172) -- 0:00:45
337500 -- [-1592.303] (-1591.334) (-1590.321) (-1591.846) * (-1591.189) (-1590.480) [-1589.384] (-1588.653) -- 0:00:45
338000 -- (-1586.455) (-1589.782) [-1590.866] (-1589.354) * (-1594.398) [-1590.477] (-1589.450) (-1593.311) -- 0:00:45
338500 -- [-1589.252] (-1588.846) (-1592.839) (-1588.522) * (-1588.774) [-1592.176] (-1590.093) (-1590.907) -- 0:00:44
339000 -- (-1592.115) (-1595.060) (-1588.799) [-1588.934] * [-1588.642] (-1594.597) (-1589.074) (-1589.002) -- 0:00:44
339500 -- [-1587.439] (-1593.536) (-1592.150) (-1592.177) * (-1589.474) [-1594.188] (-1591.798) (-1589.506) -- 0:00:44
340000 -- (-1589.179) (-1590.817) (-1594.393) [-1591.436] * (-1590.358) (-1590.639) (-1587.683) [-1587.576] -- 0:00:44
Average standard deviation of split frequencies: 0.019219
340500 -- [-1597.031] (-1591.534) (-1591.501) (-1591.533) * (-1588.941) (-1588.605) [-1589.178] (-1591.890) -- 0:00:44
341000 -- (-1593.334) (-1592.117) (-1590.923) [-1594.188] * (-1591.312) (-1591.440) [-1596.163] (-1589.263) -- 0:00:44
341500 -- (-1589.620) [-1588.533] (-1589.344) (-1590.995) * (-1590.601) (-1588.297) [-1592.110] (-1592.873) -- 0:00:46
342000 -- (-1590.006) [-1590.553] (-1591.160) (-1590.719) * (-1593.031) (-1592.033) (-1595.307) [-1591.385] -- 0:00:46
342500 -- (-1590.364) (-1590.837) [-1593.111] (-1590.730) * (-1589.498) [-1587.202] (-1593.288) (-1591.628) -- 0:00:46
343000 -- (-1587.347) (-1589.397) (-1596.008) [-1588.614] * (-1590.828) [-1586.950] (-1591.650) (-1591.332) -- 0:00:45
343500 -- (-1594.145) (-1589.702) (-1591.431) [-1590.095] * (-1590.366) (-1589.956) [-1590.767] (-1592.125) -- 0:00:45
344000 -- (-1590.318) [-1588.938] (-1591.215) (-1592.157) * (-1590.814) (-1593.607) [-1587.760] (-1591.015) -- 0:00:45
344500 -- (-1594.500) (-1588.904) (-1588.616) [-1587.502] * (-1589.464) (-1593.073) [-1590.275] (-1591.717) -- 0:00:45
345000 -- (-1589.744) (-1591.896) (-1591.088) [-1590.454] * (-1594.306) (-1591.123) (-1593.000) [-1589.155] -- 0:00:45
Average standard deviation of split frequencies: 0.018787
345500 -- (-1590.519) [-1591.492] (-1590.367) (-1594.997) * (-1590.945) (-1590.510) (-1589.692) [-1588.741] -- 0:00:45
346000 -- (-1594.283) [-1590.360] (-1592.389) (-1592.181) * [-1588.456] (-1592.188) (-1592.225) (-1586.569) -- 0:00:45
346500 -- (-1591.525) (-1594.517) (-1593.659) [-1589.124] * (-1588.038) (-1595.199) (-1589.649) [-1589.868] -- 0:00:45
347000 -- (-1590.898) (-1588.839) (-1592.221) [-1590.657] * (-1591.213) (-1588.856) (-1590.924) [-1589.851] -- 0:00:45
347500 -- (-1596.860) (-1591.514) (-1591.115) [-1590.180] * (-1594.091) (-1593.284) [-1593.205] (-1589.508) -- 0:00:45
348000 -- (-1589.262) (-1590.783) (-1591.013) [-1588.755] * [-1588.743] (-1593.769) (-1588.342) (-1589.084) -- 0:00:44
348500 -- (-1590.114) (-1593.812) [-1589.861] (-1587.851) * [-1590.434] (-1589.065) (-1588.795) (-1591.342) -- 0:00:44
349000 -- (-1590.212) (-1591.984) [-1588.656] (-1591.639) * (-1590.105) (-1595.717) [-1597.141] (-1588.253) -- 0:00:44
349500 -- [-1592.114] (-1590.583) (-1589.463) (-1588.917) * (-1590.426) (-1592.704) [-1589.065] (-1589.947) -- 0:00:44
350000 -- (-1591.971) (-1595.155) (-1592.793) [-1591.412] * (-1591.149) [-1588.040] (-1589.932) (-1593.701) -- 0:00:44
Average standard deviation of split frequencies: 0.019418
350500 -- (-1592.238) (-1593.518) (-1592.936) [-1591.154] * (-1590.697) (-1590.042) (-1589.433) [-1587.842] -- 0:00:44
351000 -- (-1595.326) [-1591.778] (-1592.809) (-1591.138) * (-1592.122) [-1589.095] (-1590.402) (-1591.441) -- 0:00:44
351500 -- (-1594.108) (-1588.023) [-1593.021] (-1592.150) * [-1586.955] (-1590.482) (-1591.376) (-1592.118) -- 0:00:44
352000 -- (-1595.786) (-1591.443) [-1588.458] (-1591.844) * (-1591.903) [-1589.725] (-1589.402) (-1593.608) -- 0:00:44
352500 -- (-1596.227) [-1592.956] (-1586.898) (-1590.578) * (-1592.880) [-1591.995] (-1590.681) (-1593.055) -- 0:00:44
353000 -- (-1593.955) [-1588.188] (-1590.755) (-1593.179) * (-1593.252) [-1590.576] (-1591.677) (-1593.146) -- 0:00:43
353500 -- (-1590.460) (-1590.212) [-1591.032] (-1591.538) * (-1589.983) [-1590.095] (-1589.318) (-1590.359) -- 0:00:43
354000 -- (-1590.428) (-1591.054) [-1591.707] (-1591.623) * (-1592.117) [-1588.655] (-1590.574) (-1592.993) -- 0:00:43
354500 -- [-1588.867] (-1590.454) (-1587.666) (-1591.394) * [-1589.656] (-1588.897) (-1590.813) (-1590.424) -- 0:00:43
355000 -- (-1588.373) (-1597.323) (-1591.412) [-1589.326] * (-1591.408) (-1588.850) (-1590.932) [-1590.188] -- 0:00:43
Average standard deviation of split frequencies: 0.019127
355500 -- (-1590.664) (-1589.922) [-1593.833] (-1596.436) * (-1594.425) (-1589.433) [-1592.004] (-1590.498) -- 0:00:43
356000 -- [-1591.043] (-1589.155) (-1592.248) (-1591.475) * (-1593.855) (-1589.250) (-1591.649) [-1592.759] -- 0:00:43
356500 -- (-1589.612) [-1588.517] (-1593.586) (-1592.503) * [-1591.231] (-1591.350) (-1592.996) (-1591.976) -- 0:00:45
357000 -- (-1592.799) [-1591.607] (-1588.106) (-1593.020) * (-1592.263) [-1592.156] (-1588.129) (-1586.669) -- 0:00:45
357500 -- (-1590.124) [-1591.717] (-1590.323) (-1592.355) * (-1597.369) (-1590.315) [-1589.108] (-1594.151) -- 0:00:44
358000 -- (-1588.746) (-1589.368) (-1590.925) [-1589.924] * (-1590.041) (-1590.085) (-1587.308) [-1591.072] -- 0:00:44
358500 -- (-1587.289) [-1592.032] (-1592.358) (-1591.389) * (-1591.457) (-1589.544) (-1590.430) [-1590.101] -- 0:00:44
359000 -- (-1588.742) (-1593.518) [-1592.360] (-1591.210) * (-1595.767) [-1590.707] (-1591.102) (-1590.788) -- 0:00:44
359500 -- (-1589.267) (-1592.313) [-1595.697] (-1593.243) * (-1592.901) (-1590.772) [-1593.116] (-1589.631) -- 0:00:44
360000 -- (-1591.264) [-1591.382] (-1592.242) (-1592.981) * (-1593.188) (-1590.465) [-1590.561] (-1591.858) -- 0:00:44
Average standard deviation of split frequencies: 0.019315
360500 -- (-1589.798) (-1591.348) (-1592.135) [-1593.726] * [-1594.742] (-1592.847) (-1589.877) (-1591.828) -- 0:00:44
361000 -- [-1588.908] (-1591.463) (-1588.672) (-1588.165) * (-1594.764) (-1590.625) [-1589.346] (-1591.150) -- 0:00:44
361500 -- [-1588.960] (-1592.383) (-1590.815) (-1595.133) * (-1590.381) [-1588.318] (-1589.297) (-1591.057) -- 0:00:44
362000 -- [-1592.583] (-1592.317) (-1588.264) (-1591.904) * (-1588.556) (-1588.833) (-1591.747) [-1589.460] -- 0:00:44
362500 -- (-1596.722) (-1590.988) [-1590.484] (-1593.132) * (-1590.162) [-1589.280] (-1593.566) (-1588.777) -- 0:00:43
363000 -- (-1587.437) (-1590.415) (-1593.307) [-1593.872] * [-1591.729] (-1592.144) (-1591.474) (-1587.847) -- 0:00:43
363500 -- (-1591.207) (-1590.029) (-1590.264) [-1593.578] * [-1591.724] (-1594.114) (-1591.240) (-1588.608) -- 0:00:43
364000 -- [-1593.118] (-1590.251) (-1588.841) (-1593.304) * (-1590.565) [-1589.973] (-1589.962) (-1591.384) -- 0:00:43
364500 -- (-1587.571) (-1591.841) (-1592.819) [-1593.066] * (-1591.030) (-1586.796) [-1588.514] (-1591.425) -- 0:00:43
365000 -- (-1588.198) [-1591.251] (-1593.891) (-1593.188) * (-1591.485) [-1587.758] (-1590.627) (-1590.238) -- 0:00:43
Average standard deviation of split frequencies: 0.019177
365500 -- (-1588.594) [-1589.806] (-1594.226) (-1591.354) * [-1590.579] (-1591.068) (-1590.631) (-1592.606) -- 0:00:43
366000 -- (-1589.918) (-1587.095) [-1592.760] (-1591.049) * (-1592.684) (-1591.014) [-1589.942] (-1589.935) -- 0:00:43
366500 -- (-1588.601) (-1590.764) [-1591.703] (-1590.294) * (-1596.465) (-1589.056) [-1590.669] (-1588.837) -- 0:00:43
367000 -- [-1592.594] (-1589.891) (-1596.836) (-1593.978) * (-1596.842) (-1592.355) (-1589.139) [-1588.587] -- 0:00:43
367500 -- (-1587.548) [-1591.177] (-1590.307) (-1591.251) * (-1598.562) (-1588.722) (-1589.882) [-1590.179] -- 0:00:43
368000 -- (-1591.905) (-1591.779) [-1592.431] (-1591.690) * (-1589.541) (-1589.595) [-1590.375] (-1588.168) -- 0:00:42
368500 -- (-1589.643) (-1589.846) (-1592.781) [-1591.931] * (-1589.850) [-1591.439] (-1593.456) (-1590.143) -- 0:00:42
369000 -- (-1589.916) [-1589.327] (-1587.793) (-1591.281) * (-1592.874) (-1594.345) (-1588.920) [-1590.429] -- 0:00:42
369500 -- (-1592.114) (-1591.239) [-1590.046] (-1588.788) * (-1591.519) (-1590.201) [-1589.915] (-1592.900) -- 0:00:42
370000 -- (-1587.869) (-1591.473) (-1588.065) [-1591.936] * (-1591.949) (-1592.990) [-1588.429] (-1591.143) -- 0:00:42
Average standard deviation of split frequencies: 0.018158
370500 -- [-1587.888] (-1588.836) (-1588.949) (-1595.145) * (-1591.531) [-1591.041] (-1591.448) (-1588.817) -- 0:00:42
371000 -- [-1588.560] (-1589.184) (-1588.644) (-1590.876) * (-1591.777) (-1593.465) (-1592.792) [-1590.652] -- 0:00:44
371500 -- (-1587.605) (-1589.555) (-1588.188) [-1593.152] * (-1588.473) [-1587.913] (-1594.684) (-1590.868) -- 0:00:43
372000 -- (-1590.597) (-1588.755) [-1588.573] (-1590.228) * [-1587.446] (-1591.984) (-1590.673) (-1590.754) -- 0:00:43
372500 -- (-1591.404) [-1588.617] (-1589.130) (-1590.369) * [-1588.473] (-1590.962) (-1591.092) (-1589.740) -- 0:00:43
373000 -- (-1590.381) [-1590.860] (-1587.506) (-1590.670) * (-1589.025) (-1591.435) (-1590.652) [-1589.241] -- 0:00:43
373500 -- (-1588.480) (-1589.911) [-1592.220] (-1588.564) * (-1593.072) [-1588.527] (-1591.785) (-1589.868) -- 0:00:43
374000 -- (-1597.707) (-1589.335) (-1595.397) [-1594.893] * (-1593.871) (-1589.708) [-1588.346] (-1597.133) -- 0:00:43
374500 -- (-1591.909) [-1589.723] (-1591.102) (-1590.777) * (-1589.882) [-1588.677] (-1591.109) (-1588.174) -- 0:00:43
375000 -- (-1589.364) (-1590.472) (-1590.752) [-1591.367] * (-1590.648) (-1590.658) (-1593.006) [-1589.222] -- 0:00:43
Average standard deviation of split frequencies: 0.019363
375500 -- (-1590.680) (-1591.581) (-1590.070) [-1593.896] * (-1589.992) (-1589.178) [-1590.070] (-1589.405) -- 0:00:43
376000 -- [-1588.063] (-1591.303) (-1590.322) (-1592.359) * (-1588.373) (-1589.502) (-1593.037) [-1591.817] -- 0:00:43
376500 -- (-1592.440) (-1592.114) [-1590.345] (-1590.176) * (-1590.789) [-1588.294] (-1591.554) (-1589.603) -- 0:00:43
377000 -- (-1592.705) [-1591.036] (-1591.851) (-1590.441) * (-1590.892) [-1592.055] (-1591.512) (-1590.254) -- 0:00:42
377500 -- [-1591.636] (-1592.011) (-1592.321) (-1590.948) * (-1588.439) (-1592.255) (-1593.813) [-1589.001] -- 0:00:42
378000 -- [-1589.399] (-1590.511) (-1595.008) (-1591.482) * (-1591.045) (-1590.352) [-1589.378] (-1594.027) -- 0:00:42
378500 -- [-1591.383] (-1591.634) (-1592.980) (-1593.150) * [-1594.456] (-1593.087) (-1594.471) (-1594.437) -- 0:00:42
379000 -- [-1590.061] (-1589.656) (-1591.274) (-1591.257) * (-1589.375) (-1590.788) [-1594.147] (-1590.273) -- 0:00:42
379500 -- [-1590.972] (-1587.235) (-1591.299) (-1591.533) * [-1592.815] (-1591.791) (-1594.864) (-1596.771) -- 0:00:42
380000 -- (-1591.923) (-1591.280) [-1590.535] (-1587.171) * (-1592.364) (-1590.982) (-1593.948) [-1592.868] -- 0:00:42
Average standard deviation of split frequencies: 0.020295
380500 -- [-1587.776] (-1590.816) (-1590.035) (-1588.141) * (-1591.731) (-1589.561) [-1595.753] (-1593.248) -- 0:00:42
381000 -- [-1587.995] (-1591.487) (-1591.064) (-1586.962) * (-1591.533) (-1589.460) (-1589.343) [-1589.026] -- 0:00:42
381500 -- (-1592.341) [-1592.210] (-1590.204) (-1587.899) * (-1590.642) (-1590.932) [-1590.747] (-1590.062) -- 0:00:42
382000 -- (-1593.019) (-1592.289) (-1589.147) [-1591.101] * (-1590.692) (-1590.791) (-1590.595) [-1594.065] -- 0:00:42
382500 -- [-1588.682] (-1591.410) (-1592.488) (-1589.850) * (-1592.821) (-1589.661) [-1590.456] (-1590.148) -- 0:00:41
383000 -- (-1590.849) (-1590.061) (-1589.342) [-1585.847] * (-1590.620) (-1588.212) [-1590.414] (-1594.319) -- 0:00:41
383500 -- (-1588.801) (-1590.851) (-1596.277) [-1588.912] * (-1595.704) (-1592.036) [-1590.095] (-1588.598) -- 0:00:41
384000 -- (-1586.437) (-1590.698) (-1593.037) [-1587.851] * (-1595.010) (-1589.772) [-1591.804] (-1588.967) -- 0:00:41
384500 -- [-1587.985] (-1588.335) (-1591.524) (-1589.275) * [-1590.963] (-1591.933) (-1590.848) (-1587.784) -- 0:00:41
385000 -- (-1589.321) [-1588.033] (-1591.802) (-1586.480) * [-1590.621] (-1591.565) (-1589.151) (-1591.435) -- 0:00:41
Average standard deviation of split frequencies: 0.019472
385500 -- [-1588.210] (-1592.680) (-1591.725) (-1586.853) * (-1590.582) [-1587.861] (-1589.999) (-1591.946) -- 0:00:41
386000 -- [-1589.251] (-1590.297) (-1595.571) (-1589.072) * (-1589.272) [-1588.476] (-1593.248) (-1595.879) -- 0:00:42
386500 -- [-1587.703] (-1594.998) (-1592.579) (-1588.291) * (-1589.782) (-1589.962) [-1590.452] (-1591.428) -- 0:00:42
387000 -- (-1588.271) (-1592.345) (-1593.470) [-1589.371] * (-1590.213) [-1589.085] (-1588.287) (-1596.534) -- 0:00:42
387500 -- (-1588.394) [-1587.986] (-1589.335) (-1588.880) * (-1592.081) [-1590.218] (-1591.949) (-1592.294) -- 0:00:42
388000 -- (-1588.245) (-1588.865) [-1591.814] (-1589.336) * [-1594.438] (-1590.568) (-1592.342) (-1595.447) -- 0:00:42
388500 -- (-1589.863) (-1590.708) [-1590.320] (-1589.195) * (-1589.558) [-1589.731] (-1591.476) (-1592.303) -- 0:00:42
389000 -- (-1588.426) [-1589.062] (-1594.321) (-1590.080) * [-1587.707] (-1590.508) (-1590.721) (-1592.941) -- 0:00:42
389500 -- (-1588.662) (-1590.952) [-1594.237] (-1591.142) * [-1591.622] (-1588.874) (-1590.727) (-1588.483) -- 0:00:42
390000 -- (-1590.537) (-1589.906) (-1589.534) [-1590.044] * (-1592.691) [-1587.987] (-1589.476) (-1592.195) -- 0:00:42
Average standard deviation of split frequencies: 0.020513
390500 -- (-1588.254) (-1589.935) (-1593.845) [-1588.150] * (-1595.756) [-1587.834] (-1590.138) (-1587.682) -- 0:00:42
391000 -- (-1588.192) (-1593.868) (-1591.823) [-1589.173] * (-1594.818) (-1594.296) (-1590.652) [-1590.191] -- 0:00:42
391500 -- [-1588.510] (-1589.970) (-1590.986) (-1592.083) * (-1591.278) [-1590.973] (-1591.496) (-1587.850) -- 0:00:41
392000 -- [-1588.752] (-1587.702) (-1592.642) (-1590.303) * [-1594.409] (-1591.687) (-1589.288) (-1589.289) -- 0:00:41
392500 -- (-1586.683) (-1588.722) (-1590.989) [-1587.419] * (-1593.097) (-1595.439) (-1594.251) [-1589.246] -- 0:00:41
393000 -- (-1589.082) (-1587.738) (-1592.934) [-1588.347] * (-1588.429) (-1589.290) (-1591.567) [-1589.487] -- 0:00:41
393500 -- [-1591.863] (-1588.686) (-1590.314) (-1591.627) * [-1589.981] (-1590.551) (-1592.019) (-1589.458) -- 0:00:41
394000 -- [-1588.874] (-1589.827) (-1592.494) (-1591.914) * (-1589.295) (-1589.150) (-1590.006) [-1588.084] -- 0:00:41
394500 -- (-1591.072) (-1589.657) (-1590.627) [-1590.127] * [-1589.872] (-1588.857) (-1589.350) (-1588.566) -- 0:00:41
395000 -- (-1592.468) (-1594.451) (-1590.928) [-1586.217] * (-1589.677) (-1587.449) [-1586.584] (-1589.929) -- 0:00:41
Average standard deviation of split frequencies: 0.019397
395500 -- (-1591.313) (-1589.295) [-1588.476] (-1590.878) * (-1590.362) (-1590.602) [-1590.819] (-1588.585) -- 0:00:41
396000 -- (-1591.167) (-1590.969) (-1594.906) [-1586.505] * (-1588.071) (-1588.965) [-1590.831] (-1589.117) -- 0:00:41
396500 -- (-1587.846) [-1591.853] (-1588.322) (-1589.550) * (-1590.859) (-1592.218) [-1588.736] (-1588.767) -- 0:00:41
397000 -- [-1587.488] (-1590.752) (-1592.336) (-1589.121) * (-1588.151) (-1595.123) [-1590.938] (-1586.956) -- 0:00:41
397500 -- (-1590.313) (-1590.952) (-1590.561) [-1588.996] * (-1591.674) (-1590.742) (-1591.270) [-1588.049] -- 0:00:40
398000 -- (-1593.528) (-1588.591) [-1588.016] (-1589.808) * (-1588.607) (-1590.972) (-1590.976) [-1591.404] -- 0:00:40
398500 -- [-1586.788] (-1590.469) (-1590.739) (-1587.480) * (-1587.653) [-1587.397] (-1590.444) (-1591.724) -- 0:00:40
399000 -- (-1589.101) (-1589.282) (-1589.501) [-1587.024] * (-1588.063) (-1590.230) [-1588.606] (-1597.151) -- 0:00:40
399500 -- (-1588.921) (-1588.994) (-1590.662) [-1586.824] * (-1588.358) (-1590.753) [-1589.557] (-1588.270) -- 0:00:40
400000 -- (-1590.138) (-1591.025) [-1589.293] (-1591.491) * [-1590.337] (-1588.337) (-1589.499) (-1588.746) -- 0:00:40
Average standard deviation of split frequencies: 0.020278
400500 -- [-1589.587] (-1589.321) (-1593.557) (-1588.605) * (-1590.011) [-1590.007] (-1591.595) (-1588.662) -- 0:00:41
401000 -- (-1590.135) (-1591.406) (-1591.357) [-1591.750] * [-1592.038] (-1592.659) (-1587.554) (-1588.843) -- 0:00:41
401500 -- (-1592.361) [-1591.027] (-1590.462) (-1590.922) * [-1590.247] (-1593.236) (-1589.956) (-1590.030) -- 0:00:41
402000 -- [-1586.672] (-1589.842) (-1590.216) (-1593.690) * [-1589.246] (-1590.183) (-1589.708) (-1588.347) -- 0:00:41
402500 -- [-1587.512] (-1588.836) (-1591.106) (-1589.152) * (-1589.250) (-1591.737) (-1590.218) [-1589.033] -- 0:00:41
403000 -- [-1591.008] (-1587.860) (-1593.425) (-1590.649) * (-1593.360) (-1593.336) (-1592.299) [-1590.394] -- 0:00:41
403500 -- (-1588.247) (-1593.040) (-1590.801) [-1589.429] * (-1590.964) (-1591.139) [-1590.266] (-1587.275) -- 0:00:41
404000 -- (-1591.456) (-1587.524) (-1591.151) [-1593.298] * (-1589.926) (-1595.724) (-1590.097) [-1589.312] -- 0:00:41
404500 -- (-1591.497) (-1590.503) (-1588.520) [-1589.841] * (-1590.261) [-1591.238] (-1592.384) (-1590.354) -- 0:00:41
405000 -- [-1589.092] (-1590.500) (-1587.699) (-1589.429) * (-1592.661) [-1591.619] (-1592.100) (-1590.454) -- 0:00:41
Average standard deviation of split frequencies: 0.020627
405500 -- [-1592.983] (-1591.646) (-1591.115) (-1590.161) * (-1589.558) [-1589.770] (-1589.721) (-1587.132) -- 0:00:41
406000 -- (-1586.971) (-1591.310) (-1590.839) [-1589.444] * [-1588.938] (-1589.998) (-1595.341) (-1590.819) -- 0:00:40
406500 -- [-1587.693] (-1589.801) (-1591.636) (-1591.934) * (-1592.869) (-1591.620) [-1589.036] (-1591.894) -- 0:00:40
407000 -- [-1590.684] (-1591.887) (-1590.153) (-1587.000) * (-1589.735) (-1590.565) [-1591.321] (-1590.635) -- 0:00:40
407500 -- (-1590.995) (-1588.816) [-1588.723] (-1591.131) * (-1587.930) (-1590.402) (-1588.951) [-1587.470] -- 0:00:40
408000 -- (-1587.770) (-1589.517) (-1590.331) [-1589.326] * [-1587.775] (-1590.825) (-1591.890) (-1588.390) -- 0:00:40
408500 -- (-1587.809) (-1589.484) (-1590.708) [-1587.843] * [-1586.641] (-1590.869) (-1596.387) (-1588.190) -- 0:00:40
409000 -- (-1593.992) [-1590.662] (-1590.821) (-1592.838) * [-1590.392] (-1592.736) (-1591.559) (-1589.218) -- 0:00:40
409500 -- (-1591.972) (-1591.050) (-1597.297) [-1586.470] * (-1590.329) [-1592.467] (-1589.978) (-1590.046) -- 0:00:40
410000 -- (-1590.570) (-1589.653) (-1589.004) [-1589.215] * [-1590.232] (-1590.584) (-1589.852) (-1587.986) -- 0:00:40
Average standard deviation of split frequencies: 0.020662
410500 -- [-1591.022] (-1588.923) (-1592.659) (-1589.647) * [-1592.189] (-1598.014) (-1594.317) (-1589.854) -- 0:00:40
411000 -- [-1587.502] (-1594.389) (-1593.124) (-1589.668) * (-1589.226) (-1591.510) (-1588.672) [-1588.297] -- 0:00:40
411500 -- (-1591.256) (-1588.962) [-1591.923] (-1589.060) * [-1587.161] (-1591.192) (-1591.608) (-1595.464) -- 0:00:40
412000 -- (-1590.006) (-1590.672) [-1591.102] (-1589.213) * (-1590.063) [-1590.274] (-1590.597) (-1592.667) -- 0:00:39
412500 -- [-1586.518] (-1590.498) (-1589.972) (-1591.018) * [-1588.434] (-1593.507) (-1591.054) (-1592.648) -- 0:00:39
413000 -- (-1588.088) [-1589.768] (-1596.053) (-1589.197) * [-1587.416] (-1588.563) (-1591.560) (-1593.436) -- 0:00:39
413500 -- (-1589.782) [-1588.667] (-1593.093) (-1591.247) * (-1588.261) (-1591.449) [-1588.873] (-1592.677) -- 0:00:39
414000 -- (-1590.092) (-1592.254) (-1593.571) [-1589.723] * [-1590.458] (-1591.336) (-1588.836) (-1588.044) -- 0:00:39
414500 -- (-1592.926) (-1589.915) (-1594.182) [-1590.185] * (-1591.042) (-1593.689) (-1588.009) [-1588.202] -- 0:00:39
415000 -- (-1591.042) [-1589.149] (-1600.039) (-1591.573) * (-1591.045) [-1588.827] (-1591.025) (-1587.995) -- 0:00:39
Average standard deviation of split frequencies: 0.020397
415500 -- (-1591.813) [-1590.476] (-1591.964) (-1588.232) * (-1589.665) (-1593.862) [-1589.503] (-1593.384) -- 0:00:40
416000 -- (-1588.908) (-1591.500) [-1592.171] (-1591.861) * (-1589.836) (-1590.111) [-1593.841] (-1590.819) -- 0:00:40
416500 -- (-1589.905) [-1592.798] (-1596.346) (-1590.484) * [-1589.129] (-1590.882) (-1590.647) (-1593.500) -- 0:00:40
417000 -- (-1592.242) (-1593.201) [-1588.932] (-1593.182) * (-1596.815) (-1590.983) [-1587.775] (-1598.647) -- 0:00:40
417500 -- [-1589.051] (-1593.486) (-1591.329) (-1592.746) * (-1590.241) (-1591.638) (-1586.849) [-1590.446] -- 0:00:40
418000 -- (-1588.932) [-1587.115] (-1591.804) (-1590.833) * (-1587.145) [-1590.677] (-1587.996) (-1589.489) -- 0:00:40
418500 -- (-1588.660) (-1591.470) (-1591.557) [-1590.237] * (-1588.684) (-1587.963) [-1588.668] (-1588.816) -- 0:00:40
419000 -- (-1591.017) [-1587.147] (-1591.097) (-1588.542) * (-1589.224) (-1591.798) [-1589.189] (-1590.357) -- 0:00:40
419500 -- (-1591.509) (-1592.893) [-1587.762] (-1591.129) * (-1593.192) [-1596.539] (-1588.580) (-1590.128) -- 0:00:40
420000 -- [-1587.887] (-1593.422) (-1592.190) (-1592.901) * (-1590.141) [-1589.312] (-1589.272) (-1589.031) -- 0:00:40
Average standard deviation of split frequencies: 0.019907
420500 -- (-1591.485) [-1591.719] (-1590.589) (-1593.013) * (-1588.717) (-1592.424) [-1589.460] (-1592.908) -- 0:00:39
421000 -- [-1589.990] (-1591.651) (-1591.147) (-1590.342) * (-1590.683) (-1593.835) (-1592.891) [-1589.834] -- 0:00:39
421500 -- (-1590.152) [-1592.189] (-1591.379) (-1591.643) * (-1589.306) (-1593.439) (-1589.692) [-1589.879] -- 0:00:39
422000 -- [-1590.770] (-1590.738) (-1592.152) (-1595.216) * [-1588.275] (-1589.257) (-1593.267) (-1591.841) -- 0:00:39
422500 -- [-1590.448] (-1593.800) (-1595.333) (-1591.765) * (-1591.421) [-1590.543] (-1594.009) (-1591.338) -- 0:00:39
423000 -- (-1590.619) (-1594.025) [-1593.997] (-1595.309) * [-1590.992] (-1591.430) (-1591.715) (-1591.664) -- 0:00:39
423500 -- (-1596.357) (-1593.338) [-1590.442] (-1594.819) * (-1589.803) [-1591.448] (-1590.415) (-1593.958) -- 0:00:39
424000 -- (-1589.450) (-1589.451) [-1594.148] (-1592.327) * (-1596.314) (-1590.335) [-1588.484] (-1592.446) -- 0:00:39
424500 -- (-1589.129) [-1589.335] (-1594.534) (-1591.117) * (-1591.829) (-1587.543) [-1590.027] (-1592.233) -- 0:00:39
425000 -- [-1588.016] (-1589.242) (-1590.583) (-1592.119) * (-1592.540) [-1590.605] (-1590.511) (-1590.513) -- 0:00:39
Average standard deviation of split frequencies: 0.018747
425500 -- [-1591.080] (-1588.839) (-1595.240) (-1594.049) * (-1593.194) [-1593.061] (-1589.957) (-1590.077) -- 0:00:39
426000 -- [-1587.974] (-1593.576) (-1592.840) (-1592.177) * [-1592.921] (-1592.030) (-1589.331) (-1589.947) -- 0:00:39
426500 -- (-1591.498) [-1590.460] (-1591.188) (-1593.633) * (-1594.355) (-1592.702) [-1592.740] (-1590.636) -- 0:00:38
427000 -- (-1591.148) (-1589.520) (-1590.048) [-1588.825] * (-1592.382) [-1591.578] (-1591.433) (-1591.506) -- 0:00:38
427500 -- (-1592.953) (-1592.840) (-1587.163) [-1588.599] * (-1591.683) (-1592.404) (-1588.350) [-1589.069] -- 0:00:38
428000 -- (-1589.622) [-1589.574] (-1591.809) (-1590.315) * [-1588.150] (-1591.842) (-1588.870) (-1592.630) -- 0:00:38
428500 -- [-1588.600] (-1591.439) (-1594.610) (-1592.470) * (-1587.911) [-1589.960] (-1589.578) (-1587.928) -- 0:00:38
429000 -- (-1593.125) (-1592.953) (-1591.699) [-1590.937] * (-1590.121) (-1589.134) [-1590.023] (-1591.143) -- 0:00:38
429500 -- [-1592.757] (-1587.856) (-1591.632) (-1587.794) * (-1590.789) (-1593.489) [-1590.524] (-1590.983) -- 0:00:38
430000 -- (-1592.143) (-1588.871) (-1588.613) [-1590.081] * (-1589.063) [-1586.794] (-1591.416) (-1592.694) -- 0:00:39
Average standard deviation of split frequencies: 0.017513
430500 -- (-1587.823) (-1597.481) (-1590.503) [-1590.773] * [-1588.143] (-1587.176) (-1588.705) (-1592.610) -- 0:00:39
431000 -- [-1588.767] (-1593.634) (-1588.378) (-1592.134) * (-1588.376) [-1591.927] (-1591.781) (-1592.180) -- 0:00:39
431500 -- [-1589.084] (-1593.718) (-1590.598) (-1589.089) * (-1591.029) [-1589.260] (-1587.937) (-1591.848) -- 0:00:39
432000 -- [-1590.541] (-1593.731) (-1590.467) (-1595.858) * (-1591.207) (-1588.520) [-1592.780] (-1592.504) -- 0:00:39
432500 -- (-1593.505) (-1591.692) (-1589.185) [-1592.513] * [-1587.944] (-1591.376) (-1592.983) (-1589.852) -- 0:00:39
433000 -- [-1592.510] (-1590.083) (-1588.648) (-1592.456) * [-1589.065] (-1592.946) (-1589.875) (-1591.936) -- 0:00:39
433500 -- (-1593.107) [-1590.549] (-1588.801) (-1596.219) * (-1590.096) [-1594.059] (-1590.101) (-1594.947) -- 0:00:39
434000 -- (-1591.141) [-1586.792] (-1589.814) (-1596.014) * (-1591.420) [-1593.407] (-1588.876) (-1592.344) -- 0:00:39
434500 -- [-1587.816] (-1589.925) (-1590.373) (-1589.476) * (-1591.682) [-1591.117] (-1591.959) (-1593.505) -- 0:00:39
435000 -- (-1590.311) (-1597.323) [-1589.069] (-1592.596) * (-1589.946) (-1592.495) (-1593.822) [-1593.263] -- 0:00:38
Average standard deviation of split frequencies: 0.017299
435500 -- (-1589.065) (-1592.943) (-1587.842) [-1590.233] * [-1588.043] (-1590.472) (-1590.192) (-1591.878) -- 0:00:38
436000 -- (-1586.893) (-1595.672) [-1589.803] (-1590.711) * (-1589.188) [-1589.519] (-1591.305) (-1591.380) -- 0:00:38
436500 -- (-1586.636) (-1588.813) (-1588.079) [-1587.695] * [-1589.865] (-1590.880) (-1589.592) (-1589.418) -- 0:00:38
437000 -- (-1589.159) (-1591.230) (-1586.953) [-1590.631] * (-1588.588) (-1588.321) [-1589.311] (-1590.294) -- 0:00:38
437500 -- [-1588.316] (-1589.283) (-1588.166) (-1589.074) * (-1590.724) [-1588.764] (-1588.607) (-1589.326) -- 0:00:38
438000 -- (-1587.899) [-1588.545] (-1587.888) (-1590.029) * (-1591.140) (-1593.784) [-1591.862] (-1590.163) -- 0:00:38
438500 -- (-1592.170) (-1589.181) (-1592.409) [-1592.358] * [-1590.447] (-1592.784) (-1589.775) (-1589.634) -- 0:00:38
439000 -- (-1589.307) [-1589.724] (-1589.982) (-1593.541) * (-1595.596) [-1590.075] (-1590.202) (-1594.009) -- 0:00:38
439500 -- (-1590.738) (-1592.030) (-1590.377) [-1587.755] * (-1589.644) (-1596.933) (-1590.483) [-1594.806] -- 0:00:38
440000 -- (-1589.731) (-1589.646) [-1588.419] (-1595.259) * (-1588.677) (-1592.945) (-1592.684) [-1589.099] -- 0:00:38
Average standard deviation of split frequencies: 0.017934
440500 -- (-1590.687) [-1592.580] (-1591.228) (-1590.999) * (-1586.619) [-1590.333] (-1591.453) (-1589.834) -- 0:00:38
441000 -- (-1589.084) (-1590.242) [-1592.436] (-1589.351) * [-1588.624] (-1590.743) (-1597.121) (-1591.703) -- 0:00:38
441500 -- (-1591.628) [-1590.588] (-1591.400) (-1588.842) * (-1590.873) (-1593.791) (-1591.898) [-1592.114] -- 0:00:37
442000 -- [-1589.259] (-1591.565) (-1590.007) (-1590.385) * (-1589.299) [-1592.230] (-1588.533) (-1587.667) -- 0:00:37
442500 -- (-1587.647) (-1588.082) [-1592.153] (-1591.818) * (-1588.603) (-1593.430) (-1589.938) [-1587.821] -- 0:00:37
443000 -- (-1595.936) (-1589.863) (-1596.052) [-1595.331] * [-1590.464] (-1592.951) (-1588.252) (-1590.549) -- 0:00:37
443500 -- [-1590.744] (-1589.610) (-1591.809) (-1589.663) * (-1588.894) (-1591.238) (-1587.834) [-1591.253] -- 0:00:37
444000 -- [-1587.495] (-1589.047) (-1595.675) (-1593.259) * [-1587.982] (-1593.579) (-1587.971) (-1588.576) -- 0:00:37
444500 -- [-1589.057] (-1589.570) (-1592.963) (-1589.277) * (-1587.716) [-1592.579] (-1588.643) (-1593.661) -- 0:00:38
445000 -- (-1592.337) (-1590.256) (-1591.394) [-1590.065] * (-1593.732) (-1591.157) [-1586.835] (-1593.203) -- 0:00:38
Average standard deviation of split frequencies: 0.017347
445500 -- (-1589.733) [-1588.215] (-1590.228) (-1590.047) * [-1589.740] (-1588.382) (-1590.480) (-1591.269) -- 0:00:38
446000 -- [-1591.500] (-1587.654) (-1592.265) (-1589.699) * [-1589.699] (-1591.295) (-1589.665) (-1596.195) -- 0:00:38
446500 -- (-1591.082) [-1587.845] (-1593.645) (-1591.953) * (-1589.205) [-1591.696] (-1595.205) (-1592.871) -- 0:00:38
447000 -- (-1591.756) [-1587.738] (-1589.289) (-1593.498) * (-1589.335) [-1589.315] (-1590.993) (-1589.265) -- 0:00:38
447500 -- [-1591.864] (-1591.957) (-1591.070) (-1594.551) * [-1589.016] (-1591.077) (-1591.356) (-1592.047) -- 0:00:38
448000 -- (-1591.851) [-1590.555] (-1590.086) (-1588.187) * [-1590.301] (-1591.192) (-1588.532) (-1590.879) -- 0:00:38
448500 -- (-1592.874) [-1589.863] (-1590.243) (-1588.857) * (-1590.232) [-1595.415] (-1587.558) (-1591.460) -- 0:00:38
449000 -- (-1591.616) [-1588.721] (-1596.243) (-1587.964) * [-1589.343] (-1590.965) (-1593.381) (-1590.933) -- 0:00:38
449500 -- (-1592.030) [-1587.940] (-1593.139) (-1589.781) * (-1589.058) (-1592.010) [-1587.110] (-1594.660) -- 0:00:37
450000 -- (-1591.748) (-1587.810) (-1595.478) [-1593.149] * [-1590.144] (-1591.129) (-1590.422) (-1591.062) -- 0:00:37
Average standard deviation of split frequencies: 0.017536
450500 -- [-1587.301] (-1588.190) (-1594.664) (-1592.846) * (-1590.366) [-1596.398] (-1588.969) (-1591.097) -- 0:00:37
451000 -- [-1589.599] (-1589.308) (-1590.367) (-1591.859) * (-1592.948) [-1590.160] (-1587.108) (-1592.046) -- 0:00:37
451500 -- (-1589.438) (-1592.411) (-1590.964) [-1590.680] * (-1597.291) [-1590.041] (-1588.293) (-1592.411) -- 0:00:37
452000 -- (-1589.347) (-1587.807) [-1591.392] (-1592.899) * [-1588.251] (-1591.711) (-1594.221) (-1594.101) -- 0:00:37
452500 -- (-1590.120) [-1591.427] (-1590.496) (-1590.879) * [-1589.136] (-1590.552) (-1587.798) (-1592.526) -- 0:00:37
453000 -- (-1587.783) (-1587.456) (-1591.444) [-1587.215] * [-1589.690] (-1595.019) (-1589.789) (-1591.553) -- 0:00:37
453500 -- (-1592.762) [-1587.435] (-1591.176) (-1591.300) * [-1587.968] (-1591.851) (-1593.865) (-1589.763) -- 0:00:37
454000 -- (-1591.324) (-1592.382) (-1591.053) [-1590.347] * [-1587.994] (-1593.571) (-1594.610) (-1588.716) -- 0:00:37
454500 -- (-1588.704) (-1588.166) (-1590.895) [-1591.353] * (-1587.761) (-1592.422) [-1590.270] (-1589.875) -- 0:00:37
455000 -- [-1587.949] (-1590.770) (-1591.103) (-1594.512) * [-1589.179] (-1597.335) (-1600.842) (-1590.052) -- 0:00:37
Average standard deviation of split frequencies: 0.017027
455500 -- (-1589.371) [-1591.513] (-1592.421) (-1590.337) * (-1587.607) (-1592.696) [-1592.470] (-1591.310) -- 0:00:37
456000 -- (-1589.387) (-1589.974) (-1592.636) [-1589.907] * (-1592.486) (-1592.272) (-1590.048) [-1590.461] -- 0:00:36
456500 -- (-1589.404) [-1589.135] (-1590.085) (-1591.012) * (-1591.346) (-1590.352) [-1593.846] (-1595.884) -- 0:00:36
457000 -- [-1591.814] (-1587.317) (-1591.212) (-1589.680) * (-1590.500) (-1590.768) (-1592.651) [-1588.071] -- 0:00:36
457500 -- (-1592.521) [-1591.739] (-1590.178) (-1590.906) * (-1589.232) (-1590.486) [-1593.320] (-1588.129) -- 0:00:36
458000 -- (-1588.439) [-1589.397] (-1589.203) (-1587.614) * (-1589.468) (-1590.983) (-1588.246) [-1590.902] -- 0:00:36
458500 -- (-1596.629) [-1588.734] (-1590.734) (-1587.827) * [-1589.398] (-1590.367) (-1590.377) (-1588.807) -- 0:00:36
459000 -- (-1598.824) (-1589.133) (-1589.324) [-1591.432] * [-1591.763] (-1589.217) (-1590.005) (-1592.227) -- 0:00:36
459500 -- (-1592.630) [-1590.481] (-1590.866) (-1590.767) * (-1587.671) (-1591.494) [-1588.232] (-1591.601) -- 0:00:37
460000 -- (-1593.313) (-1591.183) (-1590.446) [-1588.389] * [-1590.782] (-1591.581) (-1587.852) (-1591.423) -- 0:00:37
Average standard deviation of split frequencies: 0.017517
460500 -- (-1592.116) (-1590.114) (-1588.510) [-1590.229] * (-1589.401) (-1592.052) (-1593.389) [-1593.102] -- 0:00:37
461000 -- [-1595.515] (-1590.204) (-1592.790) (-1589.119) * (-1592.972) [-1589.227] (-1592.909) (-1593.585) -- 0:00:37
461500 -- (-1588.110) (-1593.454) [-1588.719] (-1588.562) * [-1590.702] (-1592.593) (-1594.962) (-1594.260) -- 0:00:37
462000 -- [-1591.228] (-1590.246) (-1589.914) (-1591.052) * (-1590.401) (-1588.755) (-1594.431) [-1593.379] -- 0:00:37
462500 -- (-1594.360) [-1589.758] (-1588.809) (-1588.200) * [-1593.433] (-1590.144) (-1597.475) (-1593.483) -- 0:00:37
463000 -- (-1592.439) [-1591.610] (-1593.749) (-1589.123) * [-1591.831] (-1594.544) (-1596.880) (-1590.918) -- 0:00:37
463500 -- (-1591.095) [-1592.534] (-1591.134) (-1589.912) * (-1590.590) [-1594.051] (-1591.478) (-1592.717) -- 0:00:37
464000 -- (-1590.602) (-1590.928) [-1592.844] (-1589.977) * (-1592.946) [-1588.622] (-1589.886) (-1590.404) -- 0:00:36
464500 -- (-1589.114) [-1592.387] (-1594.113) (-1596.079) * (-1593.636) (-1592.283) (-1587.716) [-1589.061] -- 0:00:36
465000 -- (-1591.185) [-1589.442] (-1595.342) (-1590.466) * (-1591.115) (-1589.408) (-1588.698) [-1591.293] -- 0:00:36
Average standard deviation of split frequencies: 0.017197
465500 -- [-1589.723] (-1590.289) (-1593.638) (-1588.510) * (-1592.122) [-1590.471] (-1590.442) (-1591.938) -- 0:00:36
466000 -- (-1593.308) (-1592.660) (-1591.261) [-1591.715] * (-1591.800) (-1589.721) [-1589.975] (-1590.473) -- 0:00:36
466500 -- (-1596.216) [-1589.522] (-1591.875) (-1592.833) * (-1589.987) (-1591.002) [-1589.121] (-1590.405) -- 0:00:36
467000 -- [-1590.296] (-1590.210) (-1591.815) (-1591.916) * [-1589.733] (-1591.315) (-1589.515) (-1591.166) -- 0:00:36
467500 -- (-1589.622) (-1587.508) (-1588.980) [-1587.379] * (-1589.573) (-1589.687) [-1588.846] (-1589.535) -- 0:00:36
468000 -- (-1594.988) [-1588.346] (-1590.449) (-1592.770) * (-1590.418) [-1590.369] (-1591.300) (-1590.324) -- 0:00:36
468500 -- (-1594.554) [-1593.365] (-1591.138) (-1592.114) * (-1588.599) (-1591.739) (-1590.778) [-1589.066] -- 0:00:36
469000 -- (-1594.110) (-1589.381) [-1592.504] (-1591.572) * [-1590.780] (-1588.877) (-1591.433) (-1592.776) -- 0:00:36
469500 -- (-1592.813) (-1598.754) (-1586.928) [-1591.591] * (-1589.690) (-1591.086) [-1594.400] (-1589.327) -- 0:00:36
470000 -- (-1595.195) (-1597.570) [-1589.149] (-1591.368) * (-1588.773) [-1589.275] (-1589.529) (-1594.022) -- 0:00:36
Average standard deviation of split frequencies: 0.017380
470500 -- (-1588.113) (-1594.621) [-1588.612] (-1589.544) * [-1587.812] (-1590.239) (-1591.258) (-1594.460) -- 0:00:36
471000 -- (-1591.290) [-1596.494] (-1590.367) (-1591.369) * [-1587.879] (-1587.785) (-1587.613) (-1591.929) -- 0:00:35
471500 -- (-1589.877) (-1594.018) (-1588.169) [-1594.969] * [-1589.295] (-1590.605) (-1588.070) (-1591.378) -- 0:00:35
472000 -- (-1590.202) (-1591.358) [-1587.435] (-1592.685) * [-1589.740] (-1590.578) (-1588.220) (-1591.035) -- 0:00:35
472500 -- (-1589.008) [-1589.943] (-1587.913) (-1591.493) * (-1592.079) [-1590.909] (-1590.478) (-1590.539) -- 0:00:35
473000 -- [-1589.066] (-1592.049) (-1596.660) (-1590.753) * (-1592.223) (-1591.069) [-1588.425] (-1591.543) -- 0:00:35
473500 -- (-1588.700) [-1588.913] (-1591.225) (-1592.525) * (-1587.708) [-1588.846] (-1587.419) (-1590.317) -- 0:00:35
474000 -- (-1588.078) [-1590.830] (-1597.406) (-1591.476) * (-1597.566) [-1593.467] (-1590.060) (-1589.146) -- 0:00:36
474500 -- [-1591.454] (-1591.045) (-1588.121) (-1589.071) * (-1594.347) (-1592.174) (-1589.496) [-1589.826] -- 0:00:36
475000 -- (-1590.458) (-1593.183) (-1590.388) [-1590.511] * (-1589.318) (-1589.760) [-1589.895] (-1589.872) -- 0:00:36
Average standard deviation of split frequencies: 0.017710
475500 -- [-1588.949] (-1591.512) (-1588.243) (-1592.754) * (-1588.807) (-1593.762) (-1592.890) [-1590.049] -- 0:00:36
476000 -- [-1589.427] (-1593.886) (-1590.744) (-1587.692) * (-1592.537) [-1587.861] (-1590.446) (-1592.464) -- 0:00:36
476500 -- (-1589.368) (-1593.834) (-1590.931) [-1591.316] * (-1591.548) (-1590.418) [-1590.211] (-1589.086) -- 0:00:36
477000 -- [-1590.154] (-1595.317) (-1588.517) (-1589.952) * [-1590.257] (-1590.602) (-1589.862) (-1589.112) -- 0:00:36
477500 -- (-1587.811) (-1587.230) (-1590.047) [-1590.030] * (-1593.888) (-1590.587) [-1588.813] (-1589.195) -- 0:00:36
478000 -- (-1592.895) (-1590.360) [-1587.137] (-1590.324) * [-1588.474] (-1592.509) (-1590.435) (-1590.592) -- 0:00:36
478500 -- (-1592.342) (-1587.544) (-1590.771) [-1591.092] * (-1590.350) (-1593.086) [-1587.699] (-1589.764) -- 0:00:35
479000 -- (-1591.820) (-1590.463) (-1590.458) [-1589.694] * (-1590.072) [-1593.128] (-1590.483) (-1589.135) -- 0:00:35
479500 -- (-1591.495) (-1588.751) [-1589.334] (-1590.504) * (-1588.761) (-1590.257) (-1589.379) [-1588.384] -- 0:00:35
480000 -- (-1591.066) (-1592.647) [-1588.143] (-1588.026) * (-1587.948) (-1591.437) (-1590.095) [-1589.860] -- 0:00:35
Average standard deviation of split frequencies: 0.017019
480500 -- [-1589.330] (-1594.238) (-1590.530) (-1588.371) * (-1591.485) (-1591.725) (-1595.967) [-1592.102] -- 0:00:35
481000 -- (-1589.681) [-1590.186] (-1591.629) (-1588.161) * [-1589.711] (-1590.272) (-1589.049) (-1589.415) -- 0:00:35
481500 -- (-1590.444) (-1588.685) (-1592.893) [-1592.298] * [-1588.727] (-1590.869) (-1592.057) (-1589.330) -- 0:00:35
482000 -- [-1589.909] (-1590.591) (-1595.282) (-1592.902) * [-1590.066] (-1588.618) (-1588.810) (-1589.050) -- 0:00:35
482500 -- [-1587.748] (-1589.710) (-1592.898) (-1591.246) * (-1591.800) (-1588.027) [-1589.158] (-1589.367) -- 0:00:35
483000 -- (-1588.922) (-1587.357) [-1590.393] (-1591.142) * (-1591.546) (-1590.380) [-1588.119] (-1590.469) -- 0:00:35
483500 -- (-1589.987) (-1589.490) [-1588.786] (-1591.273) * (-1589.852) (-1590.502) (-1591.407) [-1592.961] -- 0:00:35
484000 -- (-1596.117) [-1589.764] (-1596.013) (-1590.356) * (-1590.015) (-1597.408) [-1590.465] (-1595.359) -- 0:00:35
484500 -- [-1588.002] (-1590.303) (-1590.345) (-1589.978) * (-1595.972) [-1593.714] (-1588.504) (-1588.939) -- 0:00:35
485000 -- (-1588.880) (-1592.527) [-1589.356] (-1588.700) * [-1591.650] (-1593.080) (-1588.128) (-1588.092) -- 0:00:35
Average standard deviation of split frequencies: 0.017288
485500 -- (-1592.385) [-1586.629] (-1591.948) (-1592.244) * (-1589.840) (-1590.110) (-1591.925) [-1590.200] -- 0:00:34
486000 -- (-1592.973) (-1589.221) (-1593.892) [-1591.398] * (-1590.637) [-1591.992] (-1591.556) (-1587.540) -- 0:00:34
486500 -- (-1590.215) (-1590.021) (-1593.881) [-1588.709] * (-1593.782) (-1597.157) (-1594.700) [-1590.355] -- 0:00:34
487000 -- (-1589.140) [-1589.259] (-1592.536) (-1590.342) * (-1593.398) (-1593.855) (-1590.754) [-1587.607] -- 0:00:34
487500 -- (-1591.829) [-1590.262] (-1590.042) (-1588.604) * (-1592.834) [-1589.064] (-1588.389) (-1588.116) -- 0:00:34
488000 -- (-1590.761) (-1589.148) (-1589.976) [-1589.892] * [-1594.066] (-1587.534) (-1592.605) (-1588.151) -- 0:00:34
488500 -- (-1593.228) (-1591.204) (-1589.467) [-1587.607] * (-1592.354) [-1588.394] (-1593.251) (-1589.724) -- 0:00:35
489000 -- (-1592.501) (-1592.628) [-1590.680] (-1590.891) * [-1591.517] (-1591.040) (-1596.547) (-1590.494) -- 0:00:35
489500 -- (-1589.328) [-1592.524] (-1592.484) (-1589.133) * (-1588.632) [-1589.998] (-1594.733) (-1593.474) -- 0:00:35
490000 -- (-1591.263) (-1598.109) (-1590.930) [-1589.057] * (-1592.518) (-1592.264) (-1592.997) [-1587.698] -- 0:00:35
Average standard deviation of split frequencies: 0.016954
490500 -- (-1591.163) (-1591.766) (-1591.925) [-1591.371] * (-1592.834) (-1591.151) (-1589.509) [-1587.819] -- 0:00:35
491000 -- (-1593.243) (-1595.251) (-1591.207) [-1590.148] * (-1595.951) (-1589.751) (-1593.288) [-1586.356] -- 0:00:35
491500 -- (-1590.670) (-1590.271) (-1591.070) [-1590.087] * (-1594.888) (-1592.779) [-1588.877] (-1587.281) -- 0:00:35
492000 -- (-1588.759) (-1594.559) [-1592.474] (-1591.953) * (-1589.500) (-1590.532) (-1591.203) [-1587.778] -- 0:00:35
492500 -- (-1588.741) (-1590.414) [-1590.058] (-1590.375) * (-1590.895) (-1587.391) [-1588.362] (-1591.144) -- 0:00:35
493000 -- (-1589.939) (-1590.802) (-1590.664) [-1589.158] * (-1588.024) (-1589.046) (-1589.505) [-1586.742] -- 0:00:34
493500 -- (-1592.870) (-1592.595) [-1587.756] (-1590.936) * (-1590.357) [-1586.508] (-1588.303) (-1587.388) -- 0:00:34
494000 -- (-1590.555) (-1589.844) [-1593.145] (-1590.658) * (-1590.361) (-1589.753) [-1588.140] (-1586.999) -- 0:00:34
494500 -- (-1589.411) [-1588.361] (-1590.678) (-1592.865) * [-1592.004] (-1588.733) (-1592.668) (-1589.601) -- 0:00:34
495000 -- (-1591.130) (-1591.965) [-1589.429] (-1590.867) * [-1593.753] (-1590.758) (-1589.882) (-1588.596) -- 0:00:34
Average standard deviation of split frequencies: 0.017163
495500 -- (-1587.466) (-1591.332) (-1586.192) [-1587.910] * (-1589.361) (-1589.467) (-1588.505) [-1588.529] -- 0:00:34
496000 -- (-1590.271) (-1591.352) [-1589.336] (-1590.419) * (-1589.876) (-1591.238) (-1591.212) [-1590.944] -- 0:00:34
496500 -- (-1589.889) [-1590.698] (-1591.669) (-1593.476) * [-1586.118] (-1593.134) (-1592.233) (-1589.104) -- 0:00:34
497000 -- [-1598.268] (-1590.689) (-1590.543) (-1591.497) * (-1588.895) [-1588.930] (-1591.285) (-1590.829) -- 0:00:34
497500 -- [-1588.224] (-1589.205) (-1591.871) (-1590.042) * [-1587.436] (-1589.025) (-1589.365) (-1588.875) -- 0:00:34
498000 -- [-1592.547] (-1590.493) (-1589.514) (-1595.084) * (-1586.502) (-1588.726) (-1591.905) [-1587.635] -- 0:00:34
498500 -- [-1590.837] (-1591.810) (-1590.022) (-1592.709) * [-1587.627] (-1588.863) (-1593.076) (-1589.117) -- 0:00:34
499000 -- (-1593.550) [-1589.797] (-1593.741) (-1590.967) * [-1588.931] (-1588.726) (-1593.196) (-1588.891) -- 0:00:34
499500 -- (-1593.114) [-1590.506] (-1596.003) (-1591.736) * (-1592.782) (-1591.937) (-1593.831) [-1591.697] -- 0:00:34
500000 -- [-1592.673] (-1590.021) (-1595.109) (-1594.094) * [-1593.104] (-1590.946) (-1589.495) (-1591.053) -- 0:00:34
Average standard deviation of split frequencies: 0.017723
500500 -- (-1591.305) (-1590.395) (-1594.462) [-1590.083] * (-1589.306) (-1593.921) [-1590.410] (-1590.834) -- 0:00:33
501000 -- (-1592.649) (-1589.165) (-1592.621) [-1590.182] * (-1590.568) (-1590.532) (-1590.202) [-1586.539] -- 0:00:33
501500 -- (-1590.631) [-1589.704] (-1591.311) (-1588.604) * (-1590.491) (-1590.508) [-1588.509] (-1589.123) -- 0:00:33
502000 -- (-1591.288) (-1593.815) (-1590.605) [-1591.124] * (-1589.971) (-1591.640) [-1588.597] (-1588.365) -- 0:00:33
502500 -- (-1591.680) (-1595.054) (-1589.337) [-1587.578] * (-1589.218) (-1592.478) (-1588.696) [-1588.929] -- 0:00:33
503000 -- (-1591.643) (-1594.363) [-1590.625] (-1593.709) * (-1593.816) (-1595.525) [-1588.742] (-1590.640) -- 0:00:33
503500 -- [-1594.069] (-1592.337) (-1592.401) (-1590.105) * (-1589.650) (-1594.457) (-1587.253) [-1587.361] -- 0:00:34
504000 -- [-1589.874] (-1590.271) (-1593.741) (-1589.698) * (-1592.096) (-1594.163) [-1589.242] (-1589.625) -- 0:00:34
504500 -- (-1591.125) (-1592.858) (-1595.468) [-1587.609] * (-1590.801) [-1587.290] (-1589.426) (-1588.127) -- 0:00:34
505000 -- (-1593.552) (-1593.640) [-1589.895] (-1589.163) * (-1588.582) (-1588.371) (-1591.366) [-1589.627] -- 0:00:34
Average standard deviation of split frequencies: 0.017646
505500 -- (-1591.441) (-1592.424) [-1589.552] (-1589.224) * [-1587.320] (-1592.395) (-1593.194) (-1588.124) -- 0:00:34
506000 -- (-1589.639) [-1587.459] (-1588.151) (-1594.916) * (-1588.459) [-1590.850] (-1589.239) (-1592.601) -- 0:00:34
506500 -- (-1592.933) (-1588.614) (-1593.131) [-1588.543] * [-1588.293] (-1591.208) (-1592.009) (-1590.907) -- 0:00:34
507000 -- [-1591.924] (-1598.546) (-1596.174) (-1588.700) * (-1590.640) (-1589.329) (-1590.631) [-1590.873] -- 0:00:34
507500 -- (-1590.028) [-1593.532] (-1591.026) (-1587.984) * [-1591.054] (-1592.737) (-1586.753) (-1589.981) -- 0:00:33
508000 -- [-1595.082] (-1589.796) (-1591.946) (-1589.417) * [-1589.313] (-1590.706) (-1587.667) (-1591.867) -- 0:00:33
508500 -- (-1592.346) [-1591.298] (-1591.842) (-1590.206) * (-1592.475) (-1592.042) [-1588.758] (-1588.867) -- 0:00:33
509000 -- [-1595.104] (-1593.850) (-1591.863) (-1590.419) * (-1590.473) (-1592.684) (-1589.749) [-1589.763] -- 0:00:33
509500 -- (-1592.091) (-1596.489) (-1587.840) [-1592.374] * (-1589.845) (-1594.963) (-1590.369) [-1590.056] -- 0:00:33
510000 -- (-1597.527) [-1588.647] (-1588.935) (-1593.511) * (-1590.617) (-1592.319) (-1591.483) [-1591.115] -- 0:00:33
Average standard deviation of split frequencies: 0.017213
510500 -- (-1591.414) (-1589.234) (-1592.415) [-1591.180] * (-1588.745) (-1589.991) [-1590.778] (-1591.296) -- 0:00:33
511000 -- [-1592.605] (-1588.864) (-1592.828) (-1589.262) * [-1595.131] (-1591.969) (-1590.798) (-1589.081) -- 0:00:33
511500 -- (-1589.823) [-1593.308] (-1589.796) (-1590.540) * [-1587.049] (-1590.683) (-1586.480) (-1590.492) -- 0:00:33
512000 -- [-1588.070] (-1590.874) (-1588.135) (-1592.486) * (-1590.807) (-1588.784) [-1587.304] (-1589.153) -- 0:00:33
512500 -- (-1587.891) (-1592.034) (-1590.353) [-1594.009] * (-1591.358) [-1591.618] (-1591.472) (-1589.142) -- 0:00:33
513000 -- (-1592.140) (-1591.097) (-1590.369) [-1592.885] * (-1591.504) [-1592.971] (-1590.190) (-1592.391) -- 0:00:33
513500 -- (-1588.053) (-1590.506) [-1588.573] (-1589.540) * (-1594.950) (-1591.364) (-1592.037) [-1589.413] -- 0:00:33
514000 -- (-1592.663) (-1590.638) (-1590.639) [-1591.576] * (-1594.297) (-1590.811) (-1590.192) [-1587.743] -- 0:00:33
514500 -- (-1590.366) (-1597.038) (-1590.497) [-1589.328] * (-1589.346) (-1594.314) [-1591.731] (-1588.960) -- 0:00:33
515000 -- (-1590.041) (-1595.251) [-1590.462] (-1591.125) * (-1587.563) (-1591.066) (-1591.715) [-1591.592] -- 0:00:32
Average standard deviation of split frequencies: 0.016498
515500 -- (-1590.516) (-1592.010) (-1590.442) [-1589.303] * (-1595.109) (-1593.049) [-1587.236] (-1591.313) -- 0:00:32
516000 -- (-1590.802) (-1590.783) [-1589.130] (-1590.595) * [-1589.182] (-1590.813) (-1590.528) (-1590.141) -- 0:00:32
516500 -- [-1591.511] (-1590.970) (-1593.189) (-1589.891) * (-1587.827) (-1589.835) [-1588.632] (-1592.462) -- 0:00:32
517000 -- (-1588.675) (-1593.414) (-1593.535) [-1587.879] * [-1588.556] (-1592.379) (-1591.002) (-1591.258) -- 0:00:32
517500 -- (-1588.278) [-1589.958] (-1588.714) (-1587.203) * (-1595.123) (-1588.835) (-1587.575) [-1590.249] -- 0:00:32
518000 -- (-1591.464) (-1596.405) [-1592.596] (-1589.763) * (-1591.991) [-1590.958] (-1589.307) (-1586.841) -- 0:00:33
518500 -- (-1590.756) (-1595.742) [-1591.100] (-1587.765) * (-1592.581) (-1592.464) [-1590.620] (-1589.275) -- 0:00:33
519000 -- (-1588.854) (-1594.947) [-1592.800] (-1590.599) * (-1587.965) (-1591.677) (-1591.244) [-1590.029] -- 0:00:33
519500 -- (-1593.776) (-1594.568) [-1596.040] (-1589.452) * [-1588.066] (-1588.471) (-1592.665) (-1591.373) -- 0:00:33
520000 -- [-1589.414] (-1591.732) (-1591.966) (-1588.646) * (-1591.419) (-1590.190) [-1588.375] (-1590.160) -- 0:00:33
Average standard deviation of split frequencies: 0.016693
520500 -- (-1591.087) (-1594.823) [-1588.115] (-1592.031) * [-1589.322] (-1592.671) (-1592.543) (-1587.857) -- 0:00:33
521000 -- [-1591.410] (-1592.970) (-1588.690) (-1589.363) * (-1591.834) (-1590.583) [-1590.765] (-1591.858) -- 0:00:33
521500 -- [-1592.346] (-1592.193) (-1589.773) (-1595.425) * [-1588.706] (-1591.635) (-1590.307) (-1588.786) -- 0:00:33
522000 -- (-1590.957) [-1592.215] (-1592.934) (-1588.257) * [-1589.541] (-1595.586) (-1591.508) (-1589.661) -- 0:00:32
522500 -- (-1589.901) [-1590.213] (-1588.467) (-1589.841) * (-1589.013) (-1591.103) [-1591.097] (-1589.013) -- 0:00:32
523000 -- (-1591.730) [-1590.622] (-1587.401) (-1590.598) * [-1589.475] (-1589.961) (-1589.697) (-1590.142) -- 0:00:32
523500 -- (-1591.641) (-1591.037) (-1594.337) [-1590.194] * (-1591.125) (-1593.400) (-1591.239) [-1586.966] -- 0:00:32
524000 -- (-1592.139) (-1589.903) (-1592.914) [-1588.957] * (-1592.126) (-1591.831) (-1591.355) [-1587.180] -- 0:00:32
524500 -- (-1592.568) (-1590.887) [-1589.656] (-1593.300) * (-1591.224) (-1589.003) (-1593.347) [-1586.622] -- 0:00:32
525000 -- (-1592.139) (-1592.424) (-1589.931) [-1591.730] * (-1590.004) (-1589.760) (-1592.670) [-1588.181] -- 0:00:32
Average standard deviation of split frequencies: 0.016692
525500 -- [-1590.150] (-1590.881) (-1590.102) (-1590.650) * (-1592.884) (-1591.620) (-1588.033) [-1589.479] -- 0:00:32
526000 -- (-1588.691) (-1591.423) (-1588.376) [-1592.622] * (-1590.064) (-1590.848) (-1588.072) [-1590.194] -- 0:00:32
526500 -- (-1592.191) (-1590.752) [-1589.400] (-1590.342) * (-1592.925) (-1590.498) (-1588.672) [-1590.551] -- 0:00:32
527000 -- (-1589.948) (-1589.865) [-1586.991] (-1590.635) * (-1592.021) [-1589.211] (-1589.220) (-1590.431) -- 0:00:32
527500 -- (-1589.285) [-1586.328] (-1589.758) (-1592.963) * (-1587.918) (-1589.655) [-1591.949] (-1590.314) -- 0:00:32
528000 -- (-1592.068) [-1590.432] (-1587.834) (-1592.586) * [-1592.636] (-1588.334) (-1589.629) (-1588.566) -- 0:00:32
528500 -- (-1591.096) [-1587.145] (-1591.436) (-1590.301) * [-1588.672] (-1590.383) (-1596.284) (-1588.846) -- 0:00:32
529000 -- (-1593.174) [-1588.135] (-1594.082) (-1590.244) * (-1594.806) (-1590.097) [-1589.444] (-1589.795) -- 0:00:32
529500 -- (-1590.857) (-1587.202) (-1593.879) [-1590.139] * [-1589.085] (-1589.878) (-1590.684) (-1589.258) -- 0:00:31
530000 -- [-1593.172] (-1588.696) (-1590.666) (-1591.316) * (-1592.478) [-1590.196] (-1594.766) (-1590.980) -- 0:00:31
Average standard deviation of split frequencies: 0.016378
530500 -- [-1591.737] (-1589.867) (-1590.068) (-1594.035) * [-1589.033] (-1590.862) (-1592.510) (-1592.667) -- 0:00:31
531000 -- (-1590.795) (-1593.029) (-1591.019) [-1591.444] * (-1590.908) [-1589.820] (-1590.864) (-1590.398) -- 0:00:31
531500 -- (-1589.179) (-1592.535) (-1590.468) [-1589.506] * (-1587.670) (-1589.070) [-1589.206] (-1592.102) -- 0:00:31
532000 -- (-1589.350) [-1590.276] (-1590.851) (-1590.799) * (-1589.268) (-1590.434) (-1591.226) [-1589.220] -- 0:00:31
532500 -- [-1591.612] (-1586.240) (-1590.116) (-1590.512) * [-1588.293] (-1592.368) (-1592.164) (-1592.705) -- 0:00:31
533000 -- (-1590.795) (-1590.231) [-1588.528] (-1590.931) * (-1592.172) (-1595.816) [-1593.698] (-1593.064) -- 0:00:32
533500 -- (-1589.529) [-1589.902] (-1591.277) (-1587.951) * (-1590.740) (-1589.900) [-1588.783] (-1597.151) -- 0:00:32
534000 -- (-1590.058) (-1588.087) [-1593.234] (-1587.736) * [-1588.717] (-1591.929) (-1592.548) (-1588.713) -- 0:00:32
534500 -- (-1591.930) [-1588.513] (-1590.866) (-1588.673) * (-1590.980) (-1592.051) (-1591.566) [-1590.341] -- 0:00:32
535000 -- (-1591.900) (-1592.913) (-1590.028) [-1587.423] * (-1589.985) (-1593.692) (-1591.572) [-1592.035] -- 0:00:32
Average standard deviation of split frequencies: 0.015446
535500 -- (-1587.046) (-1597.412) [-1588.945] (-1592.298) * [-1590.805] (-1594.202) (-1593.492) (-1592.202) -- 0:00:32
536000 -- [-1587.172] (-1591.716) (-1590.157) (-1588.532) * [-1593.337] (-1587.538) (-1590.025) (-1591.931) -- 0:00:32
536500 -- [-1588.972] (-1588.562) (-1589.962) (-1588.980) * [-1592.917] (-1590.729) (-1591.262) (-1594.113) -- 0:00:31
537000 -- [-1587.898] (-1589.332) (-1589.431) (-1590.796) * (-1590.843) (-1588.437) [-1590.128] (-1592.339) -- 0:00:31
537500 -- [-1590.032] (-1587.851) (-1590.350) (-1587.900) * (-1589.335) (-1592.592) (-1589.431) [-1594.304] -- 0:00:31
538000 -- [-1591.963] (-1590.894) (-1591.684) (-1591.067) * [-1591.701] (-1592.542) (-1588.023) (-1592.869) -- 0:00:31
538500 -- [-1590.119] (-1593.268) (-1588.200) (-1590.655) * (-1588.988) (-1592.999) [-1591.466] (-1591.571) -- 0:00:31
539000 -- (-1588.244) [-1589.457] (-1589.777) (-1589.978) * (-1588.483) [-1588.090] (-1590.155) (-1590.963) -- 0:00:31
539500 -- (-1592.850) (-1595.565) (-1590.740) [-1588.387] * (-1587.511) [-1588.287] (-1589.826) (-1591.201) -- 0:00:31
540000 -- (-1593.216) (-1593.093) (-1587.569) [-1592.981] * (-1588.630) (-1593.678) (-1592.669) [-1591.200] -- 0:00:31
Average standard deviation of split frequencies: 0.015313
540500 -- (-1594.973) (-1588.852) [-1589.319] (-1595.928) * (-1595.208) (-1593.570) (-1591.112) [-1590.525] -- 0:00:31
541000 -- (-1592.788) (-1589.635) [-1590.785] (-1590.968) * (-1588.632) (-1591.212) (-1589.698) [-1595.181] -- 0:00:31
541500 -- (-1591.238) (-1590.242) (-1587.025) [-1589.726] * [-1588.379] (-1598.247) (-1591.348) (-1590.984) -- 0:00:31
542000 -- (-1588.376) [-1589.173] (-1589.479) (-1588.374) * [-1587.919] (-1595.382) (-1593.181) (-1591.588) -- 0:00:31
542500 -- [-1592.720] (-1589.764) (-1594.250) (-1589.287) * (-1590.868) [-1601.292] (-1588.908) (-1588.576) -- 0:00:31
543000 -- (-1592.018) (-1592.251) (-1588.227) [-1588.954] * [-1590.205] (-1593.242) (-1588.698) (-1587.714) -- 0:00:31
543500 -- (-1592.818) (-1589.341) [-1591.952] (-1592.574) * [-1588.650] (-1593.085) (-1589.344) (-1588.636) -- 0:00:31
544000 -- [-1590.369] (-1587.640) (-1590.027) (-1591.279) * [-1591.181] (-1591.370) (-1590.679) (-1591.110) -- 0:00:31
544500 -- (-1595.748) (-1593.085) (-1588.667) [-1589.941] * [-1592.072] (-1590.932) (-1590.369) (-1589.152) -- 0:00:30
545000 -- (-1592.626) (-1591.993) [-1589.684] (-1589.480) * (-1589.515) (-1592.634) [-1588.666] (-1591.476) -- 0:00:30
Average standard deviation of split frequencies: 0.015001
545500 -- (-1588.662) [-1589.363] (-1592.767) (-1592.437) * [-1591.616] (-1589.593) (-1589.517) (-1588.685) -- 0:00:30
546000 -- [-1590.922] (-1593.487) (-1594.000) (-1589.805) * (-1593.688) (-1594.503) (-1589.641) [-1589.931] -- 0:00:30
546500 -- (-1587.883) (-1590.186) (-1589.777) [-1591.241] * (-1591.025) [-1592.499] (-1590.259) (-1588.292) -- 0:00:30
547000 -- (-1589.766) [-1588.598] (-1589.744) (-1592.376) * [-1588.575] (-1593.825) (-1588.532) (-1589.375) -- 0:00:30
547500 -- [-1588.610] (-1590.332) (-1588.650) (-1591.158) * (-1590.853) (-1595.169) [-1589.408] (-1590.416) -- 0:00:31
548000 -- [-1589.869] (-1588.059) (-1588.116) (-1588.378) * [-1592.743] (-1591.351) (-1589.193) (-1588.901) -- 0:00:31
548500 -- (-1593.196) (-1587.376) (-1590.067) [-1588.241] * [-1589.976] (-1591.699) (-1588.111) (-1591.551) -- 0:00:31
549000 -- [-1590.110] (-1589.272) (-1590.364) (-1590.022) * (-1587.123) (-1591.457) [-1588.418] (-1595.278) -- 0:00:31
549500 -- (-1589.030) (-1590.725) [-1592.189] (-1590.520) * (-1589.219) (-1593.290) [-1587.797] (-1591.727) -- 0:00:31
550000 -- [-1589.622] (-1589.774) (-1592.294) (-1588.994) * (-1591.472) (-1591.511) (-1588.168) [-1588.339] -- 0:00:31
Average standard deviation of split frequencies: 0.014500
550500 -- [-1588.742] (-1592.161) (-1590.214) (-1587.420) * (-1592.235) (-1593.349) (-1591.928) [-1589.212] -- 0:00:31
551000 -- (-1589.782) (-1594.608) [-1591.826] (-1590.816) * [-1587.001] (-1590.787) (-1590.929) (-1591.267) -- 0:00:30
551500 -- (-1591.167) (-1592.679) [-1588.079] (-1586.296) * (-1589.905) (-1594.789) [-1591.881] (-1590.690) -- 0:00:30
552000 -- (-1593.387) (-1593.087) (-1587.654) [-1594.755] * [-1588.421] (-1588.907) (-1591.105) (-1592.049) -- 0:00:30
552500 -- [-1591.064] (-1590.480) (-1587.537) (-1594.496) * (-1590.079) (-1592.446) [-1590.867] (-1588.551) -- 0:00:30
553000 -- (-1590.107) (-1588.284) (-1589.228) [-1589.446] * [-1589.439] (-1590.886) (-1590.402) (-1594.292) -- 0:00:30
553500 -- (-1590.141) (-1589.356) [-1590.382] (-1592.280) * [-1591.543] (-1593.661) (-1589.896) (-1590.897) -- 0:00:30
554000 -- (-1588.235) [-1589.238] (-1591.810) (-1593.555) * (-1587.708) (-1596.095) [-1591.977] (-1592.071) -- 0:00:30
554500 -- (-1590.274) (-1589.963) (-1593.244) [-1593.102] * [-1588.603] (-1591.383) (-1589.929) (-1590.921) -- 0:00:30
555000 -- (-1589.560) (-1590.205) [-1591.108] (-1590.291) * (-1588.725) (-1591.184) (-1590.319) [-1591.942] -- 0:00:30
Average standard deviation of split frequencies: 0.014360
555500 -- (-1589.583) [-1589.964] (-1592.029) (-1590.406) * (-1590.666) (-1593.543) (-1590.310) [-1587.683] -- 0:00:30
556000 -- [-1591.876] (-1590.271) (-1587.804) (-1595.942) * (-1590.782) (-1594.177) (-1589.920) [-1590.289] -- 0:00:30
556500 -- (-1587.572) (-1590.394) [-1589.651] (-1592.120) * [-1588.858] (-1595.028) (-1590.951) (-1589.560) -- 0:00:30
557000 -- (-1589.304) (-1592.106) (-1590.270) [-1589.192] * (-1592.682) (-1592.342) (-1590.428) [-1593.673] -- 0:00:30
557500 -- (-1587.150) [-1591.113] (-1589.072) (-1588.453) * (-1592.124) (-1595.575) (-1590.474) [-1591.595] -- 0:00:30
558000 -- [-1587.563] (-1589.596) (-1588.059) (-1593.959) * (-1590.578) (-1590.013) [-1587.065] (-1590.634) -- 0:00:30
558500 -- (-1590.171) (-1591.196) (-1593.063) [-1588.274] * [-1592.754] (-1590.061) (-1588.568) (-1586.972) -- 0:00:30
559000 -- (-1589.141) (-1592.867) [-1590.699] (-1589.191) * (-1591.785) (-1590.108) [-1589.897] (-1590.615) -- 0:00:29
559500 -- [-1594.062] (-1592.630) (-1592.628) (-1587.604) * (-1589.343) (-1593.649) [-1590.057] (-1587.992) -- 0:00:29
560000 -- [-1589.985] (-1591.384) (-1589.872) (-1587.934) * (-1591.018) [-1592.468] (-1588.745) (-1587.384) -- 0:00:29
Average standard deviation of split frequencies: 0.014609
560500 -- [-1586.692] (-1594.575) (-1588.227) (-1587.761) * (-1589.086) (-1590.208) (-1590.074) [-1590.528] -- 0:00:29
561000 -- (-1588.347) (-1590.633) [-1594.128] (-1591.654) * [-1593.035] (-1598.705) (-1591.828) (-1590.134) -- 0:00:29
561500 -- [-1588.494] (-1589.391) (-1588.315) (-1591.660) * [-1592.492] (-1588.388) (-1588.787) (-1590.564) -- 0:00:29
562000 -- [-1590.569] (-1589.273) (-1590.599) (-1591.257) * (-1591.756) (-1591.383) [-1589.128] (-1590.497) -- 0:00:29
562500 -- [-1591.339] (-1592.844) (-1586.205) (-1591.364) * (-1588.894) (-1588.572) [-1588.010] (-1589.831) -- 0:00:30
563000 -- (-1587.038) (-1592.560) [-1589.592] (-1589.552) * [-1588.769] (-1590.661) (-1589.440) (-1594.207) -- 0:00:30
563500 -- (-1587.909) (-1595.841) (-1591.822) [-1591.570] * (-1589.763) (-1590.777) [-1588.627] (-1590.858) -- 0:00:30
564000 -- (-1588.382) (-1593.940) [-1589.849] (-1589.197) * (-1588.005) [-1589.899] (-1589.291) (-1591.171) -- 0:00:30
564500 -- (-1588.804) (-1594.391) [-1588.196] (-1592.275) * [-1587.451] (-1590.807) (-1591.534) (-1590.099) -- 0:00:30
565000 -- [-1587.071] (-1592.134) (-1590.596) (-1588.823) * (-1588.193) (-1592.247) [-1590.329] (-1587.296) -- 0:00:30
Average standard deviation of split frequencies: 0.013899
565500 -- (-1592.036) (-1591.411) [-1586.834] (-1590.167) * [-1589.737] (-1589.815) (-1592.889) (-1587.561) -- 0:00:29
566000 -- (-1591.238) [-1590.199] (-1594.096) (-1587.905) * (-1591.598) (-1589.780) [-1593.826] (-1592.742) -- 0:00:29
566500 -- (-1590.875) [-1590.278] (-1594.933) (-1589.125) * (-1594.730) (-1590.048) [-1590.673] (-1588.145) -- 0:00:29
567000 -- (-1589.439) [-1587.795] (-1594.901) (-1591.137) * [-1589.885] (-1592.194) (-1590.599) (-1587.622) -- 0:00:29
567500 -- (-1593.794) (-1591.103) [-1588.278] (-1597.930) * (-1588.299) (-1591.507) (-1592.712) [-1586.593] -- 0:00:29
568000 -- (-1594.776) (-1590.519) (-1590.744) [-1593.866] * (-1590.036) (-1591.440) [-1589.497] (-1587.565) -- 0:00:29
568500 -- (-1590.360) [-1588.196] (-1588.045) (-1592.539) * [-1590.684] (-1587.556) (-1589.790) (-1588.578) -- 0:00:29
569000 -- (-1590.870) [-1588.702] (-1590.844) (-1589.430) * [-1589.553] (-1593.811) (-1591.383) (-1589.932) -- 0:00:29
569500 -- (-1591.421) (-1589.976) (-1591.849) [-1590.776] * (-1590.468) (-1596.175) [-1587.996] (-1593.396) -- 0:00:29
570000 -- [-1595.256] (-1594.662) (-1591.816) (-1590.158) * (-1592.415) (-1592.678) (-1592.631) [-1590.212] -- 0:00:29
Average standard deviation of split frequencies: 0.013991
570500 -- (-1589.460) (-1596.271) [-1588.338] (-1592.160) * (-1596.757) [-1588.419] (-1589.637) (-1588.478) -- 0:00:29
571000 -- (-1590.920) (-1590.129) (-1590.800) [-1590.027] * (-1592.974) (-1587.940) [-1587.615] (-1595.999) -- 0:00:29
571500 -- (-1591.060) (-1588.234) [-1589.277] (-1590.228) * [-1589.134] (-1589.228) (-1591.102) (-1591.312) -- 0:00:29
572000 -- (-1590.088) (-1594.845) (-1587.853) [-1590.128] * (-1588.263) (-1593.702) (-1586.860) [-1591.313] -- 0:00:29
572500 -- (-1590.932) (-1590.202) (-1587.566) [-1588.020] * [-1592.579] (-1589.146) (-1590.273) (-1589.244) -- 0:00:29
573000 -- (-1590.608) (-1590.079) (-1588.882) [-1589.411] * (-1590.885) (-1594.240) [-1591.101] (-1590.607) -- 0:00:29
573500 -- (-1590.671) (-1586.148) (-1588.737) [-1590.825] * (-1590.146) (-1591.226) [-1587.411] (-1591.516) -- 0:00:29
574000 -- (-1590.154) [-1590.992] (-1588.958) (-1588.431) * (-1591.356) (-1592.471) (-1599.147) [-1594.100] -- 0:00:28
574500 -- [-1587.144] (-1588.029) (-1588.801) (-1592.162) * (-1594.183) [-1589.374] (-1590.485) (-1590.041) -- 0:00:28
575000 -- [-1587.994] (-1591.305) (-1597.591) (-1589.088) * [-1588.519] (-1596.068) (-1589.084) (-1590.377) -- 0:00:28
Average standard deviation of split frequencies: 0.014527
575500 -- (-1589.955) (-1588.050) [-1590.668] (-1590.273) * [-1589.696] (-1591.197) (-1591.027) (-1587.181) -- 0:00:28
576000 -- (-1589.664) (-1589.162) [-1588.744] (-1585.939) * (-1591.131) (-1590.687) [-1590.182] (-1587.943) -- 0:00:28
576500 -- (-1588.905) (-1588.426) [-1588.852] (-1589.591) * (-1590.898) (-1590.818) [-1589.002] (-1589.348) -- 0:00:28
577000 -- [-1588.685] (-1590.283) (-1591.195) (-1592.100) * (-1589.550) (-1590.608) (-1589.494) [-1588.448] -- 0:00:29
577500 -- (-1589.132) [-1585.984] (-1592.507) (-1590.287) * (-1589.665) [-1588.982] (-1589.716) (-1590.392) -- 0:00:29
578000 -- (-1591.120) (-1588.121) [-1591.220] (-1593.318) * [-1589.455] (-1591.872) (-1592.127) (-1593.650) -- 0:00:29
578500 -- [-1590.331] (-1587.147) (-1589.782) (-1587.848) * (-1591.201) (-1588.142) (-1590.901) [-1593.658] -- 0:00:29
579000 -- (-1590.165) (-1588.581) [-1591.785] (-1587.861) * (-1588.578) (-1588.568) [-1589.757] (-1591.864) -- 0:00:29
579500 -- [-1589.297] (-1588.631) (-1590.039) (-1589.204) * [-1590.134] (-1588.981) (-1592.767) (-1588.491) -- 0:00:29
580000 -- (-1589.179) [-1589.420] (-1591.250) (-1590.515) * (-1588.681) (-1589.151) [-1587.866] (-1590.870) -- 0:00:28
Average standard deviation of split frequencies: 0.015120
580500 -- (-1588.001) [-1588.275] (-1588.642) (-1588.962) * (-1591.660) [-1591.242] (-1590.007) (-1590.583) -- 0:00:28
581000 -- (-1589.635) (-1587.602) (-1587.219) [-1591.946] * (-1590.391) [-1589.076] (-1589.145) (-1591.369) -- 0:00:28
581500 -- (-1590.172) (-1587.412) [-1588.435] (-1591.962) * (-1590.343) (-1589.953) [-1589.369] (-1589.189) -- 0:00:28
582000 -- [-1591.055] (-1592.446) (-1590.580) (-1592.858) * (-1591.409) (-1590.326) (-1591.638) [-1590.311] -- 0:00:28
582500 -- (-1591.605) (-1592.863) (-1592.741) [-1589.328] * [-1588.739] (-1591.286) (-1592.481) (-1592.491) -- 0:00:28
583000 -- [-1589.545] (-1591.947) (-1587.334) (-1589.402) * (-1592.272) (-1592.730) (-1592.853) [-1588.295] -- 0:00:28
583500 -- [-1589.324] (-1587.750) (-1588.296) (-1594.592) * [-1590.198] (-1593.017) (-1587.133) (-1589.081) -- 0:00:28
584000 -- (-1590.347) [-1590.264] (-1587.871) (-1592.298) * [-1590.093] (-1592.969) (-1588.079) (-1591.120) -- 0:00:28
584500 -- (-1587.967) (-1588.786) (-1587.536) [-1590.721] * (-1592.192) (-1592.683) (-1589.529) [-1590.080] -- 0:00:28
585000 -- (-1588.689) [-1593.620] (-1590.143) (-1589.765) * (-1589.757) (-1588.480) (-1588.344) [-1588.042] -- 0:00:28
Average standard deviation of split frequencies: 0.015284
585500 -- (-1588.441) (-1589.873) [-1589.964] (-1596.799) * [-1589.996] (-1588.657) (-1589.937) (-1590.749) -- 0:00:28
586000 -- (-1593.766) (-1588.230) [-1589.469] (-1590.980) * (-1588.956) [-1588.125] (-1589.661) (-1590.068) -- 0:00:28
586500 -- [-1588.389] (-1590.783) (-1586.390) (-1590.248) * (-1592.193) (-1588.744) [-1588.108] (-1590.549) -- 0:00:28
587000 -- [-1589.689] (-1586.949) (-1590.244) (-1591.093) * (-1596.141) (-1590.677) (-1589.446) [-1589.682] -- 0:00:28
587500 -- (-1593.237) [-1589.909] (-1595.243) (-1591.386) * (-1592.043) [-1585.832] (-1589.075) (-1589.703) -- 0:00:28
588000 -- [-1588.840] (-1593.084) (-1589.212) (-1591.430) * (-1591.536) (-1588.037) (-1591.492) [-1590.200] -- 0:00:28
588500 -- [-1589.941] (-1597.962) (-1593.052) (-1590.892) * (-1591.001) [-1590.792] (-1595.023) (-1593.793) -- 0:00:27
589000 -- (-1591.412) [-1589.364] (-1589.394) (-1590.068) * [-1588.295] (-1591.216) (-1589.534) (-1589.779) -- 0:00:27
589500 -- (-1591.344) [-1588.849] (-1591.265) (-1587.539) * (-1591.964) (-1595.731) [-1588.334] (-1590.548) -- 0:00:27
590000 -- [-1587.767] (-1590.646) (-1595.412) (-1590.529) * [-1588.496] (-1596.062) (-1592.243) (-1588.739) -- 0:00:27
Average standard deviation of split frequencies: 0.015164
590500 -- (-1588.821) [-1587.854] (-1592.572) (-1591.039) * (-1588.021) (-1591.199) [-1589.994] (-1591.705) -- 0:00:27
591000 -- [-1590.636] (-1586.885) (-1593.473) (-1592.085) * (-1591.284) (-1593.390) (-1592.792) [-1591.495] -- 0:00:27
591500 -- (-1593.369) (-1588.529) [-1588.199] (-1592.059) * (-1591.153) [-1591.462] (-1589.652) (-1591.885) -- 0:00:28
592000 -- [-1588.325] (-1590.585) (-1591.571) (-1591.098) * (-1591.463) (-1590.158) [-1590.766] (-1589.506) -- 0:00:28
592500 -- (-1591.337) (-1589.770) (-1590.080) [-1591.240] * (-1587.116) [-1589.955] (-1587.415) (-1592.257) -- 0:00:28
593000 -- (-1587.141) (-1596.928) (-1591.894) [-1594.696] * [-1587.315] (-1591.675) (-1589.233) (-1596.273) -- 0:00:28
593500 -- [-1589.153] (-1588.102) (-1589.631) (-1591.401) * [-1588.926] (-1591.499) (-1590.130) (-1594.797) -- 0:00:28
594000 -- (-1587.308) (-1590.511) [-1590.935] (-1591.743) * [-1589.356] (-1593.057) (-1591.273) (-1593.246) -- 0:00:28
594500 -- (-1587.472) (-1587.688) [-1589.610] (-1589.492) * [-1587.843] (-1591.837) (-1589.046) (-1593.641) -- 0:00:27
595000 -- (-1592.362) (-1588.131) [-1591.616] (-1592.942) * (-1589.939) (-1591.452) (-1588.423) [-1589.556] -- 0:00:27
Average standard deviation of split frequencies: 0.015127
595500 -- (-1588.367) (-1592.407) [-1592.141] (-1591.796) * [-1591.606] (-1592.558) (-1592.560) (-1589.812) -- 0:00:27
596000 -- (-1588.263) (-1590.246) [-1590.926] (-1587.252) * (-1588.887) (-1590.075) [-1589.549] (-1591.187) -- 0:00:27
596500 -- (-1588.677) [-1588.563] (-1590.195) (-1591.113) * (-1588.572) [-1591.437] (-1590.531) (-1591.380) -- 0:00:27
597000 -- (-1590.716) (-1586.964) [-1588.740] (-1593.426) * [-1590.457] (-1592.466) (-1589.776) (-1595.513) -- 0:00:27
597500 -- (-1590.607) (-1589.995) [-1589.195] (-1589.871) * [-1590.755] (-1590.104) (-1591.012) (-1589.926) -- 0:00:27
598000 -- [-1589.014] (-1591.950) (-1589.173) (-1590.550) * [-1590.945] (-1591.935) (-1588.639) (-1591.033) -- 0:00:27
598500 -- [-1591.761] (-1592.012) (-1591.444) (-1591.988) * [-1587.121] (-1590.125) (-1591.100) (-1590.827) -- 0:00:27
599000 -- (-1590.160) (-1588.693) (-1591.494) [-1588.514] * (-1588.295) [-1590.360] (-1592.220) (-1594.312) -- 0:00:27
599500 -- [-1589.458] (-1588.785) (-1591.819) (-1593.103) * [-1587.656] (-1591.090) (-1589.919) (-1589.939) -- 0:00:27
600000 -- [-1590.098] (-1586.378) (-1590.952) (-1589.899) * [-1590.508] (-1592.206) (-1587.621) (-1589.123) -- 0:00:27
Average standard deviation of split frequencies: 0.015058
600500 -- (-1592.773) [-1587.004] (-1590.823) (-1594.607) * (-1595.912) [-1591.344] (-1591.077) (-1590.746) -- 0:00:27
601000 -- (-1594.019) (-1588.787) (-1594.157) [-1592.553] * (-1594.405) (-1590.101) (-1593.458) [-1587.596] -- 0:00:27
601500 -- (-1593.717) [-1592.980] (-1592.426) (-1592.159) * (-1595.916) (-1589.728) [-1591.646] (-1587.565) -- 0:00:27
602000 -- (-1590.926) (-1588.854) [-1591.315] (-1588.447) * (-1591.439) (-1591.451) [-1594.095] (-1588.798) -- 0:00:27
602500 -- (-1595.088) (-1589.059) (-1590.863) [-1589.124] * [-1587.480] (-1593.065) (-1592.754) (-1591.550) -- 0:00:27
603000 -- (-1589.038) [-1588.498] (-1591.311) (-1589.777) * [-1591.480] (-1590.247) (-1591.978) (-1594.220) -- 0:00:26
603500 -- [-1589.229] (-1590.807) (-1589.458) (-1591.329) * (-1588.373) (-1589.320) [-1590.525] (-1591.841) -- 0:00:26
604000 -- (-1594.124) [-1589.579] (-1590.020) (-1587.785) * (-1590.819) (-1590.775) (-1590.997) [-1592.798] -- 0:00:26
604500 -- (-1595.194) [-1587.220] (-1593.107) (-1588.486) * [-1587.802] (-1592.246) (-1591.129) (-1589.345) -- 0:00:26
605000 -- [-1588.093] (-1586.938) (-1593.729) (-1590.943) * [-1589.365] (-1593.615) (-1590.298) (-1588.818) -- 0:00:26
Average standard deviation of split frequencies: 0.014586
605500 -- (-1590.199) [-1587.708] (-1592.808) (-1591.914) * (-1590.461) (-1595.740) (-1593.784) [-1590.175] -- 0:00:26
606000 -- [-1590.290] (-1588.572) (-1593.877) (-1590.761) * (-1590.321) (-1591.402) (-1591.695) [-1590.544] -- 0:00:26
606500 -- [-1591.814] (-1589.929) (-1592.407) (-1589.235) * (-1591.159) (-1596.160) [-1590.614] (-1596.638) -- 0:00:27
607000 -- (-1592.912) (-1595.366) [-1591.084] (-1595.153) * (-1591.416) (-1588.700) (-1590.415) [-1590.912] -- 0:00:27
607500 -- (-1591.942) [-1588.934] (-1593.242) (-1587.703) * (-1592.448) [-1591.336] (-1590.558) (-1588.886) -- 0:00:27
608000 -- [-1593.443] (-1591.179) (-1594.412) (-1589.441) * (-1590.161) (-1590.274) [-1589.703] (-1589.940) -- 0:00:27
608500 -- (-1593.633) (-1591.650) (-1592.332) [-1590.948] * (-1591.042) (-1594.019) (-1589.295) [-1593.693] -- 0:00:27
609000 -- [-1590.306] (-1594.662) (-1590.724) (-1588.316) * (-1590.369) (-1592.204) (-1593.650) [-1591.907] -- 0:00:26
609500 -- (-1591.415) (-1590.685) [-1593.971] (-1589.700) * [-1588.073] (-1590.517) (-1590.421) (-1591.431) -- 0:00:26
610000 -- (-1589.482) (-1589.123) (-1594.366) [-1588.844] * (-1591.513) [-1589.980] (-1591.175) (-1590.886) -- 0:00:26
Average standard deviation of split frequencies: 0.013799
610500 -- (-1591.907) [-1590.796] (-1591.257) (-1587.840) * (-1596.228) (-1595.380) [-1589.592] (-1592.151) -- 0:00:26
611000 -- [-1589.882] (-1593.384) (-1588.103) (-1588.332) * [-1593.115] (-1589.861) (-1589.703) (-1590.560) -- 0:00:26
611500 -- (-1591.323) (-1591.124) (-1588.035) [-1590.745] * (-1594.661) [-1589.278] (-1594.528) (-1588.703) -- 0:00:26
612000 -- (-1588.103) [-1588.085] (-1589.068) (-1589.019) * (-1588.467) (-1589.620) (-1589.708) [-1590.058] -- 0:00:26
612500 -- (-1589.332) (-1591.227) (-1591.555) [-1589.924] * (-1589.079) (-1592.004) (-1596.281) [-1587.999] -- 0:00:26
613000 -- (-1589.897) (-1590.311) [-1589.310] (-1588.725) * (-1593.114) (-1592.350) (-1590.532) [-1590.938] -- 0:00:26
613500 -- (-1591.863) (-1592.013) (-1590.962) [-1592.348] * [-1589.867] (-1591.338) (-1591.425) (-1592.899) -- 0:00:26
614000 -- (-1588.978) (-1590.711) (-1590.381) [-1590.955] * (-1587.791) (-1590.841) (-1591.268) [-1589.335] -- 0:00:26
614500 -- (-1588.663) (-1590.070) (-1588.314) [-1589.458] * (-1591.509) (-1594.855) [-1590.026] (-1590.631) -- 0:00:26
615000 -- (-1588.917) (-1588.831) [-1590.636] (-1590.405) * (-1591.259) [-1591.376] (-1587.980) (-1588.273) -- 0:00:26
Average standard deviation of split frequencies: 0.013679
615500 -- (-1589.821) (-1590.353) [-1589.656] (-1590.187) * (-1597.158) (-1590.881) (-1589.601) [-1590.089] -- 0:00:26
616000 -- [-1588.628] (-1588.639) (-1589.114) (-1590.734) * (-1592.582) [-1587.774] (-1592.422) (-1590.599) -- 0:00:26
616500 -- (-1588.087) (-1590.340) [-1589.625] (-1590.519) * [-1589.132] (-1590.362) (-1593.301) (-1591.188) -- 0:00:26
617000 -- (-1590.503) [-1591.055] (-1591.558) (-1592.991) * [-1589.808] (-1589.356) (-1590.040) (-1590.133) -- 0:00:26
617500 -- (-1589.236) [-1593.565] (-1590.128) (-1590.221) * (-1590.324) (-1589.755) (-1590.725) [-1589.813] -- 0:00:26
618000 -- (-1588.779) (-1591.946) (-1590.222) [-1590.697] * (-1590.632) (-1592.907) [-1593.939] (-1590.838) -- 0:00:25
618500 -- (-1593.324) (-1591.344) [-1591.032] (-1590.934) * (-1592.011) [-1591.668] (-1589.724) (-1593.025) -- 0:00:25
619000 -- (-1592.744) [-1587.747] (-1593.199) (-1590.671) * [-1592.733] (-1588.653) (-1592.721) (-1590.274) -- 0:00:25
619500 -- (-1588.306) [-1589.618] (-1593.041) (-1592.760) * (-1594.692) (-1588.234) [-1591.111] (-1589.605) -- 0:00:25
620000 -- (-1588.691) (-1591.773) [-1589.445] (-1591.042) * (-1592.007) (-1590.200) (-1589.622) [-1591.269] -- 0:00:25
Average standard deviation of split frequencies: 0.013291
620500 -- [-1588.094] (-1591.381) (-1591.340) (-1590.687) * [-1588.467] (-1590.176) (-1589.847) (-1594.711) -- 0:00:25
621000 -- (-1590.601) [-1588.036] (-1589.306) (-1592.086) * (-1593.560) [-1589.147] (-1591.583) (-1596.340) -- 0:00:26
621500 -- (-1589.393) (-1586.463) (-1590.546) [-1591.197] * (-1592.095) (-1592.185) (-1587.211) [-1592.060] -- 0:00:26
622000 -- [-1590.523] (-1590.590) (-1589.619) (-1595.763) * [-1591.987] (-1588.270) (-1589.718) (-1589.607) -- 0:00:26
622500 -- [-1588.995] (-1591.787) (-1593.753) (-1595.501) * (-1590.937) (-1589.649) [-1589.717] (-1592.376) -- 0:00:26
623000 -- (-1587.203) (-1595.769) [-1589.822] (-1592.677) * (-1591.230) (-1590.127) [-1589.370] (-1590.795) -- 0:00:26
623500 -- [-1589.143] (-1590.430) (-1594.460) (-1592.727) * (-1593.139) [-1590.570] (-1591.611) (-1590.982) -- 0:00:25
624000 -- [-1587.748] (-1591.603) (-1591.054) (-1591.281) * (-1592.017) (-1592.553) (-1591.570) [-1589.914] -- 0:00:25
624500 -- [-1588.259] (-1591.555) (-1592.681) (-1590.733) * (-1592.622) (-1593.581) (-1590.014) [-1591.083] -- 0:00:25
625000 -- (-1589.570) (-1590.699) [-1589.418] (-1590.498) * [-1591.197] (-1593.572) (-1590.372) (-1592.633) -- 0:00:25
Average standard deviation of split frequencies: 0.014072
625500 -- (-1587.431) [-1588.079] (-1590.183) (-1592.496) * [-1591.418] (-1590.610) (-1591.660) (-1587.792) -- 0:00:25
626000 -- (-1589.179) [-1588.997] (-1589.133) (-1591.196) * (-1592.236) (-1589.451) (-1588.674) [-1590.378] -- 0:00:25
626500 -- (-1592.724) [-1588.912] (-1588.572) (-1589.438) * (-1593.896) (-1590.262) [-1587.554] (-1592.723) -- 0:00:25
627000 -- (-1594.931) (-1589.128) [-1588.117] (-1591.487) * (-1589.582) (-1592.897) (-1591.540) [-1590.914] -- 0:00:25
627500 -- [-1588.918] (-1596.043) (-1592.897) (-1591.626) * (-1589.769) [-1591.778] (-1589.173) (-1590.850) -- 0:00:25
628000 -- (-1590.814) (-1593.572) [-1592.537] (-1590.427) * [-1587.187] (-1589.223) (-1593.047) (-1590.661) -- 0:00:25
628500 -- [-1591.310] (-1588.688) (-1592.099) (-1595.319) * (-1590.222) [-1591.285] (-1590.351) (-1595.141) -- 0:00:25
629000 -- [-1589.904] (-1590.943) (-1590.444) (-1593.721) * [-1589.515] (-1590.035) (-1589.627) (-1591.683) -- 0:00:25
629500 -- (-1588.303) [-1591.971] (-1592.177) (-1594.070) * (-1588.594) (-1593.577) (-1589.855) [-1590.710] -- 0:00:25
630000 -- [-1589.490] (-1590.169) (-1589.935) (-1595.000) * [-1589.940] (-1588.516) (-1588.971) (-1590.637) -- 0:00:25
Average standard deviation of split frequencies: 0.013875
630500 -- (-1593.113) [-1589.443] (-1590.310) (-1588.707) * (-1590.814) (-1593.566) (-1590.966) [-1595.508] -- 0:00:25
631000 -- (-1590.556) (-1589.327) [-1590.240] (-1590.242) * [-1595.158] (-1595.968) (-1590.846) (-1593.190) -- 0:00:25
631500 -- [-1588.089] (-1591.223) (-1591.838) (-1590.466) * [-1589.177] (-1588.599) (-1593.465) (-1590.271) -- 0:00:25
632000 -- (-1592.538) [-1591.128] (-1591.308) (-1589.178) * [-1590.377] (-1589.977) (-1593.782) (-1588.059) -- 0:00:25
632500 -- (-1601.861) (-1591.110) [-1594.790] (-1592.778) * (-1589.403) (-1587.898) [-1589.820] (-1590.625) -- 0:00:24
633000 -- (-1591.540) [-1588.270] (-1594.838) (-1591.090) * [-1590.398] (-1591.943) (-1590.096) (-1590.848) -- 0:00:24
633500 -- [-1589.436] (-1588.872) (-1589.851) (-1596.403) * (-1590.777) (-1590.516) [-1589.725] (-1589.384) -- 0:00:24
634000 -- (-1590.036) (-1588.796) (-1588.663) [-1590.160] * (-1590.054) (-1593.450) (-1587.365) [-1588.236] -- 0:00:24
634500 -- [-1590.172] (-1588.205) (-1589.319) (-1593.876) * (-1592.640) (-1590.697) (-1589.365) [-1589.721] -- 0:00:24
635000 -- [-1585.921] (-1588.213) (-1591.177) (-1588.112) * (-1588.809) (-1590.074) [-1592.683] (-1596.585) -- 0:00:24
Average standard deviation of split frequencies: 0.013156
635500 -- [-1587.093] (-1589.652) (-1587.996) (-1589.245) * (-1591.795) (-1589.399) (-1590.311) [-1590.534] -- 0:00:24
636000 -- (-1590.186) (-1588.963) [-1590.000] (-1588.089) * (-1590.885) (-1592.053) (-1589.451) [-1590.014] -- 0:00:25
636500 -- (-1591.011) (-1587.852) (-1589.268) [-1590.634] * (-1589.928) (-1597.555) (-1593.026) [-1588.789] -- 0:00:25
637000 -- (-1589.740) [-1588.502] (-1590.860) (-1591.550) * [-1586.625] (-1589.118) (-1590.189) (-1591.727) -- 0:00:25
637500 -- (-1587.905) (-1592.354) (-1588.855) [-1589.803] * (-1590.427) (-1590.247) [-1589.295] (-1593.579) -- 0:00:25
638000 -- [-1587.520] (-1591.361) (-1590.141) (-1590.776) * (-1588.296) (-1591.051) (-1588.850) [-1592.718] -- 0:00:24
638500 -- [-1589.537] (-1592.947) (-1588.219) (-1591.638) * (-1586.846) (-1588.714) [-1588.846] (-1590.233) -- 0:00:24
639000 -- (-1587.790) (-1590.115) [-1589.946] (-1589.374) * (-1589.651) [-1590.339] (-1591.880) (-1591.001) -- 0:00:24
639500 -- (-1590.106) (-1588.783) [-1589.329] (-1592.315) * (-1590.520) (-1591.943) (-1591.089) [-1590.467] -- 0:00:24
640000 -- [-1588.027] (-1589.878) (-1590.317) (-1587.779) * (-1589.123) (-1593.065) (-1587.245) [-1593.229] -- 0:00:24
Average standard deviation of split frequencies: 0.012923
640500 -- (-1591.983) (-1589.324) (-1592.722) [-1590.022] * (-1588.710) (-1595.874) [-1590.871] (-1592.490) -- 0:00:24
641000 -- (-1589.569) (-1590.672) [-1590.651] (-1595.908) * (-1593.585) [-1589.224] (-1588.283) (-1591.502) -- 0:00:24
641500 -- (-1588.333) (-1590.186) [-1590.708] (-1589.701) * (-1592.948) (-1592.371) [-1587.056] (-1594.323) -- 0:00:24
642000 -- (-1588.653) [-1591.079] (-1590.611) (-1592.461) * [-1590.028] (-1590.651) (-1589.626) (-1591.575) -- 0:00:24
642500 -- (-1596.530) (-1589.425) (-1588.781) [-1591.927] * [-1590.232] (-1589.824) (-1589.064) (-1591.081) -- 0:00:24
643000 -- (-1591.037) (-1592.047) [-1589.623] (-1592.251) * (-1589.476) (-1590.705) [-1589.788] (-1590.619) -- 0:00:24
643500 -- (-1589.937) (-1592.943) (-1592.228) [-1588.876] * (-1588.736) (-1592.303) (-1590.158) [-1595.666] -- 0:00:24
644000 -- (-1590.188) (-1589.941) [-1591.738] (-1588.659) * [-1585.733] (-1589.640) (-1591.552) (-1597.125) -- 0:00:24
644500 -- (-1590.148) [-1590.077] (-1588.761) (-1589.311) * (-1593.294) [-1588.917] (-1591.329) (-1597.311) -- 0:00:24
645000 -- (-1591.060) (-1590.796) (-1588.733) [-1588.647] * (-1589.492) (-1590.796) [-1590.087] (-1591.176) -- 0:00:24
Average standard deviation of split frequencies: 0.012998
645500 -- [-1593.096] (-1594.286) (-1590.700) (-1589.180) * (-1589.435) [-1589.378] (-1592.522) (-1594.604) -- 0:00:24
646000 -- [-1590.122] (-1591.436) (-1588.104) (-1591.284) * [-1588.566] (-1594.850) (-1589.307) (-1590.821) -- 0:00:24
646500 -- [-1592.674] (-1594.261) (-1590.293) (-1589.420) * (-1590.701) (-1590.349) [-1590.137] (-1591.860) -- 0:00:24
647000 -- (-1594.594) (-1592.775) [-1591.411] (-1589.474) * (-1589.196) (-1592.083) (-1589.829) [-1591.292] -- 0:00:24
647500 -- (-1589.010) [-1588.934] (-1590.427) (-1593.872) * (-1590.691) (-1590.606) (-1591.629) [-1593.825] -- 0:00:23
648000 -- [-1588.861] (-1587.441) (-1589.468) (-1587.957) * (-1589.620) (-1589.513) (-1591.048) [-1589.697] -- 0:00:23
648500 -- (-1591.785) [-1587.873] (-1590.649) (-1588.707) * [-1590.244] (-1590.405) (-1590.492) (-1590.239) -- 0:00:23
649000 -- (-1596.064) [-1588.884] (-1590.502) (-1591.152) * (-1590.095) (-1591.116) (-1591.954) [-1591.781] -- 0:00:23
649500 -- (-1592.826) (-1590.810) (-1590.229) [-1591.067] * (-1592.211) (-1589.798) (-1588.146) [-1589.439] -- 0:00:23
650000 -- (-1593.455) (-1589.945) [-1587.592] (-1593.000) * (-1593.715) (-1592.585) (-1594.363) [-1590.073] -- 0:00:23
Average standard deviation of split frequencies: 0.013494
650500 -- (-1590.533) (-1592.300) [-1590.462] (-1589.886) * (-1592.901) (-1588.881) [-1590.288] (-1592.633) -- 0:00:24
651000 -- (-1592.454) [-1589.509] (-1590.991) (-1591.774) * (-1592.466) (-1588.512) (-1593.264) [-1589.990] -- 0:00:24
651500 -- (-1590.645) (-1592.812) (-1589.062) [-1591.432] * (-1592.921) (-1588.615) (-1595.080) [-1590.904] -- 0:00:24
652000 -- (-1589.975) (-1588.798) [-1592.085] (-1591.096) * (-1591.887) (-1593.392) [-1593.231] (-1592.647) -- 0:00:24
652500 -- (-1590.985) (-1590.719) [-1590.828] (-1588.716) * (-1594.123) (-1591.432) (-1599.051) [-1590.184] -- 0:00:23
653000 -- (-1589.378) (-1589.942) [-1592.092] (-1590.082) * (-1588.802) (-1591.471) (-1591.567) [-1590.535] -- 0:00:23
653500 -- (-1590.659) (-1586.743) (-1591.372) [-1591.173] * (-1593.338) (-1587.543) [-1590.075] (-1590.061) -- 0:00:23
654000 -- [-1591.346] (-1588.175) (-1591.174) (-1594.249) * (-1595.241) (-1589.410) [-1587.998] (-1592.577) -- 0:00:23
654500 -- [-1591.685] (-1592.674) (-1590.281) (-1591.659) * (-1591.924) [-1589.029] (-1588.116) (-1590.678) -- 0:00:23
655000 -- (-1591.239) [-1588.945] (-1590.369) (-1591.901) * [-1588.621] (-1586.778) (-1588.719) (-1590.326) -- 0:00:23
Average standard deviation of split frequencies: 0.012576
655500 -- (-1592.010) [-1589.311] (-1588.326) (-1593.341) * (-1590.219) [-1588.460] (-1589.810) (-1587.855) -- 0:00:23
656000 -- (-1591.824) [-1589.746] (-1589.040) (-1586.537) * (-1588.379) (-1588.249) (-1588.885) [-1588.182] -- 0:00:23
656500 -- (-1590.313) (-1590.119) [-1588.161] (-1592.078) * (-1591.826) [-1588.158] (-1589.034) (-1592.643) -- 0:00:23
657000 -- (-1592.058) (-1589.931) (-1591.231) [-1588.466] * (-1587.767) (-1589.571) [-1588.482] (-1589.487) -- 0:00:23
657500 -- (-1590.757) [-1590.144] (-1592.980) (-1590.100) * [-1592.104] (-1589.578) (-1594.088) (-1588.838) -- 0:00:23
658000 -- (-1593.944) [-1588.917] (-1595.774) (-1590.355) * (-1592.655) [-1589.666] (-1589.125) (-1587.932) -- 0:00:23
658500 -- [-1592.330] (-1588.295) (-1592.296) (-1591.234) * (-1590.697) (-1589.205) (-1590.246) [-1591.428] -- 0:00:23
659000 -- [-1594.401] (-1588.270) (-1589.616) (-1593.020) * (-1593.745) (-1592.616) (-1590.887) [-1589.878] -- 0:00:23
659500 -- (-1590.761) [-1591.975] (-1592.563) (-1589.541) * (-1595.431) (-1592.706) [-1590.508] (-1588.418) -- 0:00:23
660000 -- (-1590.263) (-1594.475) [-1588.927] (-1588.725) * (-1592.203) (-1589.172) (-1593.402) [-1586.705] -- 0:00:23
Average standard deviation of split frequencies: 0.011729
660500 -- (-1587.426) (-1591.838) (-1590.738) [-1590.030] * (-1590.033) (-1590.026) (-1593.175) [-1589.026] -- 0:00:23
661000 -- (-1591.422) [-1594.628] (-1595.042) (-1590.784) * (-1590.028) (-1595.274) (-1592.836) [-1589.728] -- 0:00:23
661500 -- (-1590.294) (-1593.778) [-1591.626] (-1590.406) * (-1590.920) (-1589.742) (-1590.034) [-1586.892] -- 0:00:23
662000 -- (-1592.730) (-1594.532) (-1588.820) [-1589.154] * (-1592.046) (-1590.695) (-1596.694) [-1590.794] -- 0:00:22
662500 -- (-1588.343) (-1590.507) (-1587.139) [-1588.838] * (-1592.352) [-1589.247] (-1594.421) (-1590.255) -- 0:00:22
663000 -- [-1591.987] (-1588.946) (-1588.855) (-1591.729) * (-1592.338) [-1588.879] (-1589.861) (-1589.899) -- 0:00:22
663500 -- (-1590.604) (-1591.235) [-1591.239] (-1590.761) * (-1590.339) [-1587.590] (-1594.551) (-1591.860) -- 0:00:22
664000 -- (-1587.406) [-1591.233] (-1590.186) (-1591.139) * [-1589.833] (-1590.279) (-1591.865) (-1590.656) -- 0:00:22
664500 -- (-1590.966) [-1591.795] (-1594.660) (-1588.028) * [-1590.608] (-1593.157) (-1590.041) (-1586.051) -- 0:00:22
665000 -- [-1590.195] (-1589.643) (-1593.556) (-1590.005) * (-1590.819) (-1593.963) [-1592.207] (-1590.042) -- 0:00:22
Average standard deviation of split frequencies: 0.011950
665500 -- (-1588.818) (-1589.923) [-1589.139] (-1591.784) * [-1591.426] (-1593.133) (-1591.485) (-1591.712) -- 0:00:23
666000 -- (-1589.272) (-1591.664) [-1590.324] (-1594.730) * (-1596.977) (-1595.338) [-1589.512] (-1592.738) -- 0:00:23
666500 -- (-1589.030) (-1600.307) (-1590.959) [-1589.511] * [-1590.915] (-1593.265) (-1590.669) (-1592.228) -- 0:00:23
667000 -- (-1590.633) [-1594.933] (-1591.760) (-1589.205) * (-1595.032) (-1590.166) [-1587.339] (-1594.591) -- 0:00:22
667500 -- (-1588.363) (-1596.371) [-1589.654] (-1592.356) * (-1593.559) (-1589.175) [-1589.510] (-1588.375) -- 0:00:22
668000 -- (-1588.622) (-1595.761) [-1590.236] (-1594.037) * (-1590.933) (-1591.820) (-1590.729) [-1588.790] -- 0:00:22
668500 -- (-1592.609) (-1593.699) [-1590.448] (-1596.897) * [-1591.033] (-1589.485) (-1590.617) (-1587.585) -- 0:00:22
669000 -- (-1589.318) (-1591.254) (-1590.876) [-1588.549] * (-1590.087) (-1588.365) (-1588.682) [-1588.150] -- 0:00:22
669500 -- (-1589.151) [-1590.763] (-1590.273) (-1589.073) * (-1593.343) (-1588.389) [-1588.611] (-1589.837) -- 0:00:22
670000 -- (-1592.196) (-1592.477) [-1587.443] (-1590.363) * (-1589.014) [-1588.547] (-1591.540) (-1590.131) -- 0:00:22
Average standard deviation of split frequencies: 0.011701
670500 -- (-1589.758) (-1593.655) (-1592.819) [-1588.528] * (-1590.556) (-1591.193) (-1589.751) [-1589.568] -- 0:00:22
671000 -- (-1591.354) (-1588.190) (-1595.289) [-1589.629] * (-1590.387) (-1589.489) (-1589.976) [-1589.599] -- 0:00:22
671500 -- [-1588.138] (-1590.984) (-1588.111) (-1590.326) * [-1593.894] (-1588.959) (-1591.498) (-1589.805) -- 0:00:22
672000 -- (-1591.441) [-1592.987] (-1592.943) (-1590.190) * (-1590.880) (-1588.135) [-1589.443] (-1590.292) -- 0:00:22
672500 -- (-1589.556) (-1593.108) (-1588.568) [-1589.495] * (-1591.499) (-1590.009) (-1591.632) [-1589.052] -- 0:00:22
673000 -- (-1589.018) (-1589.007) [-1588.124] (-1591.608) * (-1593.206) [-1587.853] (-1590.838) (-1588.130) -- 0:00:22
673500 -- (-1591.334) (-1589.604) (-1590.175) [-1588.855] * [-1587.975] (-1589.154) (-1593.775) (-1589.721) -- 0:00:22
674000 -- (-1590.056) (-1591.750) [-1589.470] (-1590.556) * (-1592.007) (-1589.294) [-1588.056] (-1593.549) -- 0:00:22
674500 -- [-1590.964] (-1587.919) (-1589.832) (-1588.123) * (-1589.851) (-1588.264) [-1590.199] (-1590.819) -- 0:00:22
675000 -- [-1589.081] (-1587.973) (-1587.220) (-1587.926) * (-1590.959) (-1589.838) [-1591.606] (-1591.461) -- 0:00:22
Average standard deviation of split frequencies: 0.011332
675500 -- [-1591.609] (-1587.963) (-1591.000) (-1591.845) * (-1591.930) (-1590.163) [-1588.484] (-1592.604) -- 0:00:22
676000 -- (-1593.393) [-1591.336] (-1593.297) (-1588.675) * (-1591.992) (-1589.642) (-1589.518) [-1589.721] -- 0:00:22
676500 -- (-1595.655) [-1590.268] (-1588.154) (-1589.242) * (-1592.233) [-1591.166] (-1589.785) (-1589.744) -- 0:00:21
677000 -- (-1592.184) (-1588.905) [-1589.779] (-1589.193) * (-1590.387) [-1592.486] (-1589.595) (-1591.794) -- 0:00:21
677500 -- (-1591.356) [-1587.325] (-1592.012) (-1590.698) * (-1587.139) (-1595.166) [-1591.586] (-1589.124) -- 0:00:21
678000 -- [-1591.075] (-1591.795) (-1588.851) (-1590.323) * (-1591.329) (-1590.875) [-1590.280] (-1593.143) -- 0:00:21
678500 -- (-1592.106) [-1588.780] (-1587.371) (-1595.610) * (-1591.556) (-1591.737) [-1588.229] (-1593.325) -- 0:00:21
679000 -- (-1590.306) (-1589.684) [-1588.442] (-1588.105) * (-1588.903) [-1590.153] (-1591.541) (-1594.518) -- 0:00:21
679500 -- (-1595.085) (-1588.661) [-1589.651] (-1587.124) * (-1592.384) (-1591.472) [-1592.145] (-1592.550) -- 0:00:21
680000 -- [-1591.730] (-1590.088) (-1591.917) (-1590.307) * (-1592.861) (-1591.421) (-1592.599) [-1588.827] -- 0:00:22
Average standard deviation of split frequencies: 0.011384
680500 -- (-1589.981) (-1595.917) [-1591.801] (-1592.129) * (-1589.345) (-1589.323) (-1588.872) [-1587.522] -- 0:00:22
681000 -- (-1589.294) (-1593.591) (-1591.583) [-1588.932] * (-1590.481) (-1589.464) (-1593.431) [-1591.357] -- 0:00:22
681500 -- (-1589.715) (-1595.186) (-1588.126) [-1587.445] * [-1590.240] (-1590.954) (-1591.134) (-1590.022) -- 0:00:21
682000 -- [-1589.415] (-1590.834) (-1591.885) (-1589.084) * (-1592.000) (-1592.048) [-1589.036] (-1590.208) -- 0:00:21
682500 -- (-1595.871) (-1588.710) (-1591.186) [-1589.268] * (-1591.814) (-1588.076) (-1590.478) [-1588.536] -- 0:00:21
683000 -- (-1591.617) (-1587.728) [-1589.036] (-1589.208) * (-1591.292) (-1587.615) (-1589.203) [-1588.106] -- 0:00:21
683500 -- [-1589.733] (-1590.324) (-1588.205) (-1588.830) * (-1591.393) (-1592.135) (-1592.767) [-1588.327] -- 0:00:21
684000 -- (-1591.271) (-1588.928) (-1589.271) [-1589.677] * [-1587.170] (-1590.009) (-1588.655) (-1588.460) -- 0:00:21
684500 -- [-1590.221] (-1594.220) (-1590.243) (-1588.851) * (-1588.556) (-1592.778) (-1593.144) [-1588.633] -- 0:00:21
685000 -- (-1591.015) (-1591.042) [-1589.257] (-1590.216) * (-1590.576) (-1590.643) [-1589.288] (-1590.937) -- 0:00:21
Average standard deviation of split frequencies: 0.010608
685500 -- (-1589.314) [-1587.799] (-1589.267) (-1589.166) * (-1595.273) (-1591.759) (-1590.667) [-1587.776] -- 0:00:21
686000 -- (-1593.218) [-1587.492] (-1590.888) (-1586.802) * (-1593.177) [-1591.026] (-1590.610) (-1589.186) -- 0:00:21
686500 -- (-1596.640) [-1590.181] (-1590.715) (-1590.528) * (-1590.416) (-1589.661) (-1588.840) [-1589.612] -- 0:00:21
687000 -- (-1598.341) [-1593.158] (-1590.533) (-1591.213) * (-1589.491) [-1588.215] (-1594.275) (-1589.145) -- 0:00:21
687500 -- (-1593.428) (-1588.422) [-1587.755] (-1591.061) * (-1587.893) (-1589.256) (-1588.716) [-1588.810] -- 0:00:21
688000 -- (-1592.047) [-1588.171] (-1593.694) (-1589.785) * [-1589.557] (-1590.088) (-1593.307) (-1593.429) -- 0:00:21
688500 -- [-1591.477] (-1589.031) (-1593.285) (-1591.333) * (-1590.999) [-1590.220] (-1590.840) (-1588.545) -- 0:00:21
689000 -- (-1591.502) (-1594.705) (-1595.302) [-1598.135] * (-1588.651) (-1594.463) [-1592.397] (-1589.785) -- 0:00:21
689500 -- [-1592.246] (-1594.255) (-1589.817) (-1591.099) * (-1592.662) [-1594.262] (-1593.401) (-1590.821) -- 0:00:21
690000 -- (-1599.256) (-1593.080) [-1589.576] (-1589.687) * [-1589.689] (-1590.747) (-1591.694) (-1590.682) -- 0:00:21
Average standard deviation of split frequencies: 0.010025
690500 -- (-1595.441) (-1589.997) (-1589.182) [-1590.487] * (-1591.372) (-1589.074) (-1590.554) [-1588.624] -- 0:00:21
691000 -- (-1593.757) (-1586.830) (-1590.337) [-1588.852] * (-1593.886) (-1587.726) [-1590.494] (-1590.724) -- 0:00:21
691500 -- (-1592.752) [-1587.349] (-1591.733) (-1588.075) * (-1590.277) (-1587.034) (-1587.601) [-1591.108] -- 0:00:20
692000 -- (-1593.418) [-1591.770] (-1587.924) (-1589.527) * (-1589.883) [-1589.725] (-1589.468) (-1590.068) -- 0:00:20
692500 -- (-1592.363) (-1590.605) [-1588.030] (-1589.680) * (-1590.473) (-1588.727) [-1587.093] (-1588.797) -- 0:00:20
693000 -- (-1590.890) (-1592.491) (-1590.102) [-1588.039] * (-1592.170) (-1590.981) [-1590.654] (-1589.451) -- 0:00:20
693500 -- (-1589.464) (-1591.299) (-1588.902) [-1589.064] * (-1591.686) (-1588.499) [-1589.720] (-1592.422) -- 0:00:20
694000 -- (-1593.198) (-1590.094) [-1589.948] (-1589.797) * (-1588.503) (-1589.885) [-1589.395] (-1590.879) -- 0:00:20
694500 -- [-1590.887] (-1591.324) (-1590.129) (-1596.042) * (-1587.988) (-1590.221) [-1589.524] (-1593.492) -- 0:00:20
695000 -- (-1593.068) (-1591.000) (-1589.639) [-1589.420] * [-1590.560] (-1592.545) (-1597.087) (-1592.338) -- 0:00:21
Average standard deviation of split frequencies: 0.010160
695500 -- (-1589.114) [-1591.637] (-1588.648) (-1588.809) * (-1587.677) (-1591.664) (-1592.908) [-1589.950] -- 0:00:21
696000 -- (-1592.105) [-1589.787] (-1589.717) (-1589.243) * [-1590.222] (-1592.526) (-1591.383) (-1588.767) -- 0:00:20
696500 -- (-1591.568) (-1589.017) [-1590.774] (-1594.229) * [-1587.885] (-1588.979) (-1593.097) (-1590.580) -- 0:00:20
697000 -- (-1589.084) [-1591.986] (-1588.946) (-1589.946) * (-1593.311) (-1588.950) (-1592.528) [-1589.944] -- 0:00:20
697500 -- [-1589.354] (-1588.581) (-1591.182) (-1588.424) * (-1591.760) [-1588.396] (-1593.404) (-1588.623) -- 0:00:20
698000 -- [-1589.685] (-1591.256) (-1590.853) (-1591.134) * (-1590.179) [-1587.963] (-1590.264) (-1594.355) -- 0:00:20
698500 -- (-1589.691) (-1586.973) (-1589.430) [-1588.385] * (-1590.994) (-1587.670) (-1590.898) [-1591.674] -- 0:00:20
699000 -- (-1590.050) (-1589.551) (-1590.065) [-1587.981] * [-1587.063] (-1588.659) (-1592.275) (-1589.843) -- 0:00:20
699500 -- (-1590.946) [-1589.085] (-1588.231) (-1589.403) * [-1588.018] (-1590.172) (-1591.757) (-1591.380) -- 0:00:20
700000 -- [-1588.730] (-1590.871) (-1588.295) (-1588.492) * (-1590.407) (-1589.013) [-1592.253] (-1591.104) -- 0:00:20
Average standard deviation of split frequencies: 0.009966
700500 -- (-1592.698) (-1589.919) [-1586.211] (-1590.922) * (-1588.627) (-1589.295) (-1594.497) [-1590.842] -- 0:00:20
701000 -- (-1588.888) [-1589.775] (-1589.677) (-1588.443) * (-1591.873) [-1588.361] (-1596.554) (-1591.116) -- 0:00:20
701500 -- [-1588.134] (-1591.268) (-1589.913) (-1589.279) * (-1588.511) [-1588.312] (-1590.500) (-1596.582) -- 0:00:20
702000 -- (-1587.797) (-1592.336) (-1594.089) [-1595.879] * (-1589.095) [-1591.006] (-1592.683) (-1591.484) -- 0:00:20
702500 -- (-1592.087) (-1588.099) [-1591.694] (-1590.985) * [-1589.576] (-1590.693) (-1592.112) (-1594.429) -- 0:00:20
703000 -- (-1589.830) (-1590.637) (-1588.143) [-1590.004] * [-1591.663] (-1589.815) (-1592.763) (-1593.350) -- 0:00:20
703500 -- [-1589.162] (-1589.514) (-1594.567) (-1590.928) * (-1588.072) [-1590.178] (-1590.613) (-1590.495) -- 0:00:20
704000 -- (-1588.826) [-1589.601] (-1595.164) (-1590.369) * (-1592.008) (-1590.395) (-1590.082) [-1591.990] -- 0:00:20
704500 -- [-1593.412] (-1596.583) (-1587.128) (-1592.933) * [-1596.484] (-1587.177) (-1589.827) (-1588.570) -- 0:00:20
705000 -- [-1592.723] (-1592.908) (-1587.272) (-1595.389) * (-1590.813) (-1589.598) (-1590.400) [-1590.292] -- 0:00:20
Average standard deviation of split frequencies: 0.010330
705500 -- (-1589.279) [-1589.801] (-1587.903) (-1595.687) * [-1589.327] (-1591.721) (-1592.557) (-1588.620) -- 0:00:20
706000 -- (-1586.298) (-1590.505) (-1591.338) [-1594.168] * (-1593.745) (-1591.466) [-1590.799] (-1592.015) -- 0:00:19
706500 -- (-1592.856) (-1589.297) (-1588.699) [-1590.709] * [-1590.058] (-1590.569) (-1594.917) (-1597.338) -- 0:00:19
707000 -- (-1592.232) (-1587.277) (-1594.843) [-1590.584] * (-1588.224) (-1589.165) (-1595.407) [-1592.102] -- 0:00:19
707500 -- (-1590.310) [-1588.156] (-1591.171) (-1593.322) * [-1588.743] (-1587.711) (-1592.993) (-1590.155) -- 0:00:19
708000 -- [-1591.710] (-1591.416) (-1591.350) (-1592.017) * (-1590.658) (-1589.357) (-1588.827) [-1590.491] -- 0:00:19
708500 -- (-1589.425) [-1588.994] (-1593.022) (-1588.516) * (-1591.654) (-1590.681) [-1588.460] (-1590.272) -- 0:00:19
709000 -- [-1589.672] (-1589.806) (-1589.547) (-1590.889) * [-1590.491] (-1593.989) (-1589.097) (-1599.660) -- 0:00:19
709500 -- (-1588.460) (-1592.181) [-1592.213] (-1588.465) * (-1590.683) (-1593.090) [-1593.033] (-1596.338) -- 0:00:20
710000 -- (-1593.093) (-1599.187) (-1589.451) [-1590.051] * (-1590.905) (-1590.539) (-1589.931) [-1593.707] -- 0:00:20
Average standard deviation of split frequencies: 0.010340
710500 -- (-1595.410) (-1596.411) [-1592.537] (-1590.857) * [-1588.979] (-1589.040) (-1588.176) (-1591.228) -- 0:00:19
711000 -- [-1598.576] (-1592.019) (-1589.464) (-1590.157) * (-1590.262) (-1589.811) (-1592.325) [-1594.042] -- 0:00:19
711500 -- (-1590.186) (-1588.553) [-1591.831] (-1588.114) * [-1590.651] (-1592.893) (-1593.396) (-1591.684) -- 0:00:19
712000 -- (-1591.427) (-1589.043) [-1587.327] (-1590.270) * (-1587.709) [-1590.713] (-1591.588) (-1588.492) -- 0:00:19
712500 -- (-1590.645) [-1590.391] (-1588.664) (-1588.711) * (-1589.671) (-1591.133) (-1590.272) [-1591.763] -- 0:00:19
713000 -- (-1594.033) (-1588.768) [-1588.928] (-1591.086) * [-1593.145] (-1590.710) (-1592.668) (-1589.088) -- 0:00:19
713500 -- (-1595.214) (-1596.526) [-1588.744] (-1588.299) * (-1593.676) (-1590.742) (-1594.624) [-1587.763] -- 0:00:19
714000 -- (-1589.386) (-1590.862) (-1590.993) [-1589.167] * (-1589.771) (-1591.564) (-1588.305) [-1588.570] -- 0:00:19
714500 -- (-1588.127) (-1588.099) [-1587.714] (-1591.113) * (-1590.447) (-1593.165) (-1591.458) [-1588.897] -- 0:00:19
715000 -- [-1588.870] (-1592.902) (-1589.463) (-1588.372) * (-1590.647) (-1593.759) (-1594.499) [-1587.789] -- 0:00:19
Average standard deviation of split frequencies: 0.010457
715500 -- (-1588.427) [-1590.203] (-1589.409) (-1590.240) * (-1588.472) (-1591.648) [-1595.398] (-1596.897) -- 0:00:19
716000 -- [-1590.993] (-1589.254) (-1589.667) (-1588.722) * (-1591.577) (-1592.473) [-1588.604] (-1587.218) -- 0:00:19
716500 -- [-1588.637] (-1591.396) (-1588.011) (-1587.826) * (-1589.918) (-1590.742) [-1589.340] (-1592.524) -- 0:00:19
717000 -- (-1592.089) (-1590.107) (-1591.283) [-1588.307] * (-1589.325) (-1589.841) [-1589.572] (-1589.347) -- 0:00:19
717500 -- (-1589.973) (-1591.597) (-1591.505) [-1589.251] * [-1589.711] (-1591.414) (-1587.007) (-1591.446) -- 0:00:19
718000 -- (-1591.699) (-1594.536) [-1590.273] (-1588.494) * (-1588.744) (-1588.602) [-1588.363] (-1587.713) -- 0:00:19
718500 -- (-1587.351) (-1591.403) (-1591.556) [-1590.383] * [-1589.477] (-1587.558) (-1588.267) (-1593.147) -- 0:00:19
719000 -- (-1597.164) (-1591.077) [-1587.547] (-1588.922) * (-1591.753) [-1586.582] (-1590.454) (-1589.855) -- 0:00:19
719500 -- (-1597.532) (-1592.548) (-1588.523) [-1589.478] * (-1589.466) (-1587.542) (-1592.899) [-1588.737] -- 0:00:19
720000 -- (-1591.995) [-1589.917] (-1593.693) (-1589.200) * (-1591.460) (-1587.978) [-1591.804] (-1592.445) -- 0:00:19
Average standard deviation of split frequencies: 0.010351
720500 -- [-1590.797] (-1590.445) (-1595.414) (-1592.958) * (-1593.035) [-1587.429] (-1591.879) (-1592.848) -- 0:00:19
721000 -- (-1593.493) [-1590.147] (-1590.636) (-1593.408) * (-1591.923) (-1591.365) [-1594.135] (-1593.263) -- 0:00:18
721500 -- (-1590.223) [-1590.223] (-1590.260) (-1590.229) * [-1590.820] (-1589.855) (-1589.044) (-1589.971) -- 0:00:18
722000 -- (-1589.360) (-1590.577) (-1589.871) [-1588.009] * (-1592.986) (-1589.042) [-1587.696] (-1588.991) -- 0:00:18
722500 -- (-1590.660) (-1593.562) (-1587.394) [-1587.906] * [-1589.222] (-1590.227) (-1590.985) (-1591.145) -- 0:00:18
723000 -- (-1591.025) (-1591.358) (-1590.575) [-1590.762] * (-1589.232) (-1590.822) [-1588.972] (-1589.524) -- 0:00:18
723500 -- [-1589.434] (-1592.418) (-1588.332) (-1588.315) * (-1590.017) (-1590.354) (-1588.794) [-1589.545] -- 0:00:18
724000 -- (-1590.326) (-1590.802) [-1589.269] (-1588.554) * (-1592.585) [-1589.340] (-1591.760) (-1594.238) -- 0:00:18
724500 -- (-1589.030) [-1588.938] (-1592.822) (-1588.194) * (-1591.024) [-1590.627] (-1592.863) (-1588.501) -- 0:00:19
725000 -- [-1586.342] (-1590.783) (-1590.792) (-1590.528) * (-1591.478) (-1593.660) [-1587.522] (-1588.871) -- 0:00:18
Average standard deviation of split frequencies: 0.010389
725500 -- [-1589.706] (-1591.259) (-1588.675) (-1590.460) * (-1593.447) (-1589.711) (-1588.878) [-1590.171] -- 0:00:18
726000 -- (-1591.193) (-1591.164) [-1590.603] (-1589.738) * (-1591.547) [-1589.617] (-1592.758) (-1596.637) -- 0:00:18
726500 -- (-1593.635) (-1590.928) [-1594.453] (-1591.193) * (-1594.801) [-1590.511] (-1589.309) (-1589.226) -- 0:00:18
727000 -- (-1590.097) (-1590.834) (-1586.719) [-1590.636] * (-1592.106) [-1589.528] (-1590.179) (-1588.774) -- 0:00:18
727500 -- (-1590.087) (-1589.079) [-1589.531] (-1591.227) * (-1593.843) (-1590.465) (-1588.195) [-1587.486] -- 0:00:18
728000 -- (-1589.418) [-1590.619] (-1592.572) (-1594.800) * (-1593.175) (-1592.796) (-1589.461) [-1590.890] -- 0:00:18
728500 -- (-1589.915) (-1589.656) [-1590.885] (-1593.739) * (-1590.483) (-1591.815) [-1590.175] (-1588.621) -- 0:00:18
729000 -- (-1590.586) [-1590.670] (-1594.619) (-1593.965) * (-1590.272) (-1594.680) (-1590.273) [-1588.323] -- 0:00:18
729500 -- (-1588.795) (-1588.303) (-1593.346) [-1589.283] * (-1590.505) (-1590.635) [-1591.240] (-1590.944) -- 0:00:18
730000 -- [-1588.705] (-1588.898) (-1587.062) (-1588.774) * (-1590.587) (-1591.656) [-1591.742] (-1588.185) -- 0:00:18
Average standard deviation of split frequencies: 0.010057
730500 -- (-1595.432) [-1587.742] (-1589.242) (-1592.027) * (-1590.404) (-1588.565) (-1593.744) [-1587.276] -- 0:00:18
731000 -- (-1588.044) (-1590.553) [-1587.157] (-1591.312) * [-1591.425] (-1594.849) (-1591.457) (-1587.920) -- 0:00:18
731500 -- (-1589.716) [-1588.526] (-1592.594) (-1592.139) * (-1587.838) (-1587.367) [-1592.227] (-1590.144) -- 0:00:18
732000 -- (-1588.873) (-1589.262) (-1592.476) [-1592.753] * [-1588.246] (-1590.413) (-1592.041) (-1589.733) -- 0:00:18
732500 -- (-1588.257) [-1590.567] (-1589.632) (-1590.807) * (-1589.005) [-1589.665] (-1593.425) (-1592.547) -- 0:00:18
733000 -- (-1588.270) [-1587.614] (-1591.102) (-1590.130) * (-1587.404) (-1590.236) (-1591.816) [-1588.659] -- 0:00:18
733500 -- (-1590.428) (-1590.445) [-1589.349] (-1593.512) * (-1590.451) [-1590.947] (-1591.155) (-1590.409) -- 0:00:18
734000 -- (-1588.548) (-1591.801) (-1589.264) [-1588.951] * (-1589.922) (-1589.222) (-1593.207) [-1588.842] -- 0:00:18
734500 -- (-1588.692) (-1590.715) [-1595.263] (-1594.147) * [-1588.774] (-1590.267) (-1591.146) (-1593.960) -- 0:00:18
735000 -- (-1589.594) [-1590.338] (-1595.170) (-1594.208) * (-1593.981) (-1591.347) [-1590.694] (-1590.001) -- 0:00:18
Average standard deviation of split frequencies: 0.010022
735500 -- [-1586.974] (-1591.335) (-1592.714) (-1591.120) * (-1587.275) [-1588.358] (-1588.845) (-1588.544) -- 0:00:17
736000 -- [-1588.971] (-1591.394) (-1589.844) (-1588.124) * (-1590.720) [-1589.929] (-1590.503) (-1591.381) -- 0:00:17
736500 -- (-1589.301) [-1591.935] (-1594.357) (-1586.456) * (-1591.761) [-1591.598] (-1591.025) (-1591.725) -- 0:00:17
737000 -- (-1590.616) (-1591.093) (-1592.825) [-1587.521] * [-1594.310] (-1589.059) (-1590.040) (-1588.924) -- 0:00:17
737500 -- (-1589.156) (-1595.049) [-1589.825] (-1590.379) * (-1589.936) [-1588.200] (-1592.463) (-1592.757) -- 0:00:17
738000 -- [-1588.469] (-1590.750) (-1593.946) (-1596.164) * [-1594.258] (-1590.816) (-1590.508) (-1589.612) -- 0:00:17
738500 -- (-1590.795) (-1590.379) (-1590.275) [-1589.957] * (-1589.409) (-1588.660) (-1589.847) [-1592.757] -- 0:00:17
739000 -- [-1590.397] (-1588.760) (-1592.083) (-1587.796) * (-1589.453) [-1589.559] (-1590.155) (-1590.357) -- 0:00:18
739500 -- [-1588.546] (-1592.622) (-1591.106) (-1588.687) * [-1589.257] (-1589.954) (-1589.940) (-1589.217) -- 0:00:17
740000 -- (-1592.127) [-1590.290] (-1590.049) (-1591.441) * (-1589.700) (-1588.374) [-1591.629] (-1590.056) -- 0:00:17
Average standard deviation of split frequencies: 0.010258
740500 -- (-1588.052) (-1588.502) [-1587.725] (-1596.601) * (-1589.171) (-1591.702) (-1591.152) [-1588.725] -- 0:00:17
741000 -- [-1589.144] (-1590.402) (-1591.618) (-1591.317) * (-1588.525) (-1586.942) (-1592.115) [-1588.575] -- 0:00:17
741500 -- (-1588.042) (-1591.360) (-1592.634) [-1592.036] * (-1591.794) [-1589.507] (-1594.772) (-1587.772) -- 0:00:17
742000 -- (-1589.764) [-1591.465] (-1590.607) (-1592.717) * [-1591.264] (-1593.310) (-1591.369) (-1590.522) -- 0:00:17
742500 -- (-1592.839) (-1590.868) (-1591.769) [-1589.996] * [-1588.369] (-1590.937) (-1592.965) (-1589.486) -- 0:00:17
743000 -- (-1589.793) (-1589.813) [-1588.800] (-1589.333) * (-1589.784) [-1589.875] (-1598.721) (-1588.257) -- 0:00:17
743500 -- (-1588.292) (-1595.032) [-1590.279] (-1588.720) * (-1592.844) [-1589.176] (-1592.514) (-1588.554) -- 0:00:17
744000 -- (-1590.860) (-1592.909) [-1589.229] (-1589.188) * (-1592.506) (-1591.200) (-1590.351) [-1590.337] -- 0:00:17
744500 -- (-1590.604) (-1593.123) [-1589.987] (-1589.838) * (-1588.118) [-1595.573] (-1593.230) (-1592.932) -- 0:00:17
745000 -- (-1593.342) (-1592.347) [-1589.727] (-1588.555) * (-1586.876) (-1594.617) (-1590.883) [-1591.069] -- 0:00:17
Average standard deviation of split frequencies: 0.009999
745500 -- [-1590.579] (-1592.882) (-1587.515) (-1591.005) * (-1590.798) (-1592.203) (-1589.509) [-1592.619] -- 0:00:17
746000 -- (-1591.917) [-1591.530] (-1587.385) (-1591.745) * [-1588.710] (-1593.634) (-1589.102) (-1596.267) -- 0:00:17
746500 -- (-1593.861) [-1590.558] (-1588.535) (-1590.429) * (-1592.958) (-1592.299) (-1590.272) [-1593.103] -- 0:00:17
747000 -- (-1594.033) (-1589.413) [-1588.248] (-1588.648) * [-1591.225] (-1592.990) (-1589.297) (-1592.606) -- 0:00:17
747500 -- (-1592.809) (-1588.298) (-1589.194) [-1588.919] * (-1590.180) [-1593.752] (-1589.918) (-1587.476) -- 0:00:17
748000 -- (-1592.701) [-1591.664] (-1591.254) (-1588.240) * (-1589.528) (-1591.566) [-1591.925] (-1589.332) -- 0:00:17
748500 -- [-1592.909] (-1591.082) (-1589.017) (-1588.992) * [-1589.332] (-1595.571) (-1592.145) (-1588.820) -- 0:00:17
749000 -- (-1590.455) (-1593.959) [-1589.821] (-1591.352) * (-1592.911) (-1594.744) (-1591.306) [-1588.377] -- 0:00:17
749500 -- (-1589.672) (-1590.312) (-1590.091) [-1589.134] * (-1592.753) (-1589.502) [-1590.835] (-1589.451) -- 0:00:17
750000 -- [-1591.423] (-1590.597) (-1587.561) (-1592.602) * [-1586.596] (-1590.227) (-1588.689) (-1591.272) -- 0:00:17
Average standard deviation of split frequencies: 0.010011
750500 -- [-1588.885] (-1590.537) (-1588.087) (-1591.552) * (-1587.326) (-1588.795) [-1589.223] (-1591.711) -- 0:00:16
751000 -- (-1590.621) [-1590.877] (-1588.659) (-1587.819) * (-1588.102) (-1588.620) [-1593.519] (-1591.002) -- 0:00:16
751500 -- (-1590.770) (-1594.138) (-1588.310) [-1587.414] * (-1588.069) (-1588.805) (-1591.044) [-1588.583] -- 0:00:16
752000 -- (-1586.971) [-1593.586] (-1589.850) (-1591.432) * (-1592.061) [-1593.576] (-1589.843) (-1589.624) -- 0:00:16
752500 -- (-1595.840) (-1587.577) [-1590.293] (-1588.062) * (-1591.996) (-1587.876) (-1588.370) [-1586.963] -- 0:00:16
753000 -- (-1594.647) [-1592.249] (-1590.172) (-1593.069) * (-1589.119) (-1589.081) [-1587.938] (-1589.612) -- 0:00:16
753500 -- (-1591.666) (-1589.515) [-1587.399] (-1587.029) * [-1590.108] (-1587.302) (-1587.263) (-1591.922) -- 0:00:16
754000 -- (-1588.921) [-1589.984] (-1591.128) (-1588.661) * [-1588.235] (-1588.815) (-1594.175) (-1590.946) -- 0:00:16
754500 -- (-1588.401) (-1588.881) [-1590.180] (-1588.324) * [-1592.309] (-1594.265) (-1590.155) (-1590.533) -- 0:00:16
755000 -- [-1587.562] (-1595.694) (-1589.769) (-1591.505) * (-1592.332) [-1590.615] (-1592.945) (-1598.075) -- 0:00:16
Average standard deviation of split frequencies: 0.009427
755500 -- (-1586.762) (-1590.284) (-1588.864) [-1588.568] * (-1592.740) (-1591.165) (-1589.178) [-1594.674] -- 0:00:16
756000 -- [-1588.905] (-1589.285) (-1590.361) (-1589.617) * [-1594.111] (-1589.855) (-1588.508) (-1589.686) -- 0:00:16
756500 -- (-1590.829) (-1586.978) [-1588.841] (-1590.043) * [-1590.447] (-1588.370) (-1587.748) (-1592.802) -- 0:00:16
757000 -- (-1589.203) (-1591.893) [-1592.265] (-1592.530) * (-1591.463) (-1587.464) (-1590.386) [-1588.986] -- 0:00:16
757500 -- (-1589.541) [-1589.769] (-1592.652) (-1588.913) * (-1593.547) (-1586.974) (-1595.583) [-1590.767] -- 0:00:16
758000 -- (-1586.760) [-1588.990] (-1590.733) (-1590.059) * (-1591.639) (-1590.331) (-1588.944) [-1588.147] -- 0:00:16
758500 -- (-1592.693) [-1590.607] (-1593.604) (-1590.696) * [-1587.862] (-1593.906) (-1589.695) (-1589.931) -- 0:00:16
759000 -- (-1594.447) (-1589.574) [-1588.551] (-1591.730) * (-1591.537) (-1590.481) (-1589.277) [-1588.921] -- 0:00:16
759500 -- [-1593.747] (-1589.839) (-1588.509) (-1593.895) * (-1593.768) [-1589.478] (-1592.418) (-1595.560) -- 0:00:16
760000 -- (-1592.610) [-1592.236] (-1594.841) (-1592.123) * (-1591.500) (-1595.734) (-1589.784) [-1593.742] -- 0:00:16
Average standard deviation of split frequencies: 0.009660
760500 -- (-1590.590) (-1591.011) (-1588.031) [-1590.245] * (-1590.017) (-1592.940) [-1592.646] (-1591.374) -- 0:00:16
761000 -- [-1589.354] (-1592.600) (-1589.813) (-1588.099) * (-1590.957) (-1592.095) (-1589.564) [-1591.343] -- 0:00:16
761500 -- (-1592.844) (-1593.895) (-1590.631) [-1595.974] * [-1590.924] (-1590.284) (-1591.002) (-1593.807) -- 0:00:16
762000 -- (-1592.831) (-1590.083) [-1590.128] (-1593.902) * (-1593.088) (-1591.752) (-1592.302) [-1594.004] -- 0:00:16
762500 -- (-1592.883) [-1586.917] (-1595.658) (-1599.743) * (-1593.220) [-1589.065] (-1594.153) (-1597.406) -- 0:00:16
763000 -- (-1593.202) [-1586.900] (-1589.632) (-1593.953) * (-1588.961) [-1590.445] (-1592.907) (-1587.566) -- 0:00:16
763500 -- (-1592.021) (-1591.574) (-1592.574) [-1590.560] * [-1591.415] (-1590.600) (-1591.276) (-1593.154) -- 0:00:16
764000 -- (-1593.063) (-1586.997) [-1591.443] (-1591.962) * (-1590.946) (-1593.785) [-1591.248] (-1592.365) -- 0:00:16
764500 -- [-1591.909] (-1590.226) (-1593.795) (-1594.379) * (-1592.805) (-1594.429) (-1591.437) [-1590.265] -- 0:00:16
765000 -- (-1590.791) [-1588.420] (-1591.228) (-1589.120) * (-1590.324) [-1591.108] (-1592.900) (-1588.752) -- 0:00:15
Average standard deviation of split frequencies: 0.009593
765500 -- [-1588.368] (-1592.293) (-1591.225) (-1591.819) * [-1593.242] (-1591.236) (-1592.283) (-1591.707) -- 0:00:15
766000 -- (-1590.864) (-1591.186) [-1589.426] (-1591.229) * (-1593.363) (-1594.866) [-1594.840] (-1589.111) -- 0:00:15
766500 -- (-1590.549) [-1586.388] (-1591.766) (-1591.065) * (-1589.137) (-1593.287) (-1591.203) [-1593.063] -- 0:00:15
767000 -- [-1591.369] (-1590.212) (-1588.510) (-1592.262) * (-1591.713) (-1594.484) (-1591.020) [-1590.247] -- 0:00:15
767500 -- (-1594.167) [-1593.128] (-1589.419) (-1592.222) * (-1588.909) (-1593.750) [-1590.747] (-1592.199) -- 0:00:15
768000 -- (-1590.613) (-1591.309) [-1589.695] (-1592.816) * (-1590.521) (-1592.653) (-1592.874) [-1591.685] -- 0:00:15
768500 -- (-1589.470) (-1589.934) (-1590.754) [-1591.084] * [-1588.994] (-1593.056) (-1591.155) (-1591.842) -- 0:00:15
769000 -- [-1590.499] (-1589.080) (-1589.353) (-1590.960) * (-1590.231) (-1590.275) [-1589.814] (-1591.504) -- 0:00:15
769500 -- [-1589.031] (-1588.381) (-1589.559) (-1589.598) * [-1593.138] (-1591.561) (-1589.933) (-1591.218) -- 0:00:15
770000 -- (-1591.903) (-1592.481) [-1587.872] (-1592.487) * (-1590.505) [-1594.238] (-1592.088) (-1590.438) -- 0:00:15
Average standard deviation of split frequencies: 0.009571
770500 -- (-1590.649) (-1593.554) (-1589.489) [-1591.093] * (-1589.369) (-1593.451) [-1592.770] (-1590.897) -- 0:00:15
771000 -- (-1588.742) (-1589.009) (-1588.254) [-1591.664] * (-1596.780) [-1591.643] (-1590.348) (-1588.504) -- 0:00:15
771500 -- (-1592.501) (-1592.857) (-1590.583) [-1589.170] * (-1589.110) (-1593.027) [-1593.050] (-1590.689) -- 0:00:15
772000 -- (-1590.028) (-1587.909) (-1589.948) [-1590.441] * [-1589.143] (-1593.615) (-1593.800) (-1591.058) -- 0:00:15
772500 -- (-1589.862) [-1588.596] (-1592.462) (-1591.506) * (-1589.587) (-1589.995) (-1594.586) [-1589.308] -- 0:00:15
773000 -- [-1587.281] (-1591.252) (-1589.519) (-1591.408) * (-1591.840) (-1590.909) (-1588.565) [-1588.554] -- 0:00:15
773500 -- (-1588.858) (-1591.065) (-1590.322) [-1591.418] * (-1590.312) (-1593.580) (-1589.768) [-1587.929] -- 0:00:15
774000 -- (-1588.111) (-1594.934) (-1593.030) [-1589.137] * (-1589.685) [-1591.804] (-1590.278) (-1588.845) -- 0:00:15
774500 -- [-1587.603] (-1590.009) (-1589.883) (-1588.023) * [-1592.945] (-1591.540) (-1590.478) (-1589.974) -- 0:00:15
775000 -- (-1595.128) (-1586.941) [-1587.915] (-1587.702) * [-1591.679] (-1589.365) (-1589.769) (-1588.636) -- 0:00:15
Average standard deviation of split frequencies: 0.009434
775500 -- (-1594.321) (-1586.241) (-1589.842) [-1587.873] * (-1594.811) (-1592.197) (-1590.129) [-1590.658] -- 0:00:15
776000 -- (-1589.985) (-1589.195) (-1590.409) [-1587.512] * [-1589.949] (-1592.567) (-1591.706) (-1589.238) -- 0:00:15
776500 -- (-1589.430) (-1590.385) [-1593.362] (-1590.473) * [-1590.148] (-1589.230) (-1588.716) (-1590.020) -- 0:00:15
777000 -- [-1588.983] (-1590.602) (-1589.306) (-1596.610) * (-1592.125) (-1590.907) (-1589.214) [-1586.817] -- 0:00:15
777500 -- (-1590.261) (-1587.828) [-1588.304] (-1593.394) * (-1592.360) [-1590.375] (-1589.896) (-1592.485) -- 0:00:15
778000 -- (-1591.527) (-1588.959) (-1592.117) [-1593.586] * (-1593.043) (-1591.354) (-1591.767) [-1592.671] -- 0:00:15
778500 -- [-1590.681] (-1591.287) (-1589.214) (-1590.721) * [-1589.424] (-1589.161) (-1589.693) (-1593.938) -- 0:00:15
779000 -- (-1591.264) (-1593.972) (-1587.932) [-1591.488] * (-1590.295) (-1588.644) (-1591.801) [-1587.933] -- 0:00:15
779500 -- (-1590.149) (-1591.847) (-1589.633) [-1590.066] * (-1591.482) [-1588.467] (-1592.547) (-1589.290) -- 0:00:14
780000 -- [-1592.777] (-1592.867) (-1592.214) (-1589.424) * (-1592.338) (-1588.963) (-1591.147) [-1589.864] -- 0:00:14
Average standard deviation of split frequencies: 0.009448
780500 -- (-1592.190) [-1588.604] (-1591.166) (-1589.701) * (-1594.045) (-1588.960) (-1592.466) [-1588.568] -- 0:00:14
781000 -- (-1596.648) (-1591.075) (-1592.465) [-1592.823] * (-1592.057) [-1590.311] (-1593.265) (-1594.259) -- 0:00:14
781500 -- (-1590.726) [-1590.404] (-1590.538) (-1587.620) * [-1589.461] (-1593.549) (-1591.721) (-1592.500) -- 0:00:14
782000 -- (-1588.318) [-1592.979] (-1589.837) (-1588.404) * [-1587.722] (-1592.027) (-1592.536) (-1592.304) -- 0:00:14
782500 -- (-1590.072) [-1589.869] (-1589.934) (-1590.528) * [-1590.763] (-1599.625) (-1593.129) (-1593.015) -- 0:00:14
783000 -- (-1590.814) (-1590.979) (-1592.735) [-1587.805] * [-1590.395] (-1589.570) (-1591.285) (-1590.162) -- 0:00:14
783500 -- (-1588.932) (-1590.136) [-1590.026] (-1589.947) * (-1590.558) (-1589.168) (-1590.744) [-1594.314] -- 0:00:14
784000 -- (-1590.711) (-1591.211) (-1590.011) [-1589.121] * (-1589.914) (-1591.598) (-1594.636) [-1589.620] -- 0:00:14
784500 -- (-1586.524) (-1592.586) (-1589.403) [-1590.431] * (-1590.131) [-1594.218] (-1590.699) (-1589.062) -- 0:00:14
785000 -- [-1589.411] (-1589.440) (-1596.351) (-1590.678) * [-1586.466] (-1592.192) (-1590.129) (-1590.644) -- 0:00:14
Average standard deviation of split frequencies: 0.008584
785500 -- (-1592.513) (-1592.172) (-1592.248) [-1590.836] * (-1587.754) [-1591.715] (-1591.913) (-1591.090) -- 0:00:14
786000 -- (-1593.695) [-1590.878] (-1593.621) (-1588.195) * [-1588.430] (-1589.540) (-1591.061) (-1587.740) -- 0:00:14
786500 -- (-1593.736) (-1592.176) [-1589.584] (-1590.460) * (-1590.749) (-1588.520) (-1589.054) [-1588.464] -- 0:00:14
787000 -- (-1593.847) [-1587.890] (-1589.977) (-1589.721) * (-1595.677) (-1591.983) [-1589.160] (-1588.203) -- 0:00:14
787500 -- [-1589.902] (-1590.385) (-1590.023) (-1587.603) * (-1594.688) (-1591.061) [-1589.503] (-1590.707) -- 0:00:14
788000 -- (-1589.567) (-1589.465) (-1589.263) [-1588.373] * [-1590.805] (-1593.477) (-1589.739) (-1589.617) -- 0:00:14
788500 -- (-1590.062) (-1589.991) (-1589.100) [-1588.591] * (-1588.595) (-1589.888) [-1590.466] (-1586.775) -- 0:00:14
789000 -- [-1587.413] (-1591.729) (-1588.752) (-1590.329) * (-1593.808) (-1587.791) (-1593.886) [-1593.428] -- 0:00:14
789500 -- (-1589.124) (-1590.396) (-1592.999) [-1591.081] * (-1588.688) [-1591.606] (-1591.590) (-1590.093) -- 0:00:14
790000 -- (-1590.685) [-1602.970] (-1586.895) (-1591.628) * (-1589.092) [-1590.370] (-1591.058) (-1587.448) -- 0:00:14
Average standard deviation of split frequencies: 0.008943
790500 -- (-1589.335) [-1591.004] (-1591.282) (-1589.158) * (-1590.347) (-1593.147) (-1587.948) [-1588.487] -- 0:00:14
791000 -- (-1591.844) (-1591.247) (-1588.798) [-1588.798] * [-1588.615] (-1594.493) (-1588.503) (-1589.823) -- 0:00:14
791500 -- (-1592.292) (-1591.658) (-1589.014) [-1588.493] * (-1588.287) (-1592.253) [-1589.713] (-1588.857) -- 0:00:14
792000 -- (-1590.259) (-1590.611) [-1590.673] (-1594.066) * (-1588.828) [-1586.516] (-1588.160) (-1591.479) -- 0:00:14
792500 -- (-1590.172) (-1590.094) (-1587.927) [-1591.306] * (-1591.572) (-1590.781) [-1587.644] (-1590.786) -- 0:00:14
793000 -- (-1589.995) [-1588.424] (-1588.790) (-1592.224) * (-1589.393) (-1595.844) [-1591.132] (-1595.483) -- 0:00:14
793500 -- [-1591.014] (-1589.276) (-1589.365) (-1590.209) * (-1590.886) (-1589.968) (-1599.663) [-1593.634] -- 0:00:14
794000 -- (-1591.622) (-1591.554) (-1590.129) [-1591.889] * [-1589.775] (-1590.394) (-1592.446) (-1593.361) -- 0:00:14
794500 -- (-1590.785) (-1592.099) (-1589.582) [-1588.467] * (-1593.793) [-1588.375] (-1592.795) (-1589.002) -- 0:00:13
795000 -- (-1588.430) (-1591.091) [-1591.195] (-1588.020) * (-1594.465) [-1589.132] (-1590.771) (-1587.439) -- 0:00:13
Average standard deviation of split frequencies: 0.008735
795500 -- (-1595.008) (-1591.935) [-1588.786] (-1587.968) * (-1588.538) (-1591.074) [-1589.224] (-1589.422) -- 0:00:13
796000 -- (-1588.312) [-1587.901] (-1587.870) (-1592.577) * (-1592.767) (-1594.188) [-1590.039] (-1590.765) -- 0:00:13
796500 -- (-1587.519) (-1592.042) (-1590.161) [-1588.786] * (-1595.988) [-1595.633] (-1591.179) (-1590.018) -- 0:00:13
797000 -- (-1592.126) (-1591.914) (-1592.430) [-1588.473] * (-1587.895) (-1591.793) [-1588.887] (-1589.631) -- 0:00:13
797500 -- (-1593.947) (-1593.177) (-1589.865) [-1589.023] * (-1589.432) (-1588.496) [-1590.848] (-1589.132) -- 0:00:13
798000 -- (-1588.816) (-1592.507) (-1590.196) [-1587.964] * (-1588.439) (-1590.951) (-1589.372) [-1594.483] -- 0:00:13
798500 -- [-1592.842] (-1588.564) (-1591.008) (-1591.427) * (-1590.711) (-1590.298) (-1588.545) [-1593.493] -- 0:00:13
799000 -- [-1590.065] (-1592.665) (-1593.693) (-1593.153) * (-1588.538) (-1596.703) [-1588.836] (-1593.921) -- 0:00:13
799500 -- (-1591.251) [-1593.436] (-1591.246) (-1591.972) * [-1589.605] (-1594.203) (-1588.149) (-1589.640) -- 0:00:13
800000 -- (-1592.005) (-1590.160) [-1593.073] (-1592.066) * (-1591.569) [-1590.798] (-1589.885) (-1591.281) -- 0:00:13
Average standard deviation of split frequencies: 0.008500
800500 -- (-1593.089) (-1588.191) [-1591.142] (-1590.332) * [-1592.076] (-1591.297) (-1589.498) (-1590.828) -- 0:00:13
801000 -- (-1589.547) [-1589.813] (-1591.176) (-1590.986) * (-1589.318) (-1593.541) [-1593.772] (-1589.068) -- 0:00:13
801500 -- (-1588.250) (-1586.248) [-1591.846] (-1595.320) * (-1592.150) (-1594.951) (-1592.347) [-1590.759] -- 0:00:13
802000 -- (-1594.413) [-1589.961] (-1594.957) (-1590.211) * [-1592.262] (-1593.139) (-1595.005) (-1589.840) -- 0:00:13
802500 -- [-1591.258] (-1591.006) (-1589.488) (-1590.770) * [-1588.606] (-1590.952) (-1590.909) (-1590.024) -- 0:00:13
803000 -- (-1588.003) [-1591.794] (-1593.628) (-1587.135) * (-1590.351) (-1596.820) [-1587.159] (-1592.602) -- 0:00:13
803500 -- (-1590.001) (-1591.361) (-1590.380) [-1587.339] * (-1590.758) (-1597.777) [-1590.050] (-1591.390) -- 0:00:13
804000 -- (-1592.623) (-1589.082) [-1586.775] (-1587.826) * (-1591.244) [-1591.815] (-1591.986) (-1594.081) -- 0:00:13
804500 -- (-1590.456) (-1588.810) [-1589.604] (-1593.223) * [-1591.098] (-1591.194) (-1589.682) (-1591.948) -- 0:00:13
805000 -- (-1589.883) (-1590.473) (-1589.361) [-1589.720] * (-1593.830) (-1589.156) [-1590.566] (-1593.403) -- 0:00:13
Average standard deviation of split frequencies: 0.008042
805500 -- (-1587.241) (-1592.184) (-1591.288) [-1593.756] * (-1591.656) (-1589.805) [-1590.302] (-1589.949) -- 0:00:13
806000 -- (-1591.592) [-1589.071] (-1591.522) (-1592.669) * (-1592.422) (-1593.069) [-1591.842] (-1591.046) -- 0:00:13
806500 -- (-1588.694) [-1590.245] (-1592.237) (-1591.243) * (-1589.256) (-1591.130) [-1593.105] (-1590.389) -- 0:00:13
807000 -- [-1587.710] (-1589.019) (-1590.184) (-1589.667) * [-1587.356] (-1592.216) (-1591.120) (-1593.048) -- 0:00:13
807500 -- [-1587.161] (-1593.614) (-1588.745) (-1588.592) * (-1590.989) (-1587.389) [-1589.562] (-1594.524) -- 0:00:13
808000 -- (-1589.014) (-1590.486) [-1590.112] (-1591.765) * (-1592.154) (-1588.190) [-1589.740] (-1593.825) -- 0:00:13
808500 -- (-1591.586) (-1590.621) (-1590.778) [-1590.438] * (-1591.260) [-1588.570] (-1589.736) (-1590.857) -- 0:00:13
809000 -- (-1588.741) (-1591.160) (-1589.329) [-1588.699] * [-1587.516] (-1589.085) (-1591.842) (-1594.599) -- 0:00:12
809500 -- (-1593.909) [-1589.068] (-1589.556) (-1591.319) * [-1589.667] (-1588.579) (-1591.621) (-1594.109) -- 0:00:12
810000 -- (-1592.078) (-1590.306) [-1592.120] (-1589.792) * (-1587.921) (-1588.968) (-1590.580) [-1589.694] -- 0:00:12
Average standard deviation of split frequencies: 0.008586
810500 -- (-1591.371) (-1591.731) (-1588.532) [-1593.920] * [-1588.317] (-1590.182) (-1592.603) (-1591.296) -- 0:00:12
811000 -- [-1592.328] (-1588.144) (-1590.151) (-1592.871) * (-1595.391) [-1588.102] (-1592.615) (-1590.881) -- 0:00:12
811500 -- [-1588.859] (-1586.845) (-1587.595) (-1591.218) * (-1592.337) [-1588.269] (-1592.394) (-1598.388) -- 0:00:12
812000 -- (-1589.742) [-1589.087] (-1591.753) (-1590.784) * (-1589.701) (-1588.512) (-1593.765) [-1592.059] -- 0:00:12
812500 -- (-1591.637) (-1591.060) [-1588.546] (-1594.325) * [-1591.799] (-1588.671) (-1590.534) (-1589.722) -- 0:00:12
813000 -- (-1589.843) (-1591.071) [-1589.665] (-1592.544) * (-1590.699) [-1589.822] (-1590.776) (-1588.184) -- 0:00:12
813500 -- (-1590.967) (-1589.618) [-1588.515] (-1590.669) * (-1598.636) (-1591.550) [-1591.356] (-1588.984) -- 0:00:12
814000 -- (-1590.717) (-1590.457) [-1591.071] (-1588.021) * (-1594.742) [-1588.597] (-1593.060) (-1588.972) -- 0:00:12
814500 -- (-1590.977) [-1589.768] (-1589.673) (-1592.745) * (-1592.000) (-1588.452) (-1591.337) [-1587.144] -- 0:00:12
815000 -- (-1590.904) (-1592.835) [-1589.981] (-1589.911) * (-1591.697) (-1588.826) [-1595.004] (-1590.854) -- 0:00:12
Average standard deviation of split frequencies: 0.008485
815500 -- [-1589.340] (-1590.915) (-1587.394) (-1591.760) * (-1592.628) (-1592.133) [-1587.202] (-1590.286) -- 0:00:12
816000 -- (-1587.789) (-1588.369) (-1589.484) [-1590.871] * [-1591.909] (-1590.561) (-1591.955) (-1589.483) -- 0:00:12
816500 -- (-1589.470) (-1590.001) (-1589.840) [-1589.981] * (-1592.260) [-1592.272] (-1591.285) (-1590.268) -- 0:00:12
817000 -- (-1590.076) (-1591.097) [-1595.111] (-1589.801) * [-1588.183] (-1596.045) (-1589.688) (-1591.389) -- 0:00:12
817500 -- (-1591.509) (-1590.617) [-1589.160] (-1590.965) * (-1591.674) [-1588.150] (-1589.665) (-1590.152) -- 0:00:12
818000 -- (-1593.461) (-1590.849) [-1591.220] (-1588.344) * (-1589.361) [-1591.880] (-1589.155) (-1589.207) -- 0:00:12
818500 -- [-1590.155] (-1591.318) (-1589.312) (-1591.392) * [-1591.345] (-1591.368) (-1594.306) (-1592.649) -- 0:00:12
819000 -- [-1590.678] (-1589.087) (-1592.858) (-1589.720) * [-1591.543] (-1589.931) (-1592.690) (-1588.577) -- 0:00:12
819500 -- (-1591.419) (-1594.595) [-1592.453] (-1588.754) * (-1590.554) (-1589.612) (-1591.134) [-1590.746] -- 0:00:12
820000 -- (-1592.951) (-1591.130) [-1591.488] (-1591.375) * (-1589.548) (-1589.766) [-1589.792] (-1589.653) -- 0:00:12
Average standard deviation of split frequencies: 0.008257
820500 -- (-1592.579) [-1590.484] (-1592.191) (-1589.147) * [-1591.347] (-1590.930) (-1590.549) (-1588.555) -- 0:00:12
821000 -- (-1590.414) (-1590.008) (-1592.982) [-1588.996] * (-1587.736) (-1592.166) [-1589.830] (-1589.806) -- 0:00:12
821500 -- (-1590.717) [-1588.240] (-1590.177) (-1589.832) * (-1591.291) [-1591.655] (-1587.500) (-1589.807) -- 0:00:12
822000 -- (-1593.682) (-1590.408) [-1590.457] (-1592.384) * (-1592.335) [-1592.478] (-1589.547) (-1590.958) -- 0:00:12
822500 -- (-1590.604) (-1588.567) (-1594.816) [-1590.749] * (-1591.895) (-1590.442) [-1588.889] (-1591.209) -- 0:00:12
823000 -- (-1591.386) [-1589.924] (-1590.176) (-1589.922) * (-1587.969) (-1590.273) [-1591.218] (-1592.590) -- 0:00:12
823500 -- [-1592.889] (-1593.078) (-1592.161) (-1589.897) * (-1593.314) (-1587.329) [-1589.485] (-1590.879) -- 0:00:12
824000 -- (-1591.702) [-1587.723] (-1591.259) (-1589.206) * (-1594.246) [-1588.105] (-1591.663) (-1592.452) -- 0:00:11
824500 -- [-1593.566] (-1589.723) (-1587.559) (-1592.479) * (-1594.722) [-1592.457] (-1592.084) (-1591.165) -- 0:00:11
825000 -- (-1591.195) (-1588.248) [-1587.827] (-1589.975) * (-1595.286) (-1592.397) [-1589.097] (-1588.558) -- 0:00:11
Average standard deviation of split frequencies: 0.007883
825500 -- [-1590.700] (-1594.897) (-1591.767) (-1592.883) * (-1595.448) [-1591.114] (-1592.852) (-1589.875) -- 0:00:11
826000 -- (-1590.347) (-1592.287) (-1590.933) [-1591.763] * (-1589.518) (-1589.354) [-1590.731] (-1589.936) -- 0:00:11
826500 -- (-1588.589) (-1592.988) (-1587.926) [-1591.731] * (-1590.086) (-1589.767) (-1591.387) [-1591.457] -- 0:00:11
827000 -- (-1592.253) (-1593.109) (-1589.054) [-1588.013] * (-1591.710) (-1591.097) [-1588.750] (-1591.103) -- 0:00:11
827500 -- (-1593.676) (-1588.900) [-1588.635] (-1596.040) * (-1589.450) (-1591.284) (-1591.911) [-1591.975] -- 0:00:11
828000 -- (-1591.744) (-1596.219) [-1588.287] (-1590.478) * [-1588.240] (-1591.861) (-1588.778) (-1589.726) -- 0:00:11
828500 -- (-1590.781) (-1592.754) [-1590.199] (-1593.015) * (-1589.775) (-1590.855) [-1593.887] (-1590.308) -- 0:00:11
829000 -- (-1591.550) (-1589.961) [-1588.663] (-1591.365) * (-1591.949) [-1589.791] (-1589.913) (-1591.166) -- 0:00:11
829500 -- (-1587.714) [-1588.836] (-1591.285) (-1592.209) * (-1589.383) [-1591.229] (-1591.457) (-1590.656) -- 0:00:11
830000 -- [-1587.238] (-1590.403) (-1594.267) (-1594.081) * (-1589.379) (-1592.770) (-1589.483) [-1592.674] -- 0:00:11
Average standard deviation of split frequencies: 0.007590
830500 -- [-1586.421] (-1589.878) (-1594.894) (-1595.848) * [-1591.336] (-1590.818) (-1591.237) (-1597.429) -- 0:00:11
831000 -- (-1592.020) (-1592.264) [-1588.201] (-1588.963) * (-1590.269) (-1588.715) [-1591.230] (-1591.666) -- 0:00:11
831500 -- (-1589.840) [-1586.918] (-1592.136) (-1591.412) * (-1590.417) [-1590.625] (-1590.088) (-1589.477) -- 0:00:11
832000 -- [-1589.787] (-1590.610) (-1594.128) (-1591.908) * (-1587.873) (-1590.929) (-1589.450) [-1590.578] -- 0:00:11
832500 -- (-1591.328) (-1588.298) (-1591.833) [-1589.582] * (-1589.600) (-1590.210) [-1591.329] (-1589.265) -- 0:00:11
833000 -- [-1590.512] (-1594.111) (-1589.189) (-1591.970) * (-1589.100) [-1590.765] (-1588.020) (-1590.370) -- 0:00:11
833500 -- (-1592.624) (-1594.546) [-1585.921] (-1589.804) * (-1589.888) (-1590.136) (-1587.447) [-1588.169] -- 0:00:11
834000 -- (-1590.209) (-1587.548) (-1588.899) [-1588.046] * (-1588.925) (-1589.904) (-1588.251) [-1588.670] -- 0:00:11
834500 -- (-1590.094) (-1596.651) [-1595.196] (-1592.849) * [-1589.715] (-1590.601) (-1590.558) (-1593.769) -- 0:00:11
835000 -- (-1589.550) (-1589.873) (-1590.399) [-1588.918] * [-1589.630] (-1589.479) (-1589.420) (-1589.184) -- 0:00:11
Average standard deviation of split frequencies: 0.007330
835500 -- [-1589.788] (-1588.427) (-1589.906) (-1589.795) * (-1587.551) (-1590.546) (-1594.962) [-1590.189] -- 0:00:11
836000 -- (-1592.162) (-1594.344) [-1587.037] (-1590.516) * (-1588.731) [-1589.635] (-1590.616) (-1596.154) -- 0:00:11
836500 -- (-1591.692) (-1588.971) (-1587.581) [-1589.445] * (-1588.651) (-1595.065) [-1587.807] (-1591.004) -- 0:00:11
837000 -- [-1591.276] (-1589.157) (-1590.377) (-1589.147) * (-1588.634) (-1589.561) [-1592.282] (-1591.909) -- 0:00:11
837500 -- (-1590.774) [-1590.839] (-1592.454) (-1588.803) * [-1587.712] (-1588.433) (-1588.527) (-1592.716) -- 0:00:11
838000 -- (-1589.920) (-1591.912) (-1593.378) [-1590.882] * (-1593.925) (-1590.874) (-1592.328) [-1590.132] -- 0:00:11
838500 -- (-1588.625) (-1590.980) [-1588.273] (-1591.304) * (-1590.798) (-1590.360) [-1590.662] (-1589.036) -- 0:00:10
839000 -- (-1591.801) (-1593.201) (-1592.075) [-1591.041] * (-1589.338) (-1589.934) [-1588.132] (-1593.043) -- 0:00:10
839500 -- (-1591.013) [-1589.657] (-1589.768) (-1593.855) * [-1592.626] (-1589.208) (-1591.409) (-1591.651) -- 0:00:10
840000 -- [-1589.205] (-1590.085) (-1592.341) (-1591.759) * [-1589.562] (-1589.869) (-1590.080) (-1593.754) -- 0:00:10
Average standard deviation of split frequencies: 0.007325
840500 -- (-1591.140) (-1589.469) [-1586.940] (-1593.602) * (-1588.862) (-1590.646) (-1593.119) [-1589.369] -- 0:00:10
841000 -- (-1593.294) (-1588.597) (-1587.676) [-1592.994] * (-1591.042) [-1588.284] (-1594.254) (-1593.926) -- 0:00:10
841500 -- (-1588.543) (-1590.752) (-1587.890) [-1591.925] * (-1592.527) [-1590.076] (-1593.491) (-1594.000) -- 0:00:10
842000 -- (-1589.379) [-1589.902] (-1592.172) (-1592.216) * (-1590.991) [-1587.972] (-1588.702) (-1596.818) -- 0:00:10
842500 -- [-1590.693] (-1587.958) (-1590.571) (-1588.499) * (-1591.255) (-1589.638) (-1592.536) [-1588.697] -- 0:00:10
843000 -- (-1588.685) [-1593.335] (-1592.390) (-1594.338) * (-1589.140) (-1588.229) (-1591.673) [-1588.580] -- 0:00:10
843500 -- (-1591.702) (-1590.462) (-1587.229) [-1589.962] * (-1591.482) (-1590.098) (-1591.314) [-1588.410] -- 0:00:10
844000 -- (-1590.484) [-1589.823] (-1588.056) (-1593.090) * (-1587.981) (-1592.105) (-1595.419) [-1588.060] -- 0:00:10
844500 -- [-1590.391] (-1589.562) (-1588.799) (-1590.041) * (-1590.029) (-1591.862) [-1589.011] (-1587.343) -- 0:00:10
845000 -- [-1588.542] (-1588.021) (-1592.166) (-1590.972) * (-1591.732) (-1587.032) (-1590.211) [-1586.658] -- 0:00:10
Average standard deviation of split frequencies: 0.007637
845500 -- [-1589.375] (-1591.433) (-1598.905) (-1590.368) * (-1590.640) (-1590.043) (-1593.074) [-1589.732] -- 0:00:10
846000 -- (-1590.841) (-1593.554) [-1588.967] (-1590.773) * (-1593.080) [-1592.119] (-1589.022) (-1587.247) -- 0:00:10
846500 -- (-1591.467) (-1591.045) (-1591.183) [-1589.297] * (-1588.550) (-1592.046) (-1587.660) [-1589.643] -- 0:00:10
847000 -- (-1587.202) (-1587.515) (-1589.986) [-1589.816] * (-1591.159) (-1591.986) (-1590.689) [-1590.360] -- 0:00:10
847500 -- (-1589.683) [-1587.421] (-1590.505) (-1590.119) * (-1591.783) (-1587.992) (-1590.152) [-1588.931] -- 0:00:10
848000 -- [-1593.216] (-1590.638) (-1591.374) (-1590.770) * (-1590.026) (-1589.942) (-1587.119) [-1590.536] -- 0:00:10
848500 -- [-1591.179] (-1591.824) (-1589.824) (-1594.894) * (-1589.704) (-1591.291) (-1587.508) [-1590.354] -- 0:00:10
849000 -- (-1588.639) (-1591.056) (-1588.544) [-1592.382] * (-1588.878) (-1590.892) [-1590.704] (-1588.312) -- 0:00:10
849500 -- (-1592.524) (-1589.022) (-1592.417) [-1588.900] * [-1588.076] (-1589.967) (-1587.904) (-1589.939) -- 0:00:10
850000 -- (-1588.123) (-1589.562) (-1590.578) [-1588.644] * (-1593.861) (-1589.897) [-1590.292] (-1592.755) -- 0:00:10
Average standard deviation of split frequencies: 0.007135
850500 -- [-1588.522] (-1591.039) (-1591.654) (-1589.005) * (-1594.980) [-1587.765] (-1589.602) (-1590.480) -- 0:00:10
851000 -- (-1593.082) (-1596.720) (-1589.850) [-1589.369] * (-1593.227) [-1590.728] (-1592.516) (-1589.310) -- 0:00:10
851500 -- (-1591.059) [-1592.297] (-1588.601) (-1591.031) * (-1589.728) (-1591.674) (-1589.654) [-1588.243] -- 0:00:10
852000 -- (-1589.676) (-1587.461) (-1590.533) [-1591.045] * (-1588.680) (-1591.140) (-1591.609) [-1588.556] -- 0:00:10
852500 -- (-1586.967) (-1589.355) [-1594.019] (-1592.949) * (-1591.361) (-1593.079) [-1589.411] (-1588.878) -- 0:00:10
853000 -- (-1588.255) [-1591.411] (-1590.781) (-1590.856) * [-1589.706] (-1595.639) (-1592.899) (-1590.451) -- 0:00:09
853500 -- (-1589.165) (-1591.403) [-1589.133] (-1589.817) * (-1591.143) (-1589.390) (-1593.711) [-1586.592] -- 0:00:09
854000 -- (-1589.063) (-1591.684) [-1587.790] (-1593.761) * (-1590.509) (-1592.740) (-1588.940) [-1589.381] -- 0:00:09
854500 -- (-1594.339) (-1588.415) [-1590.057] (-1594.290) * (-1587.928) [-1590.351] (-1590.122) (-1591.037) -- 0:00:09
855000 -- (-1595.941) (-1587.831) (-1591.261) [-1593.198] * (-1587.860) [-1588.059] (-1592.558) (-1588.951) -- 0:00:09
Average standard deviation of split frequencies: 0.007538
855500 -- (-1593.209) [-1590.275] (-1591.417) (-1591.812) * (-1589.647) (-1590.298) [-1593.523] (-1592.208) -- 0:00:09
856000 -- [-1589.772] (-1588.457) (-1593.707) (-1593.286) * [-1590.227] (-1592.113) (-1588.820) (-1592.730) -- 0:00:09
856500 -- [-1588.370] (-1587.647) (-1589.761) (-1594.513) * (-1600.545) (-1593.175) (-1589.443) [-1588.645] -- 0:00:09
857000 -- [-1593.492] (-1588.192) (-1589.786) (-1594.417) * [-1592.656] (-1591.878) (-1591.008) (-1589.372) -- 0:00:09
857500 -- (-1593.558) [-1590.347] (-1589.484) (-1589.419) * (-1590.521) (-1589.066) [-1588.583] (-1590.725) -- 0:00:09
858000 -- (-1591.381) (-1589.881) [-1591.292] (-1593.231) * [-1588.170] (-1587.012) (-1587.496) (-1592.432) -- 0:00:09
858500 -- [-1591.348] (-1591.859) (-1590.034) (-1590.966) * (-1590.477) (-1590.494) [-1590.772] (-1592.685) -- 0:00:09
859000 -- (-1587.726) (-1590.700) (-1592.102) [-1588.559] * (-1589.547) [-1590.309] (-1590.353) (-1591.144) -- 0:00:09
859500 -- (-1589.903) (-1586.977) (-1588.421) [-1590.743] * (-1589.593) (-1589.357) (-1591.127) [-1589.474] -- 0:00:09
860000 -- (-1590.647) [-1588.353] (-1586.933) (-1593.220) * [-1587.632] (-1590.038) (-1589.251) (-1594.421) -- 0:00:09
Average standard deviation of split frequencies: 0.007634
860500 -- (-1589.776) (-1590.924) [-1587.612] (-1590.009) * (-1589.462) [-1588.258] (-1590.379) (-1590.293) -- 0:00:09
861000 -- (-1590.827) (-1588.066) [-1587.163] (-1591.047) * [-1587.961] (-1586.840) (-1591.765) (-1589.819) -- 0:00:09
861500 -- (-1587.003) (-1591.859) [-1586.451] (-1589.095) * (-1590.660) [-1591.560] (-1589.527) (-1589.605) -- 0:00:09
862000 -- (-1596.464) [-1588.043] (-1588.079) (-1587.579) * [-1591.777] (-1588.393) (-1587.070) (-1592.205) -- 0:00:09
862500 -- [-1592.622] (-1589.556) (-1586.969) (-1587.465) * (-1589.620) (-1590.030) (-1589.916) [-1591.870] -- 0:00:09
863000 -- (-1587.182) (-1588.700) [-1591.106] (-1589.526) * (-1597.681) (-1590.031) [-1591.715] (-1588.790) -- 0:00:09
863500 -- (-1590.057) [-1594.649] (-1590.504) (-1591.562) * (-1590.005) [-1592.214] (-1588.059) (-1591.953) -- 0:00:09
864000 -- (-1588.400) (-1593.406) (-1589.126) [-1588.673] * [-1591.714] (-1588.467) (-1586.897) (-1595.319) -- 0:00:09
864500 -- (-1590.704) [-1588.330] (-1591.659) (-1592.062) * [-1589.571] (-1593.011) (-1591.652) (-1588.641) -- 0:00:09
865000 -- (-1591.700) (-1589.305) [-1595.291] (-1589.836) * (-1591.019) [-1594.227] (-1587.311) (-1594.197) -- 0:00:09
Average standard deviation of split frequencies: 0.007008
865500 -- (-1590.595) (-1588.425) (-1593.823) [-1587.876] * (-1587.909) (-1590.470) (-1591.250) [-1590.692] -- 0:00:09
866000 -- (-1588.512) (-1590.187) (-1591.196) [-1592.025] * (-1592.523) (-1589.408) (-1587.439) [-1590.583] -- 0:00:09
866500 -- (-1590.265) [-1588.720] (-1591.810) (-1590.138) * [-1589.695] (-1591.577) (-1589.730) (-1590.508) -- 0:00:09
867000 -- (-1590.657) (-1590.334) (-1591.847) [-1594.039] * (-1592.731) [-1591.132] (-1589.338) (-1593.715) -- 0:00:09
867500 -- (-1590.272) [-1592.061] (-1595.879) (-1588.784) * (-1597.568) (-1590.586) [-1587.381] (-1591.956) -- 0:00:09
868000 -- [-1591.172] (-1590.759) (-1590.231) (-1591.465) * (-1593.634) (-1591.625) [-1587.395] (-1591.406) -- 0:00:08
868500 -- (-1591.056) (-1590.870) [-1588.813] (-1591.512) * (-1593.153) (-1594.478) (-1587.288) [-1589.603] -- 0:00:08
869000 -- (-1592.570) [-1590.506] (-1591.855) (-1589.223) * (-1587.536) [-1590.985] (-1590.641) (-1588.972) -- 0:00:08
869500 -- (-1589.525) (-1587.236) (-1591.058) [-1591.992] * [-1587.569] (-1587.715) (-1591.917) (-1588.386) -- 0:00:08
870000 -- [-1590.939] (-1589.799) (-1589.041) (-1587.411) * (-1599.309) (-1589.094) (-1590.919) [-1592.901] -- 0:00:08
Average standard deviation of split frequencies: 0.006802
870500 -- (-1590.632) [-1589.955] (-1589.787) (-1590.806) * (-1597.083) (-1588.885) (-1596.089) [-1589.195] -- 0:00:08
871000 -- (-1589.936) [-1588.582] (-1591.170) (-1589.843) * (-1594.330) (-1591.109) [-1590.935] (-1589.704) -- 0:00:08
871500 -- (-1589.908) (-1589.228) (-1589.552) [-1589.443] * (-1590.046) (-1592.316) [-1588.807] (-1590.039) -- 0:00:08
872000 -- (-1588.550) (-1587.242) [-1589.404] (-1589.924) * (-1590.366) (-1598.952) [-1587.434] (-1588.928) -- 0:00:08
872500 -- [-1591.421] (-1592.700) (-1592.129) (-1588.142) * (-1588.008) (-1592.549) [-1587.557] (-1589.172) -- 0:00:08
873000 -- (-1589.773) (-1596.164) (-1594.101) [-1593.560] * (-1587.792) (-1588.052) [-1590.043] (-1588.292) -- 0:00:08
873500 -- (-1587.769) (-1592.342) [-1589.677] (-1589.004) * [-1591.495] (-1590.989) (-1589.265) (-1592.987) -- 0:00:08
874000 -- (-1591.008) (-1589.578) [-1587.194] (-1591.016) * (-1588.941) (-1590.529) [-1586.752] (-1590.855) -- 0:00:08
874500 -- (-1592.495) (-1590.310) [-1588.195] (-1592.052) * (-1590.774) (-1592.233) (-1588.566) [-1588.986] -- 0:00:08
875000 -- (-1586.662) [-1587.538] (-1587.341) (-1593.671) * (-1588.339) (-1588.896) [-1588.701] (-1590.092) -- 0:00:08
Average standard deviation of split frequencies: 0.007567
875500 -- (-1588.233) [-1587.224] (-1589.348) (-1590.128) * [-1588.669] (-1595.379) (-1590.855) (-1592.049) -- 0:00:08
876000 -- (-1587.279) (-1587.470) [-1588.321] (-1589.722) * [-1587.923] (-1595.052) (-1590.421) (-1589.621) -- 0:00:08
876500 -- (-1589.706) [-1586.996] (-1591.301) (-1588.547) * [-1590.476] (-1596.304) (-1596.309) (-1589.952) -- 0:00:08
877000 -- (-1586.416) (-1589.898) (-1589.820) [-1588.472] * [-1588.177] (-1592.509) (-1589.356) (-1594.006) -- 0:00:08
877500 -- (-1591.405) [-1592.306] (-1591.639) (-1596.248) * (-1592.316) (-1592.346) [-1590.090] (-1588.370) -- 0:00:08
878000 -- [-1592.565] (-1592.275) (-1589.050) (-1591.091) * (-1589.708) (-1593.765) (-1588.087) [-1588.967] -- 0:00:08
878500 -- (-1589.489) (-1588.865) [-1593.078] (-1588.471) * (-1589.311) (-1591.557) [-1588.459] (-1591.109) -- 0:00:08
879000 -- (-1592.396) (-1587.955) (-1589.293) [-1587.230] * (-1591.518) (-1589.124) (-1589.599) [-1591.090] -- 0:00:08
879500 -- [-1587.423] (-1588.080) (-1590.113) (-1589.155) * (-1591.454) [-1589.190] (-1591.774) (-1591.480) -- 0:00:08
880000 -- (-1590.807) (-1589.912) [-1590.655] (-1590.213) * (-1593.869) (-1589.999) [-1588.817] (-1589.927) -- 0:00:08
Average standard deviation of split frequencies: 0.007092
880500 -- (-1589.803) [-1588.303] (-1593.068) (-1590.827) * [-1592.144] (-1590.466) (-1590.854) (-1590.188) -- 0:00:08
881000 -- [-1589.064] (-1587.621) (-1588.519) (-1588.200) * (-1593.129) (-1588.687) (-1587.498) [-1591.213] -- 0:00:08
881500 -- (-1592.605) (-1587.153) (-1589.413) [-1593.243] * [-1587.727] (-1589.254) (-1587.490) (-1592.243) -- 0:00:08
882000 -- (-1587.183) [-1590.946] (-1589.380) (-1590.256) * [-1589.997] (-1590.460) (-1592.022) (-1594.449) -- 0:00:08
882500 -- (-1587.719) [-1590.241] (-1591.128) (-1590.460) * [-1586.585] (-1591.759) (-1587.282) (-1589.212) -- 0:00:07
883000 -- [-1594.353] (-1587.340) (-1592.897) (-1591.341) * (-1593.914) (-1592.550) (-1588.700) [-1589.669] -- 0:00:07
883500 -- (-1588.728) (-1591.479) [-1592.341] (-1589.649) * (-1593.924) [-1590.098] (-1591.189) (-1590.266) -- 0:00:07
884000 -- (-1590.741) [-1586.855] (-1591.448) (-1591.103) * (-1589.757) (-1591.103) [-1591.984] (-1590.267) -- 0:00:07
884500 -- [-1588.404] (-1588.267) (-1591.199) (-1589.402) * (-1589.916) (-1597.305) (-1592.446) [-1589.617] -- 0:00:07
885000 -- (-1591.895) (-1597.514) [-1594.409] (-1592.085) * (-1589.605) (-1589.047) (-1593.734) [-1587.362] -- 0:00:07
Average standard deviation of split frequencies: 0.007543
885500 -- [-1590.154] (-1595.418) (-1592.800) (-1592.361) * (-1586.859) [-1589.874] (-1589.202) (-1589.662) -- 0:00:07
886000 -- [-1588.604] (-1589.028) (-1593.971) (-1589.687) * (-1592.387) (-1590.418) [-1589.866] (-1590.033) -- 0:00:07
886500 -- (-1589.683) (-1592.266) (-1587.925) [-1590.807] * (-1588.554) (-1591.713) (-1593.277) [-1587.349] -- 0:00:07
887000 -- (-1589.694) (-1593.684) [-1588.606] (-1588.628) * [-1587.575] (-1587.736) (-1587.822) (-1591.973) -- 0:00:07
887500 -- (-1591.243) (-1588.224) (-1589.148) [-1590.307] * (-1588.482) (-1588.711) [-1589.819] (-1588.550) -- 0:00:07
888000 -- (-1588.739) [-1587.626] (-1588.970) (-1594.736) * (-1590.431) [-1588.744] (-1589.369) (-1587.509) -- 0:00:07
888500 -- (-1590.636) (-1588.109) [-1589.102] (-1590.427) * (-1592.117) (-1591.150) [-1594.046] (-1591.510) -- 0:00:07
889000 -- (-1592.080) [-1589.187] (-1592.415) (-1593.071) * [-1589.395] (-1589.622) (-1593.276) (-1591.145) -- 0:00:07
889500 -- (-1589.238) [-1592.089] (-1592.463) (-1589.873) * (-1591.153) [-1590.149] (-1592.390) (-1590.013) -- 0:00:07
890000 -- [-1589.803] (-1592.608) (-1586.141) (-1594.119) * (-1590.703) (-1588.409) [-1587.531] (-1590.818) -- 0:00:07
Average standard deviation of split frequencies: 0.007441
890500 -- [-1590.616] (-1591.657) (-1592.454) (-1589.960) * (-1590.813) (-1590.585) [-1590.262] (-1590.614) -- 0:00:07
891000 -- (-1589.494) (-1589.915) [-1590.940] (-1588.695) * (-1590.182) (-1598.001) (-1592.190) [-1589.396] -- 0:00:07
891500 -- (-1588.760) (-1589.780) [-1590.065] (-1590.103) * [-1587.933] (-1590.319) (-1593.754) (-1590.946) -- 0:00:07
892000 -- [-1588.654] (-1587.937) (-1591.345) (-1589.844) * [-1590.379] (-1589.512) (-1588.684) (-1590.315) -- 0:00:07
892500 -- (-1589.916) (-1590.374) (-1591.724) [-1590.793] * (-1588.455) (-1591.000) (-1591.157) [-1589.845] -- 0:00:07
893000 -- (-1589.122) (-1591.927) [-1591.273] (-1592.278) * (-1588.286) (-1590.774) (-1590.868) [-1588.068] -- 0:00:07
893500 -- (-1592.895) [-1587.822] (-1588.254) (-1594.443) * [-1589.350] (-1592.687) (-1589.484) (-1591.017) -- 0:00:07
894000 -- [-1589.558] (-1591.186) (-1591.765) (-1590.418) * (-1593.283) (-1589.428) [-1590.865] (-1589.585) -- 0:00:07
894500 -- (-1594.431) (-1588.002) (-1591.061) [-1590.303] * (-1597.719) (-1593.008) (-1590.451) [-1587.723] -- 0:00:07
895000 -- (-1588.950) (-1591.690) [-1589.297] (-1589.366) * [-1590.603] (-1589.972) (-1590.677) (-1591.068) -- 0:00:07
Average standard deviation of split frequencies: 0.007103
895500 -- [-1588.954] (-1591.628) (-1588.011) (-1592.041) * [-1590.283] (-1587.600) (-1589.807) (-1593.613) -- 0:00:07
896000 -- (-1587.925) (-1590.057) [-1587.918] (-1591.917) * (-1589.171) [-1589.194] (-1591.151) (-1591.932) -- 0:00:07
896500 -- (-1593.212) (-1594.669) (-1587.755) [-1589.819] * [-1591.186] (-1589.868) (-1588.282) (-1591.373) -- 0:00:07
897000 -- (-1591.364) (-1590.783) [-1588.115] (-1590.223) * [-1589.845] (-1590.154) (-1589.904) (-1591.552) -- 0:00:07
897500 -- (-1590.136) (-1593.650) (-1588.050) [-1588.518] * [-1590.334] (-1592.742) (-1587.480) (-1592.566) -- 0:00:06
898000 -- (-1588.071) [-1588.574] (-1592.638) (-1593.841) * [-1589.999] (-1590.016) (-1588.924) (-1594.491) -- 0:00:06
898500 -- (-1591.302) [-1588.959] (-1595.308) (-1591.642) * [-1589.944] (-1591.782) (-1588.496) (-1590.788) -- 0:00:06
899000 -- [-1590.962] (-1588.343) (-1588.490) (-1589.599) * [-1591.838] (-1591.262) (-1590.805) (-1592.378) -- 0:00:06
899500 -- (-1589.850) (-1590.018) (-1589.683) [-1587.161] * (-1589.556) (-1588.936) [-1590.325] (-1593.393) -- 0:00:06
900000 -- [-1587.218] (-1590.198) (-1591.634) (-1592.938) * (-1596.859) (-1590.681) (-1589.589) [-1592.790] -- 0:00:06
Average standard deviation of split frequencies: 0.007262
900500 -- (-1589.539) (-1589.944) [-1590.755] (-1591.500) * (-1593.318) (-1592.142) [-1588.729] (-1592.779) -- 0:00:06
901000 -- [-1591.660] (-1591.010) (-1586.814) (-1590.963) * (-1591.065) (-1593.236) (-1591.667) [-1590.185] -- 0:00:06
901500 -- (-1590.805) (-1590.771) (-1590.045) [-1591.285] * [-1593.378] (-1590.929) (-1590.067) (-1589.781) -- 0:00:06
902000 -- (-1589.960) [-1587.688] (-1588.437) (-1591.121) * (-1592.527) (-1592.021) (-1592.433) [-1587.439] -- 0:00:06
902500 -- (-1591.620) (-1589.270) (-1588.337) [-1589.427] * (-1593.605) (-1589.532) [-1591.437] (-1590.354) -- 0:00:06
903000 -- [-1589.625] (-1589.262) (-1591.113) (-1591.601) * (-1591.402) (-1590.616) [-1587.846] (-1590.156) -- 0:00:06
903500 -- (-1588.075) (-1588.013) (-1592.098) [-1590.367] * (-1592.515) [-1589.980] (-1593.611) (-1594.331) -- 0:00:06
904000 -- (-1588.574) [-1589.668] (-1588.219) (-1587.471) * (-1593.937) (-1597.041) (-1590.065) [-1591.414] -- 0:00:06
904500 -- (-1587.842) (-1588.330) (-1590.316) [-1591.012] * (-1587.451) (-1590.809) [-1590.611] (-1590.407) -- 0:00:06
905000 -- [-1591.310] (-1587.378) (-1592.745) (-1591.123) * [-1589.555] (-1591.004) (-1591.681) (-1592.817) -- 0:00:06
Average standard deviation of split frequencies: 0.007089
905500 -- (-1587.788) [-1588.328] (-1589.143) (-1590.230) * (-1591.234) (-1590.919) [-1589.242] (-1593.688) -- 0:00:06
906000 -- (-1589.503) (-1587.493) [-1591.025] (-1594.475) * [-1588.825] (-1590.193) (-1596.164) (-1593.795) -- 0:00:06
906500 -- (-1591.816) (-1590.855) [-1588.554] (-1591.395) * (-1592.838) [-1592.540] (-1591.403) (-1590.633) -- 0:00:06
907000 -- [-1590.524] (-1592.919) (-1593.755) (-1588.379) * (-1593.405) (-1594.728) (-1591.188) [-1592.383] -- 0:00:06
907500 -- (-1593.313) (-1588.660) (-1594.735) [-1588.185] * [-1588.800] (-1594.031) (-1590.386) (-1588.738) -- 0:00:06
908000 -- (-1589.833) (-1594.420) (-1590.723) [-1589.069] * [-1588.360] (-1588.571) (-1591.535) (-1590.713) -- 0:00:06
908500 -- [-1590.431] (-1592.887) (-1588.312) (-1592.491) * [-1590.430] (-1592.837) (-1588.453) (-1589.089) -- 0:00:06
909000 -- (-1595.199) (-1590.344) (-1589.116) [-1587.752] * (-1591.781) (-1588.316) [-1587.456] (-1590.456) -- 0:00:06
909500 -- [-1588.916] (-1590.558) (-1588.895) (-1588.463) * [-1590.553] (-1589.867) (-1591.381) (-1586.665) -- 0:00:06
910000 -- (-1590.147) (-1588.187) (-1590.594) [-1588.941] * (-1591.451) (-1591.128) (-1589.077) [-1588.784] -- 0:00:06
Average standard deviation of split frequencies: 0.007441
910500 -- [-1588.103] (-1591.273) (-1592.410) (-1589.206) * (-1590.044) (-1586.102) [-1589.385] (-1589.220) -- 0:00:06
911000 -- (-1590.370) (-1592.636) [-1589.446] (-1587.995) * [-1589.350] (-1592.302) (-1590.676) (-1587.436) -- 0:00:06
911500 -- (-1590.212) (-1592.958) [-1589.780] (-1587.220) * (-1590.424) (-1593.912) [-1589.624] (-1587.493) -- 0:00:06
912000 -- (-1591.959) (-1591.861) (-1591.659) [-1588.114] * [-1590.409] (-1593.685) (-1591.618) (-1590.344) -- 0:00:05
912500 -- (-1590.359) (-1591.746) [-1589.691] (-1588.173) * (-1594.824) (-1590.711) (-1590.943) [-1588.953] -- 0:00:05
913000 -- (-1592.779) (-1589.915) (-1589.926) [-1589.218] * (-1590.996) (-1588.355) [-1586.727] (-1591.004) -- 0:00:05
913500 -- (-1595.593) (-1590.682) (-1591.886) [-1590.240] * (-1594.886) (-1591.063) (-1588.921) [-1588.979] -- 0:00:05
914000 -- (-1591.651) (-1591.377) (-1593.938) [-1588.616] * (-1595.622) (-1592.131) [-1588.967] (-1590.569) -- 0:00:05
914500 -- (-1589.414) (-1592.524) [-1588.938] (-1589.487) * (-1596.022) [-1596.104] (-1591.710) (-1590.321) -- 0:00:05
915000 -- [-1588.372] (-1589.146) (-1587.605) (-1592.370) * (-1589.063) (-1592.878) (-1590.939) [-1590.647] -- 0:00:05
Average standard deviation of split frequencies: 0.007173
915500 -- [-1588.311] (-1594.614) (-1594.875) (-1593.344) * (-1592.144) (-1588.610) [-1591.767] (-1593.759) -- 0:00:05
916000 -- [-1588.115] (-1593.244) (-1594.145) (-1591.972) * (-1593.296) [-1590.530] (-1594.245) (-1591.909) -- 0:00:05
916500 -- (-1586.950) (-1591.584) (-1589.511) [-1592.461] * (-1591.619) (-1587.849) [-1590.768] (-1590.560) -- 0:00:05
917000 -- [-1591.133] (-1591.077) (-1593.052) (-1593.561) * [-1592.658] (-1590.685) (-1590.386) (-1587.661) -- 0:00:05
917500 -- (-1592.964) (-1589.484) [-1593.270] (-1593.667) * (-1590.557) (-1591.415) [-1588.144] (-1591.544) -- 0:00:05
918000 -- (-1591.591) [-1591.002] (-1593.652) (-1589.959) * [-1595.819] (-1590.136) (-1588.514) (-1590.654) -- 0:00:05
918500 -- (-1595.026) [-1588.802] (-1588.613) (-1591.935) * (-1594.288) (-1589.293) [-1591.085] (-1592.499) -- 0:00:05
919000 -- [-1591.035] (-1590.073) (-1593.115) (-1597.145) * [-1591.905] (-1588.554) (-1590.374) (-1590.175) -- 0:00:05
919500 -- (-1589.648) (-1589.198) [-1589.882] (-1593.119) * (-1590.606) [-1588.579] (-1587.657) (-1589.073) -- 0:00:05
920000 -- (-1589.386) (-1591.426) [-1592.276] (-1591.428) * (-1588.433) (-1593.724) [-1593.415] (-1590.585) -- 0:00:05
Average standard deviation of split frequencies: 0.007200
920500 -- [-1588.126] (-1592.326) (-1592.934) (-1590.635) * [-1586.690] (-1590.957) (-1588.539) (-1591.474) -- 0:00:05
921000 -- [-1589.189] (-1591.231) (-1589.346) (-1589.872) * (-1592.714) (-1590.832) (-1589.637) [-1593.121] -- 0:00:05
921500 -- [-1588.327] (-1590.321) (-1593.377) (-1590.700) * (-1592.619) [-1592.776] (-1591.548) (-1592.620) -- 0:00:05
922000 -- [-1589.087] (-1586.510) (-1589.921) (-1590.877) * (-1591.832) [-1591.586] (-1591.590) (-1590.462) -- 0:00:05
922500 -- [-1588.501] (-1588.595) (-1590.502) (-1589.761) * (-1592.899) (-1590.948) [-1587.615] (-1589.157) -- 0:00:05
923000 -- (-1589.032) (-1590.416) [-1586.909] (-1589.159) * [-1590.674] (-1589.771) (-1590.411) (-1591.213) -- 0:00:05
923500 -- (-1589.946) (-1589.840) [-1590.354] (-1589.839) * (-1588.580) (-1592.214) (-1590.065) [-1590.379] -- 0:00:05
924000 -- (-1592.677) (-1593.619) (-1590.946) [-1588.545] * (-1590.194) (-1590.331) [-1589.117] (-1592.349) -- 0:00:05
924500 -- (-1590.319) (-1591.777) [-1592.846] (-1590.633) * (-1594.877) (-1588.054) (-1589.504) [-1591.664] -- 0:00:05
925000 -- (-1589.135) [-1592.295] (-1594.943) (-1589.040) * (-1592.566) [-1593.144] (-1590.369) (-1595.350) -- 0:00:05
Average standard deviation of split frequencies: 0.007000
925500 -- (-1588.037) (-1589.831) [-1595.588] (-1591.113) * [-1591.364] (-1595.980) (-1588.766) (-1590.099) -- 0:00:05
926000 -- [-1590.056] (-1591.178) (-1588.827) (-1594.485) * [-1588.203] (-1592.899) (-1587.681) (-1590.905) -- 0:00:05
926500 -- (-1591.995) (-1591.952) [-1592.353] (-1590.775) * (-1590.927) (-1592.224) (-1593.906) [-1589.762] -- 0:00:04
927000 -- (-1591.674) [-1590.043] (-1592.049) (-1589.689) * [-1593.215] (-1590.887) (-1596.079) (-1591.512) -- 0:00:04
927500 -- [-1590.017] (-1589.230) (-1590.894) (-1587.162) * (-1590.964) [-1590.665] (-1590.600) (-1588.588) -- 0:00:04
928000 -- (-1592.476) (-1592.610) [-1589.270] (-1593.029) * [-1587.565] (-1591.835) (-1589.826) (-1593.136) -- 0:00:04
928500 -- [-1589.152] (-1587.446) (-1591.131) (-1592.893) * (-1590.568) [-1592.784] (-1589.475) (-1589.087) -- 0:00:04
929000 -- [-1587.810] (-1588.487) (-1590.250) (-1592.371) * (-1591.302) (-1589.350) (-1592.422) [-1588.433] -- 0:00:04
929500 -- (-1589.194) [-1588.739] (-1589.013) (-1589.339) * (-1589.702) [-1587.530] (-1588.470) (-1589.525) -- 0:00:04
930000 -- (-1591.319) (-1588.198) (-1589.533) [-1589.087] * (-1592.843) (-1590.860) (-1590.315) [-1592.088] -- 0:00:04
Average standard deviation of split frequencies: 0.007123
930500 -- [-1587.729] (-1586.474) (-1590.020) (-1588.793) * [-1588.358] (-1589.355) (-1593.693) (-1589.173) -- 0:00:04
931000 -- [-1587.777] (-1589.569) (-1589.908) (-1588.960) * [-1588.241] (-1589.935) (-1590.719) (-1589.366) -- 0:00:04
931500 -- (-1588.055) (-1591.381) (-1590.789) [-1589.670] * (-1588.935) (-1589.683) [-1591.848] (-1587.772) -- 0:00:04
932000 -- (-1594.583) [-1588.694] (-1588.142) (-1591.947) * (-1593.687) [-1589.929] (-1591.016) (-1592.925) -- 0:00:04
932500 -- (-1587.383) (-1588.573) (-1591.165) [-1590.357] * (-1590.185) (-1587.546) (-1593.199) [-1590.074] -- 0:00:04
933000 -- (-1589.848) (-1591.026) (-1590.783) [-1589.447] * (-1590.867) [-1590.804] (-1588.506) (-1587.912) -- 0:00:04
933500 -- (-1589.468) (-1588.307) [-1587.861] (-1588.936) * [-1589.475] (-1594.887) (-1591.617) (-1588.858) -- 0:00:04
934000 -- [-1590.007] (-1588.247) (-1589.027) (-1588.829) * (-1589.993) (-1590.977) [-1589.155] (-1591.236) -- 0:00:04
934500 -- [-1590.140] (-1590.378) (-1589.596) (-1587.121) * (-1591.798) (-1590.398) [-1592.486] (-1592.309) -- 0:00:04
935000 -- (-1590.058) (-1591.682) [-1591.206] (-1589.013) * (-1589.093) [-1592.993] (-1592.536) (-1587.717) -- 0:00:04
Average standard deviation of split frequencies: 0.007366
935500 -- [-1588.385] (-1589.655) (-1590.165) (-1590.284) * (-1593.910) (-1593.034) (-1595.810) [-1589.611] -- 0:00:04
936000 -- (-1596.684) (-1592.436) (-1589.143) [-1588.475] * (-1588.873) (-1593.056) (-1589.674) [-1590.487] -- 0:00:04
936500 -- [-1587.917] (-1592.352) (-1591.694) (-1588.719) * (-1590.922) (-1590.477) (-1588.530) [-1588.621] -- 0:00:04
937000 -- [-1590.440] (-1592.464) (-1587.444) (-1590.997) * (-1592.792) (-1589.871) (-1591.155) [-1590.713] -- 0:00:04
937500 -- (-1591.052) (-1594.983) (-1594.902) [-1592.603] * (-1597.911) [-1591.343] (-1594.860) (-1594.277) -- 0:00:04
938000 -- (-1592.646) (-1588.390) (-1593.551) [-1591.733] * (-1588.649) (-1592.941) [-1588.460] (-1591.188) -- 0:00:04
938500 -- (-1593.533) (-1589.180) (-1594.900) [-1590.028] * [-1587.699] (-1593.811) (-1591.163) (-1592.487) -- 0:00:04
939000 -- [-1590.357] (-1595.634) (-1594.817) (-1590.348) * (-1590.950) (-1590.927) [-1588.673] (-1588.568) -- 0:00:04
939500 -- (-1597.412) [-1590.992] (-1592.062) (-1592.575) * (-1588.582) [-1587.786] (-1590.902) (-1594.101) -- 0:00:04
940000 -- (-1591.579) (-1589.708) (-1593.298) [-1589.842] * (-1589.315) (-1590.881) [-1588.532] (-1592.064) -- 0:00:04
Average standard deviation of split frequencies: 0.007674
940500 -- (-1587.014) [-1587.944] (-1590.066) (-1590.761) * (-1590.918) [-1592.146] (-1591.454) (-1589.980) -- 0:00:04
941000 -- (-1590.741) (-1587.525) [-1590.904] (-1592.198) * (-1593.238) (-1589.183) [-1591.491] (-1592.186) -- 0:00:04
941500 -- (-1591.010) (-1591.103) (-1590.712) [-1587.070] * (-1593.370) (-1591.216) (-1590.214) [-1590.366] -- 0:00:03
942000 -- (-1591.009) (-1586.828) (-1589.618) [-1588.860] * [-1589.430] (-1591.074) (-1589.584) (-1590.791) -- 0:00:03
942500 -- (-1591.136) (-1587.732) (-1588.751) [-1589.445] * [-1589.915] (-1587.177) (-1588.650) (-1589.707) -- 0:00:03
943000 -- (-1594.561) (-1588.960) (-1588.729) [-1590.270] * (-1590.746) [-1590.241] (-1591.626) (-1591.180) -- 0:00:03
943500 -- (-1594.118) (-1591.472) (-1589.198) [-1588.581] * (-1589.391) [-1593.337] (-1589.614) (-1590.603) -- 0:00:03
944000 -- (-1593.397) (-1589.426) [-1587.932] (-1591.554) * (-1590.558) [-1587.585] (-1591.261) (-1591.888) -- 0:00:03
944500 -- (-1590.598) (-1591.785) [-1587.386] (-1595.369) * (-1589.779) [-1588.041] (-1590.226) (-1587.404) -- 0:00:03
945000 -- [-1587.485] (-1593.492) (-1587.727) (-1593.203) * (-1593.848) [-1592.072] (-1590.112) (-1591.303) -- 0:00:03
Average standard deviation of split frequencies: 0.007973
945500 -- [-1591.026] (-1589.241) (-1588.663) (-1592.261) * (-1591.286) [-1590.552] (-1592.620) (-1596.268) -- 0:00:03
946000 -- (-1588.407) (-1588.885) (-1588.551) [-1589.902] * (-1589.175) (-1592.461) (-1591.649) [-1589.945] -- 0:00:03
946500 -- [-1590.053] (-1594.631) (-1587.747) (-1589.176) * (-1594.150) [-1589.177] (-1591.239) (-1588.383) -- 0:00:03
947000 -- (-1588.493) (-1594.377) (-1590.923) [-1587.291] * (-1589.455) (-1591.004) (-1591.330) [-1589.316] -- 0:00:03
947500 -- [-1590.224] (-1588.475) (-1587.410) (-1589.100) * (-1591.358) (-1588.377) (-1591.189) [-1587.671] -- 0:00:03
948000 -- (-1591.517) [-1586.721] (-1589.921) (-1589.902) * (-1590.240) (-1590.175) [-1592.976] (-1591.930) -- 0:00:03
948500 -- (-1587.681) (-1589.037) [-1589.674] (-1589.346) * (-1591.050) (-1591.146) [-1590.324] (-1598.736) -- 0:00:03
949000 -- [-1589.717] (-1587.778) (-1591.007) (-1587.644) * (-1595.077) [-1586.423] (-1592.481) (-1589.280) -- 0:00:03
949500 -- [-1588.909] (-1587.925) (-1594.504) (-1591.535) * (-1588.598) (-1588.370) [-1589.302] (-1589.861) -- 0:00:03
950000 -- (-1592.043) (-1587.625) (-1589.967) [-1589.118] * [-1588.503] (-1586.963) (-1590.318) (-1591.349) -- 0:00:03
Average standard deviation of split frequencies: 0.008080
950500 -- (-1591.671) (-1593.620) [-1589.326] (-1593.646) * [-1590.285] (-1588.497) (-1592.132) (-1590.836) -- 0:00:03
951000 -- [-1589.107] (-1591.448) (-1588.855) (-1589.712) * [-1588.909] (-1591.555) (-1592.200) (-1591.961) -- 0:00:03
951500 -- (-1592.218) [-1589.116] (-1587.500) (-1588.458) * [-1593.576] (-1590.575) (-1591.999) (-1593.829) -- 0:00:03
952000 -- (-1590.589) [-1592.775] (-1594.473) (-1589.302) * (-1591.832) [-1591.393] (-1594.645) (-1592.171) -- 0:00:03
952500 -- (-1590.422) (-1589.710) (-1589.116) [-1591.267] * (-1589.799) (-1590.584) [-1589.107] (-1591.742) -- 0:00:03
953000 -- (-1591.111) (-1589.047) [-1588.590] (-1589.108) * (-1591.014) (-1592.860) [-1590.537] (-1590.161) -- 0:00:03
953500 -- (-1590.571) [-1587.211] (-1588.543) (-1591.133) * (-1598.746) (-1588.715) [-1593.036] (-1591.039) -- 0:00:03
954000 -- (-1590.031) (-1588.410) [-1589.114] (-1593.641) * (-1589.930) (-1591.454) (-1591.059) [-1589.652] -- 0:00:03
954500 -- (-1591.271) [-1588.449] (-1589.681) (-1592.349) * (-1592.078) (-1591.078) (-1591.647) [-1586.856] -- 0:00:03
955000 -- [-1589.829] (-1590.723) (-1589.484) (-1593.173) * (-1591.294) [-1588.353] (-1588.145) (-1588.646) -- 0:00:03
Average standard deviation of split frequencies: 0.006739
955500 -- [-1588.390] (-1588.154) (-1590.654) (-1587.848) * (-1593.669) [-1588.104] (-1588.381) (-1590.417) -- 0:00:03
956000 -- (-1592.199) [-1587.742] (-1593.537) (-1589.109) * (-1589.915) (-1590.536) (-1587.745) [-1592.016] -- 0:00:02
956500 -- (-1589.364) [-1590.977] (-1592.152) (-1588.845) * [-1592.101] (-1590.272) (-1588.325) (-1589.618) -- 0:00:02
957000 -- (-1590.413) [-1587.668] (-1593.424) (-1591.663) * (-1591.615) (-1592.450) (-1588.336) [-1587.540] -- 0:00:02
957500 -- (-1592.770) (-1588.226) (-1597.033) [-1589.549] * (-1595.974) (-1590.096) (-1590.013) [-1591.949] -- 0:00:02
958000 -- (-1594.287) [-1588.895] (-1590.414) (-1588.632) * (-1590.563) [-1588.499] (-1594.201) (-1591.066) -- 0:00:02
958500 -- (-1593.827) (-1589.894) [-1587.785] (-1592.453) * (-1592.138) (-1594.835) [-1592.300] (-1589.625) -- 0:00:02
959000 -- (-1592.946) (-1596.166) (-1590.099) [-1590.488] * (-1593.005) [-1589.029] (-1588.113) (-1590.592) -- 0:00:02
959500 -- (-1592.970) [-1590.478] (-1588.663) (-1588.316) * [-1593.935] (-1588.054) (-1587.272) (-1592.631) -- 0:00:02
960000 -- (-1591.760) [-1588.054] (-1590.086) (-1588.582) * (-1593.819) (-1586.966) [-1587.214] (-1592.742) -- 0:00:02
Average standard deviation of split frequencies: 0.006739
960500 -- [-1591.637] (-1590.934) (-1589.581) (-1589.064) * [-1591.557] (-1590.532) (-1590.844) (-1592.009) -- 0:00:02
961000 -- (-1589.298) (-1588.605) (-1589.113) [-1588.266] * (-1590.982) [-1596.658] (-1589.558) (-1590.173) -- 0:00:02
961500 -- (-1590.361) (-1588.673) [-1591.649] (-1589.521) * [-1588.724] (-1593.578) (-1588.183) (-1590.071) -- 0:00:02
962000 -- (-1591.968) (-1590.516) (-1593.532) [-1592.325] * (-1588.700) [-1592.794] (-1587.399) (-1589.186) -- 0:00:02
962500 -- [-1588.875] (-1590.135) (-1593.964) (-1593.281) * (-1590.486) [-1587.485] (-1589.436) (-1589.042) -- 0:00:02
963000 -- (-1590.511) (-1589.029) [-1588.921] (-1590.284) * (-1590.900) (-1589.407) [-1588.365] (-1589.282) -- 0:00:02
963500 -- (-1594.421) [-1593.076] (-1595.972) (-1591.639) * [-1590.505] (-1588.660) (-1586.444) (-1588.788) -- 0:00:02
964000 -- (-1594.470) [-1590.053] (-1591.023) (-1588.582) * (-1595.601) [-1587.929] (-1589.463) (-1587.904) -- 0:00:02
964500 -- [-1588.580] (-1590.141) (-1589.445) (-1590.811) * (-1589.732) (-1590.203) (-1589.409) [-1588.714] -- 0:00:02
965000 -- (-1590.706) (-1589.913) [-1590.826] (-1589.095) * (-1596.197) [-1590.666] (-1592.327) (-1592.390) -- 0:00:02
Average standard deviation of split frequencies: 0.006604
965500 -- (-1590.475) (-1595.999) [-1591.498] (-1589.577) * (-1591.845) [-1588.335] (-1589.821) (-1593.418) -- 0:00:02
966000 -- (-1588.787) (-1591.234) [-1589.936] (-1591.188) * [-1591.140] (-1592.444) (-1589.666) (-1588.613) -- 0:00:02
966500 -- [-1589.653] (-1588.395) (-1590.034) (-1591.667) * [-1589.321] (-1589.238) (-1591.691) (-1591.973) -- 0:00:02
967000 -- (-1592.111) (-1588.797) [-1589.131] (-1587.691) * (-1591.634) (-1591.695) [-1589.174] (-1592.133) -- 0:00:02
967500 -- (-1590.713) [-1590.776] (-1589.376) (-1589.508) * (-1589.485) (-1590.506) [-1591.993] (-1592.963) -- 0:00:02
968000 -- (-1591.947) (-1587.861) (-1587.129) [-1588.437] * (-1591.121) (-1588.433) [-1588.093] (-1592.384) -- 0:00:02
968500 -- (-1594.295) [-1593.434] (-1591.090) (-1588.137) * (-1591.215) (-1589.565) (-1589.937) [-1588.629] -- 0:00:02
969000 -- (-1594.099) (-1591.017) [-1589.836] (-1589.581) * (-1587.345) (-1589.482) (-1589.182) [-1590.530] -- 0:00:02
969500 -- [-1588.238] (-1591.226) (-1586.070) (-1587.853) * [-1587.274] (-1588.623) (-1589.464) (-1590.553) -- 0:00:02
970000 -- [-1589.926] (-1590.395) (-1591.345) (-1588.301) * (-1591.117) [-1588.543] (-1591.272) (-1591.958) -- 0:00:02
Average standard deviation of split frequencies: 0.006508
970500 -- (-1591.336) [-1593.158] (-1588.943) (-1589.126) * (-1590.598) [-1590.336] (-1589.103) (-1590.633) -- 0:00:02
971000 -- (-1590.280) (-1591.379) [-1590.299] (-1591.932) * (-1593.062) (-1590.731) (-1589.426) [-1590.784] -- 0:00:01
971500 -- (-1594.460) (-1594.195) (-1586.822) [-1589.005] * (-1590.506) (-1590.577) [-1588.274] (-1592.541) -- 0:00:01
972000 -- (-1589.227) (-1594.791) (-1592.975) [-1589.663] * (-1588.291) (-1591.285) [-1592.392] (-1589.217) -- 0:00:01
972500 -- (-1594.206) (-1592.465) [-1590.753] (-1590.695) * (-1590.618) [-1587.849] (-1588.956) (-1592.999) -- 0:00:01
973000 -- (-1588.250) [-1590.548] (-1585.759) (-1586.914) * (-1591.976) (-1587.037) [-1590.994] (-1593.241) -- 0:00:01
973500 -- (-1592.535) [-1590.682] (-1594.149) (-1590.935) * (-1591.127) (-1596.813) (-1603.208) [-1591.017] -- 0:00:01
974000 -- (-1592.848) (-1593.016) [-1590.610] (-1592.809) * (-1588.314) (-1591.141) [-1595.371] (-1589.728) -- 0:00:01
974500 -- (-1589.902) (-1593.462) (-1590.137) [-1595.238] * (-1588.238) (-1591.131) [-1589.175] (-1595.120) -- 0:00:01
975000 -- (-1590.513) (-1592.351) [-1589.467] (-1588.872) * (-1590.725) (-1590.067) [-1588.948] (-1587.481) -- 0:00:01
Average standard deviation of split frequencies: 0.006537
975500 -- (-1588.073) (-1592.798) [-1592.311] (-1590.061) * (-1592.958) (-1588.950) [-1592.388] (-1589.671) -- 0:00:01
976000 -- (-1591.666) [-1587.252] (-1592.972) (-1589.812) * (-1588.108) [-1589.061] (-1589.741) (-1592.624) -- 0:00:01
976500 -- (-1591.112) (-1589.827) (-1590.561) [-1592.246] * (-1591.001) (-1588.487) (-1588.929) [-1591.458] -- 0:00:01
977000 -- [-1589.127] (-1597.619) (-1588.627) (-1592.711) * [-1591.183] (-1590.512) (-1590.706) (-1593.842) -- 0:00:01
977500 -- [-1591.165] (-1591.073) (-1591.854) (-1596.166) * (-1586.797) [-1590.109] (-1589.507) (-1597.016) -- 0:00:01
978000 -- (-1590.182) (-1590.803) (-1588.391) [-1589.553] * (-1589.354) (-1588.875) [-1589.018] (-1594.230) -- 0:00:01
978500 -- [-1588.327] (-1588.287) (-1587.767) (-1591.997) * (-1598.826) (-1590.436) [-1589.315] (-1590.394) -- 0:00:01
979000 -- (-1589.074) (-1588.139) (-1589.886) [-1593.063] * [-1590.646] (-1587.947) (-1592.587) (-1590.032) -- 0:00:01
979500 -- (-1592.993) [-1589.137] (-1588.428) (-1590.668) * [-1590.798] (-1595.284) (-1592.151) (-1587.888) -- 0:00:01
980000 -- (-1589.296) (-1588.066) (-1589.782) [-1589.942] * [-1589.021] (-1591.163) (-1592.797) (-1594.931) -- 0:00:01
Average standard deviation of split frequencies: 0.007180
980500 -- (-1590.796) (-1590.097) [-1588.778] (-1591.934) * (-1589.568) (-1592.624) [-1596.751] (-1592.068) -- 0:00:01
981000 -- (-1593.026) [-1589.279] (-1592.359) (-1588.153) * [-1599.264] (-1593.656) (-1590.574) (-1592.627) -- 0:00:01
981500 -- [-1592.370] (-1591.104) (-1591.494) (-1594.409) * [-1589.921] (-1593.681) (-1589.449) (-1591.692) -- 0:00:01
982000 -- (-1593.204) (-1588.977) [-1589.233] (-1589.433) * (-1594.159) [-1588.567] (-1590.927) (-1587.341) -- 0:00:01
982500 -- (-1589.946) (-1593.435) (-1589.303) [-1588.055] * [-1589.370] (-1589.036) (-1594.088) (-1591.241) -- 0:00:01
983000 -- [-1589.961] (-1591.741) (-1586.279) (-1588.297) * (-1588.269) (-1589.140) [-1594.838] (-1592.155) -- 0:00:01
983500 -- [-1590.900] (-1588.503) (-1587.146) (-1588.017) * (-1593.441) [-1590.157] (-1590.601) (-1589.210) -- 0:00:01
984000 -- [-1590.301] (-1590.646) (-1590.897) (-1587.414) * (-1593.850) (-1591.036) [-1588.515] (-1588.436) -- 0:00:01
984500 -- (-1590.589) (-1592.050) (-1587.869) [-1593.979] * (-1588.849) (-1592.731) (-1588.655) [-1591.514] -- 0:00:01
985000 -- (-1590.575) (-1589.063) [-1587.190] (-1586.554) * [-1591.785] (-1593.669) (-1588.696) (-1592.719) -- 0:00:01
Average standard deviation of split frequencies: 0.007231
985500 -- (-1587.762) (-1588.928) [-1588.094] (-1597.010) * [-1593.528] (-1589.642) (-1587.546) (-1590.146) -- 0:00:00
986000 -- (-1591.656) (-1588.172) (-1598.666) [-1591.827] * (-1589.543) (-1591.212) (-1591.901) [-1593.344] -- 0:00:00
986500 -- (-1587.843) (-1592.355) (-1591.756) [-1589.289] * (-1589.638) [-1587.941] (-1594.415) (-1593.116) -- 0:00:00
987000 -- (-1590.489) (-1592.416) (-1592.595) [-1591.263] * (-1592.262) (-1589.315) (-1589.958) [-1591.293] -- 0:00:00
987500 -- (-1592.242) [-1590.015] (-1592.809) (-1588.587) * (-1593.350) (-1588.854) (-1586.537) [-1591.865] -- 0:00:00
988000 -- (-1589.903) (-1589.402) (-1590.392) [-1591.663] * [-1589.335] (-1590.060) (-1592.493) (-1589.959) -- 0:00:00
988500 -- [-1587.140] (-1587.222) (-1591.505) (-1590.550) * (-1592.331) [-1589.167] (-1588.577) (-1591.657) -- 0:00:00
989000 -- [-1590.556] (-1591.929) (-1591.552) (-1591.879) * [-1589.601] (-1594.559) (-1591.052) (-1593.674) -- 0:00:00
989500 -- (-1588.718) (-1591.024) [-1593.016] (-1588.765) * (-1589.381) (-1598.300) (-1588.057) [-1587.799] -- 0:00:00
990000 -- (-1592.922) [-1590.130] (-1590.886) (-1591.186) * (-1590.553) (-1592.040) [-1589.647] (-1586.923) -- 0:00:00
Average standard deviation of split frequencies: 0.007078
990500 -- [-1593.214] (-1593.310) (-1588.112) (-1594.496) * (-1589.610) (-1593.620) (-1590.164) [-1587.627] -- 0:00:00
991000 -- (-1592.526) (-1590.464) [-1588.066] (-1591.766) * (-1591.054) (-1592.001) [-1589.669] (-1587.864) -- 0:00:00
991500 -- (-1594.695) (-1589.407) [-1586.372] (-1592.062) * [-1593.239] (-1592.634) (-1594.690) (-1589.978) -- 0:00:00
992000 -- (-1593.122) (-1587.290) [-1587.426] (-1593.505) * [-1591.012] (-1590.779) (-1592.079) (-1592.230) -- 0:00:00
992500 -- [-1590.778] (-1592.706) (-1591.186) (-1590.838) * [-1589.119] (-1592.708) (-1590.165) (-1590.747) -- 0:00:00
993000 -- (-1593.293) (-1588.600) [-1591.216] (-1591.858) * (-1591.638) (-1593.543) [-1588.896] (-1592.129) -- 0:00:00
993500 -- (-1592.087) (-1588.489) (-1590.670) [-1591.548] * (-1592.042) (-1590.001) [-1591.402] (-1590.333) -- 0:00:00
994000 -- (-1591.370) (-1596.056) [-1589.125] (-1590.261) * (-1590.926) [-1589.959] (-1590.676) (-1597.447) -- 0:00:00
994500 -- (-1591.783) [-1592.477] (-1588.641) (-1591.442) * (-1590.750) (-1588.040) (-1590.416) [-1592.616] -- 0:00:00
995000 -- (-1593.051) [-1589.638] (-1589.443) (-1592.370) * (-1590.599) (-1591.120) [-1591.965] (-1591.440) -- 0:00:00
Average standard deviation of split frequencies: 0.006833
995500 -- (-1595.308) [-1591.095] (-1590.514) (-1591.173) * (-1591.898) [-1589.281] (-1593.471) (-1589.031) -- 0:00:00
996000 -- (-1593.975) [-1588.423] (-1596.027) (-1588.683) * (-1593.242) (-1590.442) (-1588.676) [-1590.875] -- 0:00:00
996500 -- (-1589.884) [-1588.261] (-1589.759) (-1591.090) * [-1589.464] (-1589.002) (-1589.825) (-1594.161) -- 0:00:00
997000 -- (-1589.586) [-1589.091] (-1588.096) (-1588.271) * (-1590.794) (-1592.982) (-1590.383) [-1592.281] -- 0:00:00
997500 -- [-1589.132] (-1590.826) (-1589.598) (-1591.715) * (-1590.640) [-1591.996] (-1588.488) (-1593.167) -- 0:00:00
998000 -- (-1591.464) (-1589.824) [-1589.232] (-1591.058) * [-1590.372] (-1590.942) (-1589.970) (-1592.464) -- 0:00:00
998500 -- (-1587.900) (-1592.239) [-1590.361] (-1591.033) * [-1588.457] (-1589.764) (-1590.319) (-1591.461) -- 0:00:00
999000 -- [-1589.137] (-1590.577) (-1591.572) (-1591.643) * [-1591.493] (-1590.708) (-1588.839) (-1588.893) -- 0:00:00
999500 -- (-1589.927) (-1590.809) [-1589.954] (-1590.995) * (-1588.286) (-1588.671) [-1592.011] (-1589.764) -- 0:00:00
1000000 -- (-1591.364) [-1589.226] (-1594.754) (-1593.131) * [-1590.590] (-1586.981) (-1591.547) (-1588.054) -- 0:00:00
Average standard deviation of split frequencies: 0.006860
Analysis completed in 1 mins 8 seconds
Analysis used 66.94 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1585.26
Likelihood of best state for "cold" chain of run 2 was -1585.27
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 53 %) Dirichlet(Revmat{all})
98.2 % ( 98 %) Slider(Revmat{all})
25.3 % ( 22 %) Dirichlet(Pi{all})
27.7 % ( 27 %) Slider(Pi{all})
60.7 % ( 36 %) Multiplier(Alpha{1,2})
79.5 % ( 53 %) Multiplier(Alpha{3})
23.3 % ( 21 %) Slider(Pinvar{all})
97.4 % ( 96 %) ExtSPR(Tau{all},V{all})
69.1 % ( 72 %) ExtTBR(Tau{all},V{all})
98.4 % ( 99 %) NNI(Tau{all},V{all})
88.1 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 31 %) Multiplier(V{all})
94.2 % ( 96 %) Nodeslider(V{all})
30.9 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 72 %) Dirichlet(Revmat{all})
97.8 % ( 98 %) Slider(Revmat{all})
25.4 % ( 27 %) Dirichlet(Pi{all})
27.0 % ( 30 %) Slider(Pi{all})
61.3 % ( 27 %) Multiplier(Alpha{1,2})
80.0 % ( 51 %) Multiplier(Alpha{3})
23.6 % ( 28 %) Slider(Pinvar{all})
97.4 % ( 99 %) ExtSPR(Tau{all},V{all})
68.8 % ( 67 %) ExtTBR(Tau{all},V{all})
98.3 % ( 99 %) NNI(Tau{all},V{all})
88.1 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
94.5 % ( 94 %) Nodeslider(V{all})
30.6 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 166121 0.82 0.65
3 | 166351 166781 0.83
4 | 167360 167001 166386
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 167121 0.81 0.65
3 | 166131 166556 0.83
4 | 166715 167034 166443
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1588.91
| 1 2 |
| 1 |
| 1 2 2 1 |
| 2 1 22 22 2 2 11 1 |
|2 1 21 1 *1 1 2 *2 1 12 2 |
| 2 1 2*21 1 1 21 2 1 1|
| 1 1 1 1 21 2 121 2 |
|1 2*2 2 1 1 1 1 * 1 1 |
| 2 22 212 2 2 222 1 1 2 |
| 1 1 2 1 1 2 *2 21 2|
| 1 2 2 1 2 1 |
| 1 1 2 2 2 |
| 2 1 * |
| 1 2 |
| 11 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1591.34
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1588.78 -1595.71
2 -1588.78 -1594.28
--------------------------------------
TOTAL -1588.78 -1595.23
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.857700 0.087163 0.371438 1.498118 0.818721 1450.98 1475.99 1.000
r(A<->C){all} 0.128609 0.015636 0.000043 0.390337 0.091120 200.67 271.37 1.000
r(A<->G){all} 0.173072 0.023438 0.000055 0.481097 0.127195 284.45 284.70 1.004
r(A<->T){all} 0.183783 0.022984 0.000010 0.481335 0.147242 136.64 140.86 1.000
r(C<->G){all} 0.131556 0.013986 0.000031 0.371207 0.097409 213.99 272.99 1.000
r(C<->T){all} 0.212183 0.025011 0.000478 0.529592 0.175590 101.83 142.56 1.002
r(G<->T){all} 0.170798 0.019811 0.000034 0.450518 0.140201 219.39 280.92 1.000
pi(A){all} 0.228817 0.000153 0.203395 0.252148 0.228955 1233.79 1241.70 1.000
pi(C){all} 0.221904 0.000149 0.198993 0.246707 0.221858 1287.38 1347.42 1.000
pi(G){all} 0.273839 0.000177 0.247708 0.299478 0.273486 1296.94 1315.59 1.000
pi(T){all} 0.275440 0.000171 0.248736 0.299356 0.275666 1134.78 1187.27 1.000
alpha{1,2} 0.249422 0.100677 0.000888 0.805988 0.158403 1221.05 1230.35 1.000
alpha{3} 0.402812 0.231323 0.000104 1.335507 0.231194 1304.82 1310.34 1.000
pinvar{all} 0.996928 0.000006 0.992183 0.999912 0.997555 1315.32 1385.06 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..****
8 -- .**...
9 -- ..**..
10 -- ...**.
11 -- .*.***
12 -- ....**
13 -- .**.**
14 -- ..*..*
15 -- .*.*..
16 -- .*...*
17 -- ...*.*
18 -- ..*.*.
19 -- .*..*.
20 -- .****.
21 -- .***.*
22 -- .***..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 459 0.152898 0.008009 0.147235 0.158561 2
8 449 0.149567 0.006124 0.145237 0.153897 2
9 448 0.149234 0.001884 0.147901 0.150566 2
10 446 0.148568 0.006595 0.143904 0.153231 2
11 437 0.145570 0.002355 0.143904 0.147235 2
12 436 0.145237 0.001884 0.143904 0.146569 2
13 433 0.144237 0.001413 0.143238 0.145237 2
14 430 0.143238 0.008480 0.137242 0.149234 2
15 425 0.141572 0.016488 0.129913 0.153231 2
16 415 0.138241 0.008951 0.131912 0.144570 2
17 414 0.137908 0.007537 0.132578 0.143238 2
18 414 0.137908 0.011306 0.129913 0.145903 2
19 412 0.137242 0.002827 0.135243 0.139241 2
20 410 0.136576 0.005653 0.132578 0.140573 2
21 404 0.134577 0.002827 0.132578 0.136576 2
22 271 0.090273 0.017430 0.077948 0.102598 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/ML2710/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.087799 0.008493 0.000021 0.265454 0.058961 1.000 2
length{all}[2] 0.086723 0.007667 0.000025 0.262645 0.060027 1.000 2
length{all}[3] 0.086547 0.007915 0.000040 0.251559 0.060492 1.000 2
length{all}[4] 0.090360 0.008707 0.000009 0.275837 0.061619 1.000 2
length{all}[5] 0.088166 0.007834 0.000040 0.261725 0.061427 1.000 2
length{all}[6] 0.152854 0.016108 0.000018 0.405541 0.119793 1.000 2
length{all}[7] 0.093749 0.009339 0.000133 0.255520 0.063697 0.998 2
length{all}[8] 0.090982 0.010097 0.000293 0.290639 0.058438 1.000 2
length{all}[9] 0.084657 0.007804 0.000164 0.267867 0.057301 0.998 2
length{all}[10] 0.090518 0.008433 0.000586 0.271268 0.062902 0.998 2
length{all}[11] 0.088095 0.008374 0.000102 0.294449 0.056305 0.998 2
length{all}[12] 0.089603 0.009461 0.000087 0.294565 0.057662 0.998 2
length{all}[13] 0.081531 0.007458 0.000535 0.227905 0.058363 1.000 2
length{all}[14] 0.086614 0.006941 0.000098 0.257989 0.062174 1.006 2
length{all}[15] 0.087510 0.010390 0.000035 0.270312 0.056385 0.998 2
length{all}[16] 0.086089 0.006720 0.000180 0.246266 0.062456 0.999 2
length{all}[17] 0.096745 0.008915 0.000028 0.288095 0.064787 0.998 2
length{all}[18] 0.088489 0.007596 0.000078 0.259014 0.056047 1.000 2
length{all}[19] 0.087835 0.006881 0.000247 0.247284 0.064749 0.998 2
length{all}[20] 0.089700 0.009593 0.000044 0.301828 0.053758 1.010 2
length{all}[21] 0.093518 0.007951 0.000504 0.282025 0.065319 1.005 2
length{all}[22] 0.091320 0.008531 0.000208 0.284820 0.058065 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006860
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------- C1 (1)
|
|------------------------------------ C2 (2)
|
|------------------------------------ C3 (3)
+
|------------------------------------- C4 (4)
|
|------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|-----------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1140
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 380 / 380 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 380 / 380 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.059990 0.065474 0.054489 0.014803 0.065270 0.023927 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1651.097047
Iterating by ming2
Initial: fx= 1651.097047
x= 0.05999 0.06547 0.05449 0.01480 0.06527 0.02393 0.30000 1.30000
1 h-m-p 0.0000 0.0000 906.4000 ++ 1619.203798 m 0.0000 13 | 1/8
2 h-m-p 0.0000 0.0000 5431.6416 ++ 1558.341951 m 0.0000 24 | 2/8
3 h-m-p 0.0000 0.0001 140.6203 ++ 1551.805768 m 0.0001 35 | 3/8
4 h-m-p 0.0000 0.0000 281.4535 ++ 1547.686808 m 0.0000 46 | 4/8
5 h-m-p 0.0000 0.0000 280.7653 ++ 1547.604060 m 0.0000 57 | 5/8
6 h-m-p 0.0009 0.4687 0.9720 ++++YYCYCYC 1546.765689 6 0.3053 80 | 5/8
7 h-m-p 0.0965 8.0000 3.0770 +YYYCC 1545.957001 4 0.4573 100 | 5/8
8 h-m-p 0.4203 2.1014 0.4836 YCYCCC 1545.575473 5 1.1086 119 | 5/8
9 h-m-p 1.6000 8.0000 0.3343 ++ 1545.221433 m 8.0000 133 | 5/8
10 h-m-p 0.8028 4.0140 1.6474 CYCCC 1545.080794 4 1.3933 154 | 5/8
11 h-m-p 1.3949 8.0000 1.6456 +YCCC 1544.929048 3 3.4277 171 | 5/8
12 h-m-p 1.6000 8.0000 2.0935 YCCC 1544.826774 3 3.0634 187 | 5/8
13 h-m-p 1.6000 8.0000 2.8879 +YCCC 1544.766015 3 4.0484 204 | 5/8
14 h-m-p 1.6000 8.0000 5.2661 YCCC 1544.720256 3 2.8030 220 | 5/8
15 h-m-p 1.6000 8.0000 6.8377 YC 1544.692403 1 3.8527 232 | 5/8
16 h-m-p 1.6000 8.0000 10.8882 YCC 1544.672801 2 2.7357 246 | 5/8
17 h-m-p 1.6000 8.0000 15.1384 +YC 1544.659117 1 4.2297 259 | 5/8
18 h-m-p 1.6000 8.0000 24.2202 CC 1544.650727 1 2.5044 272 | 5/8
19 h-m-p 1.6000 8.0000 33.1078 +YC 1544.644084 1 4.8344 285 | 5/8
20 h-m-p 1.6000 8.0000 54.5739 CC 1544.640553 1 2.2889 298 | 5/8
21 h-m-p 1.6000 8.0000 72.3272 +CC 1544.637444 1 5.4635 312 | 5/8
22 h-m-p 0.7540 3.7702 126.2969 +YC 1544.635970 1 2.1516 325 | 5/8
23 h-m-p 0.2526 1.2629 161.8640 ++ 1544.635375 m 1.2629 336 | 6/8
24 h-m-p 0.0322 0.1611 256.6866 ++ 1544.635345 m 0.1611 347 | 7/8
25 h-m-p 0.2743 8.0000 0.0000 +C 1544.635328 0 1.0263 359 | 7/8
26 h-m-p 1.6000 8.0000 0.0000 ---------Y 1544.635328 0 0.0000 380
Out..
lnL = -1544.635328
381 lfun, 381 eigenQcodon, 2286 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.026288 0.037698 0.109496 0.087377 0.070572 0.065196 999.000000 0.589702 0.591385
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.024311
np = 9
lnL0 = -1685.935059
Iterating by ming2
Initial: fx= 1685.935059
x= 0.02629 0.03770 0.10950 0.08738 0.07057 0.06520 951.42857 0.58970 0.59138
1 h-m-p 0.0000 0.0001 874.4709 ++ 1630.601070 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 1355.5517 +CCYYCYCYC 1606.419472 8 0.0000 39 | 1/9
3 h-m-p 0.0000 0.0001 249.1948 ++ 1602.619174 m 0.0001 51 | 2/9
4 h-m-p 0.0000 0.0005 1098.7396 +++ 1561.386169 m 0.0005 64 | 3/9
5 h-m-p 0.0000 0.0000 1526.7696 ++ 1556.894146 m 0.0000 76 | 3/9
6 h-m-p 0.0000 0.0000 123.8302
h-m-p: 1.63920230e-21 8.19601149e-21 1.23830233e+02 1556.894146
.. | 3/9
7 h-m-p 0.0000 0.0000 761.9561 ++ 1553.498593 m 0.0000 97 | 4/9
8 h-m-p 0.0000 0.0000 524.9104 ++ 1546.961847 m 0.0000 109 | 5/9
9 h-m-p 0.0000 0.0000 14.3692 ++ 1546.961378 m 0.0000 121 | 5/9
10 h-m-p -0.0000 -0.0000 2.8913
h-m-p: -3.34008712e-22 -1.67004356e-21 2.89131498e+00 1546.961378
.. | 5/9
11 h-m-p 0.0000 0.0000 277.4984 +YYYCCC 1545.359389 5 0.0000 150 | 5/9
12 h-m-p 0.0058 0.4749 1.3819 ++++ 1545.011328 m 0.4749 164 | 6/9
13 h-m-p 1.6000 8.0000 0.0001 Y 1545.011324 0 0.2566 176 | 6/9
14 h-m-p 1.6000 8.0000 0.0000 ------C 1545.011324 0 0.0001 197
Out..
lnL = -1545.011324
198 lfun, 594 eigenQcodon, 2376 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.098918 0.082266 0.071271 0.026050 0.068794 0.079758 951.428574 1.727602 0.363456 0.204471 1058.129192
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000248
np = 11
lnL0 = -1589.233828
Iterating by ming2
Initial: fx= 1589.233828
x= 0.09892 0.08227 0.07127 0.02605 0.06879 0.07976 951.42857 1.72760 0.36346 0.20447 951.42857
1 h-m-p 0.0000 0.0007 72.6871 ++++ 1584.269439 m 0.0007 18 | 1/11
2 h-m-p 0.0011 0.0150 43.7807 ++ 1562.791546 m 0.0150 32 | 2/11
3 h-m-p 0.0000 0.0000 3871.7248 ++ 1562.023738 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0002 1813.3633 ++ 1557.547225 m 0.0002 60 | 4/11
5 h-m-p 0.0000 0.0000 8013.4521 ++ 1556.044377 m 0.0000 74 | 5/11
6 h-m-p 0.0013 0.0304 77.1098 +YCCC 1552.665023 3 0.0125 94 | 5/11
7 h-m-p 0.0037 0.0183 6.3310 ++ 1552.169609 m 0.0183 108 | 6/11
8 h-m-p 0.0886 2.9733 0.7027 +++ 1550.159782 m 2.9733 123 | 6/11
9 h-m-p 1.2153 8.0000 1.7193 YYCCCCCC 1549.632203 7 0.4269 154 | 6/11
10 h-m-p 0.3251 8.0000 2.2574 CCC 1548.947608 2 0.3664 172 | 6/11
11 h-m-p 1.6000 8.0000 0.0046 ++ 1548.946562 m 8.0000 186 | 6/11
12 h-m-p 0.0160 8.0000 7.4161 +++++ 1547.333585 m 8.0000 208 | 6/11
13 h-m-p 0.0660 0.3299 539.9113 --------------.. | 6/11
14 h-m-p 0.0000 0.0040 20.0531 ++++YYCYYCYYYY 1544.717281 10 0.0038 264 | 6/11
15 h-m-p 0.0062 0.0312 0.5139 CC 1544.716101 1 0.0018 280 | 6/11
16 h-m-p 0.0160 8.0000 0.0934 +++++ 1544.667415 m 8.0000 302 | 6/11
17 h-m-p 1.6000 8.0000 0.3937 ++ 1544.636751 m 8.0000 321 | 6/11
18 h-m-p 1.6000 8.0000 0.1579 C 1544.636538 0 0.4382 340 | 6/11
19 h-m-p 0.6858 8.0000 0.1009 ++ 1544.635941 m 8.0000 359 | 6/11
20 h-m-p 1.2882 8.0000 0.6266 +C 1544.635523 0 5.1526 379 | 6/11
21 h-m-p 1.6000 8.0000 0.1523 Y 1544.635470 0 1.0743 398 | 6/11
22 h-m-p 1.4437 8.0000 0.1134 ++ 1544.635460 m 8.0000 417 | 6/11
23 h-m-p 1.4775 8.0000 0.6139 +C 1544.635454 0 5.7004 437 | 6/11
24 h-m-p 1.6000 8.0000 0.0884 Y 1544.635454 0 0.9542 456 | 6/11
25 h-m-p 0.7499 8.0000 0.1125 C 1544.635454 0 0.8165 475 | 6/11
26 h-m-p 0.3690 8.0000 0.2488 +C 1544.635454 0 1.2951 495 | 6/11
27 h-m-p 0.8785 8.0000 0.3668 +Y 1544.635454 0 5.2540 515 | 6/11
28 h-m-p 1.6000 8.0000 0.2326 Y 1544.635454 0 2.9731 534 | 6/11
29 h-m-p 1.6000 8.0000 0.0467 -C 1544.635454 0 0.1445 554 | 6/11
30 h-m-p 0.0730 8.0000 0.0924 C 1544.635454 0 0.0183 573 | 6/11
31 h-m-p 0.0160 8.0000 0.3407 +Y 1544.635454 0 0.1125 593 | 6/11
32 h-m-p 0.1344 8.0000 0.2850 --C 1544.635454 0 0.0021 614 | 6/11
33 h-m-p 0.0160 8.0000 0.7573 --------N 1544.635454 0 0.0000 641 | 6/11
34 h-m-p 0.0160 8.0000 0.0001 +C 1544.635454 0 0.0564 661 | 6/11
35 h-m-p 0.1511 8.0000 0.0000 --N 1544.635454 0 0.0024 682
Out..
lnL = -1544.635454
683 lfun, 2732 eigenQcodon, 12294 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1549.605792 S = -1548.167022 -2.367422
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:04
did 20 / 58 patterns 0:04
did 30 / 58 patterns 0:04
did 40 / 58 patterns 0:04
did 50 / 58 patterns 0:04
did 58 / 58 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.051114 0.106549 0.060446 0.085503 0.104128 0.032731 952.375868 1.024983 1.752037
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.035880
np = 9
lnL0 = -1699.840931
Iterating by ming2
Initial: fx= 1699.840931
x= 0.05111 0.10655 0.06045 0.08550 0.10413 0.03273 952.37587 1.02498 1.75204
1 h-m-p 0.0000 0.0001 833.1153 ++ 1635.959660 m 0.0001 14 | 0/9
2 h-m-p -0.0000 -0.0000 5142.3730
h-m-p: -9.49630482e-19 -4.74815241e-18 5.14237300e+03 1635.959660
.. | 0/9
3 h-m-p 0.0000 0.0000 236355.9025 ---YCYYCYCYC 1630.424088 8 0.0000 49 | 0/9
4 h-m-p 0.0000 0.0000 798.1406 ++ 1602.740752 m 0.0000 61 | 1/9
5 h-m-p 0.0012 0.0400 25.6166 -----------.. | 1/9
6 h-m-p 0.0000 0.0000 722.1968 ++ 1589.052195 m 0.0000 94 | 2/9
7 h-m-p 0.0000 0.0000 10249.9898 +YYYCYCYC 1584.790530 7 0.0000 117 | 2/9
8 h-m-p 0.0005 0.0604 16.9743 -----------.. | 2/9
9 h-m-p 0.0000 0.0001 2492.6961 YYCYCCC 1583.110057 6 0.0000 159 | 2/9
10 h-m-p 0.0000 0.0001 673.4649 ++ 1561.071910 m 0.0001 171 | 3/9
11 h-m-p 0.0036 0.1338 7.8126 ------------.. | 3/9
12 h-m-p 0.0000 0.0000 547.5483 +YYCYYYC 1554.562110 6 0.0000 214 | 3/9
13 h-m-p 0.0000 0.0000 5669.5696 ++ 1547.317157 m 0.0000 226 | 4/9
14 h-m-p 0.0001 0.0004 6.2187 ++ 1546.484864 m 0.0004 238 | 5/9
15 h-m-p 0.0160 8.0000 0.4067 +++++ 1545.067213 m 8.0000 253 | 5/9
16 h-m-p 0.4407 2.2036 0.0691 +
QuantileBeta(0.85, 3.74255, 0.00500) = 1.000000e+00 2000 rounds
+ 1545.045127 m 2.2036 269
QuantileBeta(0.85, 3.74255, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.74255, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.74255, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.74255, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.74255, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.74255, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.74255, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.74255, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.74255, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.74271, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.74239, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
17 h-m-p 0.1300 2.9716 0.7541
QuantileBeta(0.85, 3.64453, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.35046, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.17419, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.35171, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.76233, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.26525, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 3.01379, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.25247, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 3.13313, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24784, 0.00500) = 1.000000e+00 2000 rounds
C 1545.011320 3 0.6560 292
QuantileBeta(0.85, 3.24784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24784, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24799, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24770, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24784, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
18 h-m-p 1.6000 8.0000 0.0003
QuantileBeta(0.85, 3.24737, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24594, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
C 1545.011320 0 1.6349 307
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24750, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
19 h-m-p 1.6000 8.0000 0.0003
QuantileBeta(0.85, 3.24776, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24746, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.24738, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
C 1545.011320 0 0.0016 326
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -1545.011320
327 lfun, 3597 eigenQcodon, 19620 P(t)
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.24736, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.054549 0.083563 0.048682 0.065005 0.058932 0.107554 952.375913 0.900000 0.623267 1.627354 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000307
np = 11
lnL0 = -1581.686945
Iterating by ming2
Initial: fx= 1581.686945
x= 0.05455 0.08356 0.04868 0.06501 0.05893 0.10755 952.37591 0.90000 0.62327 1.62735 951.42857
1 h-m-p 0.0000 0.0003 300.7576 ++YCYYYCYYCC 1556.599998 10 0.0003 32 | 0/11
2 h-m-p 0.0004 0.0022 43.3731 ++ 1553.045910 m 0.0022 46 | 1/11
3 h-m-p 0.0002 0.0008 53.3923 ++ 1549.939971 m 0.0008 60 | 2/11
4 h-m-p 0.0003 0.0013 6.7351 ++ 1549.645712 m 0.0013 74 | 3/11
5 h-m-p 0.0000 0.0000 95.9866 ++ 1549.346564 m 0.0000 88 | 4/11
6 h-m-p 0.0001 0.0037 16.5711 ++YCYYYYCYCY 1547.859210 10 0.0033 117 | 4/11
7 h-m-p 0.0156 0.0778 1.2437 -CC 1547.852813 1 0.0010 134 | 4/11
8 h-m-p 0.0056 2.7981 0.2242 ------------.. | 4/11
9 h-m-p 0.0000 0.0001 146.8444 ++ 1544.775727 m 0.0001 179 | 5/11
10 h-m-p 0.0000 0.0000 188.6373 CYCCC 1544.710871 4 0.0000 200 | 5/11
11 h-m-p 0.5307 8.0000 0.0039 ++ 1544.689080 m 8.0000 214 | 5/11
12 h-m-p 1.2242 8.0000 0.0255 CYC 1544.671908 2 0.9951 237 | 5/11
13 h-m-p 1.4478 8.0000 0.0175 YC 1544.659021 1 3.4493 258 | 5/11
14 h-m-p 1.6000 8.0000 0.0242 YCC 1544.651251 2 3.2847 281 | 5/11
15 h-m-p 1.6000 8.0000 0.0461 CCC 1544.646271 2 2.0799 305 | 5/11
16 h-m-p 1.5275 7.6373 0.0468 +C 1544.641701 0 6.0028 326 | 5/11
17 h-m-p 0.1490 0.7452 0.1027 ++ 1544.640259 m 0.7452 346 | 5/11
18 h-m-p 0.0000 0.0000 0.1764
h-m-p: 5.32331885e-18 2.66165943e-17 1.76418977e-01 1544.640259
.. | 5/11
19 h-m-p 0.0000 0.0005 5.3041 Y 1544.640145 0 0.0000 383 | 5/11
20 h-m-p 0.0160 8.0000 0.0481 ++++Y 1544.637091 0 4.9566 401 | 5/11
21 h-m-p 0.6326 3.1628 0.0186 YC 1544.636456 1 1.0787 422 | 5/11
22 h-m-p 0.8109 8.0000 0.0247 ++ 1544.635909 m 8.0000 442 | 5/11
23 h-m-p 0.5987 2.9933 0.1440 ++ 1544.635469 m 2.9933 462
QuantileBeta(0.15, 0.00495, 1.86082) = 1.834123e-162 2000 rounds
| 6/11
24 h-m-p 1.6000 8.0000 0.0000 Y 1544.635469 0 3.6717 482 | 6/11
25 h-m-p 1.6000 8.0000 0.0000 ----C 1544.635469 0 0.0016 505
Out..
lnL = -1544.635469
506 lfun, 6072 eigenQcodon, 33396 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1549.312178 S = -1548.134377 -1.981269
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:18
did 20 / 58 patterns 0:18
did 30 / 58 patterns 0:18
did 40 / 58 patterns 0:18
did 50 / 58 patterns 0:19
did 58 / 58 patterns 0:19
Time used: 0:19
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/10res/ML2710/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 380
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 12 12 12 12 12 12 | Ser TCT 7 7 7 7 7 7 | Tyr TAT 6 6 6 6 6 6 | Cys TGT 0 0 0 0 0 0
TTC 12 12 12 12 12 12 | TCC 3 3 3 3 3 3 | TAC 8 8 8 8 8 8 | TGC 2 2 2 2 2 2
Leu TTA 4 4 4 4 4 4 | TCA 4 4 4 4 4 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 15 15 15 15 15 15 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 6 6 6 6 6 6 | Pro CCT 2 2 2 2 2 2 | His CAT 5 5 5 5 5 5 | Arg CGT 8 8 8 8 8 8
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 5 5 5 5 5 5
CTA 0 0 0 0 0 0 | CCA 11 11 11 11 11 11 | Gln CAA 6 6 6 6 6 6 | CGA 2 2 2 2 2 2
CTG 5 5 5 5 5 6 | CCG 11 11 11 11 11 10 | CAG 12 12 12 12 12 12 | CGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 11 11 11 11 11 11 | Thr ACT 8 8 8 8 8 8 | Asn AAT 7 7 7 7 7 7 | Ser AGT 5 5 5 5 5 5
ATC 5 5 5 5 5 5 | ACC 7 7 7 7 7 7 | AAC 9 9 9 9 9 9 | AGC 1 1 1 1 1 1
ATA 3 3 3 3 3 3 | ACA 4 4 4 4 4 4 | Lys AAA 8 8 8 8 8 8 | Arg AGA 3 3 3 3 3 3
Met ATG 14 14 14 14 14 14 | ACG 5 5 5 5 5 5 | AAG 10 10 10 10 10 10 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 7 7 7 7 7 7 | Ala GCT 10 10 10 10 10 10 | Asp GAT 8 8 8 8 8 8 | Gly GGT 12 12 12 12 12 12
GTC 5 5 5 5 5 5 | GCC 1 1 1 1 1 1 | GAC 7 7 7 7 7 7 | GGC 4 4 4 4 4 4
GTA 2 2 2 2 2 2 | GCA 6 6 6 6 6 6 | Glu GAA 4 4 4 4 4 4 | GGA 5 5 5 5 5 5
GTG 14 14 14 14 14 14 | GCG 17 17 17 17 17 17 | GAG 8 8 8 8 8 8 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010909049_1_2897_MLBR_RS13795
position 1: T:0.22105 C:0.21579 A:0.26316 G:0.30000
position 2: T:0.30526 C:0.26053 A:0.26053 G:0.17368
position 3: T:0.30000 C:0.18684 A:0.16316 G:0.35000
Average T:0.27544 C:0.22105 A:0.22895 G:0.27456
#2: NC_002677_1_NP_302731_1_1603_ML2710
position 1: T:0.22105 C:0.21579 A:0.26316 G:0.30000
position 2: T:0.30526 C:0.26053 A:0.26053 G:0.17368
position 3: T:0.30000 C:0.18684 A:0.16316 G:0.35000
Average T:0.27544 C:0.22105 A:0.22895 G:0.27456
#3: NZ_LVXE01000010_1_WP_010909049_1_261_A3216_RS04945
position 1: T:0.22105 C:0.21579 A:0.26316 G:0.30000
position 2: T:0.30526 C:0.26053 A:0.26053 G:0.17368
position 3: T:0.30000 C:0.18684 A:0.16316 G:0.35000
Average T:0.27544 C:0.22105 A:0.22895 G:0.27456
#4: NZ_LYPH01000099_1_WP_010909049_1_2889_A8144_RS13950
position 1: T:0.22105 C:0.21579 A:0.26316 G:0.30000
position 2: T:0.30526 C:0.26053 A:0.26053 G:0.17368
position 3: T:0.30000 C:0.18684 A:0.16316 G:0.35000
Average T:0.27544 C:0.22105 A:0.22895 G:0.27456
#5: NZ_CP029543_1_WP_010909049_1_2937_DIJ64_RS14940
position 1: T:0.22105 C:0.21579 A:0.26316 G:0.30000
position 2: T:0.30526 C:0.26053 A:0.26053 G:0.17368
position 3: T:0.30000 C:0.18684 A:0.16316 G:0.35000
Average T:0.27544 C:0.22105 A:0.22895 G:0.27456
#6: NZ_AP014567_1_WP_119608035_1_3001_yidC
position 1: T:0.22105 C:0.21579 A:0.26316 G:0.30000
position 2: T:0.30789 C:0.25789 A:0.26053 G:0.17368
position 3: T:0.30000 C:0.18684 A:0.16316 G:0.35000
Average T:0.27632 C:0.22018 A:0.22895 G:0.27456
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 72 | Ser S TCT 42 | Tyr Y TAT 36 | Cys C TGT 0
TTC 72 | TCC 18 | TAC 48 | TGC 12
Leu L TTA 24 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 90 | TCG 18 | TAG 0 | Trp W TGG 48
------------------------------------------------------------------------------
Leu L CTT 36 | Pro P CCT 12 | His H CAT 30 | Arg R CGT 48
CTC 6 | CCC 0 | CAC 6 | CGC 30
CTA 0 | CCA 66 | Gln Q CAA 36 | CGA 12
CTG 31 | CCG 65 | CAG 72 | CGG 42
------------------------------------------------------------------------------
Ile I ATT 66 | Thr T ACT 48 | Asn N AAT 42 | Ser S AGT 30
ATC 30 | ACC 42 | AAC 54 | AGC 6
ATA 18 | ACA 24 | Lys K AAA 48 | Arg R AGA 18
Met M ATG 84 | ACG 30 | AAG 60 | AGG 0
------------------------------------------------------------------------------
Val V GTT 42 | Ala A GCT 60 | Asp D GAT 48 | Gly G GGT 72
GTC 30 | GCC 6 | GAC 42 | GGC 24
GTA 12 | GCA 36 | Glu E GAA 24 | GGA 30
GTG 84 | GCG 102 | GAG 48 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.22105 C:0.21579 A:0.26316 G:0.30000
position 2: T:0.30570 C:0.26009 A:0.26053 G:0.17368
position 3: T:0.30000 C:0.18684 A:0.16316 G:0.35000
Average T:0.27558 C:0.22091 A:0.22895 G:0.27456
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -1544.635328 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.002690 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002710
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.002690);
(NC_011896_1_WP_010909049_1_2897_MLBR_RS13795: 0.000004, NC_002677_1_NP_302731_1_1603_ML2710: 0.000004, NZ_LVXE01000010_1_WP_010909049_1_261_A3216_RS04945: 0.000004, NZ_LYPH01000099_1_WP_010909049_1_2889_A8144_RS13950: 0.000004, NZ_CP029543_1_WP_010909049_1_2937_DIJ64_RS14940: 0.000004, NZ_AP014567_1_WP_119608035_1_3001_yidC: 0.002690);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 785.2 354.8 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 785.2 354.8 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 785.2 354.8 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 785.2 354.8 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 785.2 354.8 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.003 785.2 354.8 999.0000 0.0013 0.0000 1.0 0.0
tree length for dN: 0.0013
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1545.011324 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.002680 951.428574 0.000010 0.325705
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002700
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.002680);
(NC_011896_1_WP_010909049_1_2897_MLBR_RS13795: 0.000004, NC_002677_1_NP_302731_1_1603_ML2710: 0.000004, NZ_LVXE01000010_1_WP_010909049_1_261_A3216_RS04945: 0.000004, NZ_LYPH01000099_1_WP_010909049_1_2889_A8144_RS13950: 0.000004, NZ_CP029543_1_WP_010909049_1_2937_DIJ64_RS14940: 0.000004, NZ_AP014567_1_WP_119608035_1_3001_yidC: 0.002680);
Detailed output identifying parameters
kappa (ts/tv) = 951.42857
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.32571 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 785.2 354.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 785.2 354.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 785.2 354.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 785.2 354.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 785.2 354.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.003 785.2 354.8 1.0000 0.0009 0.0009 0.7 0.3
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1544.635454 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.002690 952.375868 0.000015 0.000000 0.000001 983.051463
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002710
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.002690);
(NC_011896_1_WP_010909049_1_2897_MLBR_RS13795: 0.000004, NC_002677_1_NP_302731_1_1603_ML2710: 0.000004, NZ_LVXE01000010_1_WP_010909049_1_261_A3216_RS04945: 0.000004, NZ_LYPH01000099_1_WP_010909049_1_2889_A8144_RS13950: 0.000004, NZ_CP029543_1_WP_010909049_1_2937_DIJ64_RS14940: 0.000004, NZ_AP014567_1_WP_119608035_1_3001_yidC: 0.002690);
Detailed output identifying parameters
kappa (ts/tv) = 952.37587
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00001 0.00000 0.99999
w: 0.00000 1.00000 983.05146
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 785.2 354.8 983.0370 0.0000 0.0000 0.0 0.0
7..2 0.000 785.2 354.8 983.0370 0.0000 0.0000 0.0 0.0
7..3 0.000 785.2 354.8 983.0370 0.0000 0.0000 0.0 0.0
7..4 0.000 785.2 354.8 983.0370 0.0000 0.0000 0.0 0.0
7..5 0.000 785.2 354.8 983.0370 0.0000 0.0000 0.0 0.0
7..6 0.003 785.2 354.8 983.0370 0.0013 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909049_1_2897_MLBR_RS13795)
Pr(w>1) post mean +- SE for w
1 V 1.000** 983.037
2 S 1.000** 983.037
3 L 1.000** 983.037
4 L 1.000** 983.037
5 P 1.000** 983.037
6 F 1.000** 983.037
7 D 1.000** 983.037
8 F 1.000** 983.037
9 V 1.000** 983.037
10 S 1.000** 983.037
11 L 1.000** 983.037
12 D 1.000** 983.037
13 I 1.000** 983.037
14 V 1.000** 983.037
15 Y 1.000** 983.037
16 Y 1.000** 983.037
17 P 1.000** 983.037
18 V 1.000** 983.037
19 S 1.000** 983.037
20 W 1.000** 983.037
21 I 1.000** 983.037
22 M 1.000** 983.037
23 W 1.000** 983.037
24 V 1.000** 983.037
25 W 1.000** 983.037
26 Y 1.000** 983.037
27 K 1.000** 983.037
28 L 1.000** 983.037
29 F 1.000** 983.037
30 A 1.000** 983.037
31 A 1.000** 983.037
32 V 1.000** 983.037
33 L 1.000** 983.037
34 G 1.000** 983.037
35 P 1.000** 983.037
36 S 1.000** 983.037
37 N 1.000** 983.037
38 F 1.000** 983.037
39 F 1.000** 983.037
40 A 1.000** 983.037
41 W 1.000** 983.037
42 A 1.000** 983.037
43 L 1.000** 983.037
44 S 1.000** 983.037
45 V 1.000** 983.037
46 M 1.000** 983.037
47 F 1.000** 983.037
48 L 1.000** 983.037
49 V 1.000** 983.037
50 F 1.000** 983.037
51 T 1.000** 983.037
52 L 1.000** 983.037
53 R 1.000** 983.037
54 A 1.000** 983.037
55 L 1.000** 983.037
56 L 1.000** 983.037
57 Y 1.000** 983.037
58 K 1.000** 983.037
59 P 1.000** 983.037
60 F 1.000** 983.037
61 V 1.000** 983.037
62 R 1.000** 983.037
63 Q 1.000** 983.037
64 I 1.000** 983.037
65 R 1.000** 983.037
66 T 1.000** 983.037
67 T 1.000** 983.037
68 R 1.000** 983.037
69 Q 1.000** 983.037
70 M 1.000** 983.037
71 Q 1.000** 983.037
72 E 1.000** 983.037
73 L 1.000** 983.037
74 Q 1.000** 983.037
75 P 1.000** 983.037
76 R 1.000** 983.037
77 I 1.000** 983.037
78 R 1.000** 983.037
79 A 1.000** 983.037
80 L 1.000** 983.037
81 Q 1.000** 983.037
82 R 1.000** 983.037
83 K 1.000** 983.037
84 Y 1.000** 983.037
85 G 1.000** 983.037
86 K 1.000** 983.037
87 D 1.000** 983.037
88 R 1.000** 983.037
89 Q 1.000** 983.037
90 R 1.000** 983.037
91 M 1.000** 983.037
92 A 1.000** 983.037
93 L 1.000** 983.037
94 E 1.000** 983.037
95 M 1.000** 983.037
96 Q 1.000** 983.037
97 K 1.000** 983.037
98 L 1.000** 983.037
99 Q 1.000** 983.037
100 R 1.000** 983.037
101 E 1.000** 983.037
102 H 1.000** 983.037
103 G 1.000** 983.037
104 F 1.000** 983.037
105 N 1.000** 983.037
106 P 1.000** 983.037
107 I 1.000** 983.037
108 L 1.000** 983.037
109 G 1.000** 983.037
110 C 1.000** 983.037
111 L 1.000** 983.037
112 P 1.000** 983.037
113 M 1.000** 983.037
114 L 1.000** 983.037
115 A 1.000** 983.037
116 Q 1.000** 983.037
117 I 1.000** 983.037
118 P 1.000** 983.037
119 V 1.000** 983.037
120 F 1.000** 983.037
121 L 1.000** 983.037
122 G 1.000** 983.037
123 L 1.000** 983.037
124 Y 1.000** 983.037
125 H 1.000** 983.037
126 A 1.000** 983.037
127 L 1.000** 983.037
128 R 1.000** 983.037
129 S 1.000** 983.037
130 F 1.000** 983.037
131 N 1.000** 983.037
132 R 1.000** 983.037
133 T 1.000** 983.037
134 T 1.000** 983.037
135 G 1.000** 983.037
136 G 1.000** 983.037
137 F 1.000** 983.037
138 G 1.000** 983.037
139 Q 1.000** 983.037
140 P 1.000** 983.037
141 H 1.000** 983.037
142 M 1.000** 983.037
143 S 1.000** 983.037
144 V 1.000** 983.037
145 T 1.000** 983.037
146 E 1.000** 983.037
147 N 1.000** 983.037
148 R 1.000** 983.037
149 M 1.000** 983.037
150 T 1.000** 983.037
151 G 1.000** 983.037
152 N 1.000** 983.037
153 Y 1.000** 983.037
154 V 1.000** 983.037
155 F 1.000** 983.037
156 T 1.000** 983.037
157 P 1.000** 983.037
158 V 1.000** 983.037
159 D 1.000** 983.037
160 V 1.000** 983.037
161 G 1.000** 983.037
162 H 1.000** 983.037
163 F 1.000** 983.037
164 L 1.000** 983.037
165 D 1.000** 983.037
166 A 1.000** 983.037
167 N 1.000** 983.037
168 L 1.000** 983.037
169 W 1.000** 983.037
170 G 1.000** 983.037
171 A 1.000** 983.037
172 P 1.000** 983.037
173 I 1.000** 983.037
174 G 1.000** 983.037
175 A 1.000** 983.037
176 Y 1.000** 983.037
177 M 1.000** 983.037
178 T 1.000** 983.037
179 Q 1.000** 983.037
180 R 1.000** 983.037
181 S 1.000** 983.037
182 G 1.000** 983.037
183 L 1.000** 983.037
184 D 1.000** 983.037
185 A 1.000** 983.037
186 F 1.000** 983.037
187 I 1.000** 983.037
188 D 1.000** 983.037
189 F 1.000** 983.037
190 S 1.000** 983.037
191 R 1.000** 983.037
192 P 1.000** 983.037
193 A 1.000** 983.037
194 V 1.000** 983.037
195 I 1.000** 983.037
196 L 1.000** 983.037
197 V 1.000** 983.037
198 G 1.000** 983.037
199 I 1.000** 983.037
200 P 1.000** 983.037
201 M 1.000** 983.037
202 M 1.000** 983.037
203 V 1.000** 983.037
204 L 1.000** 983.037
205 A 1.000** 983.037
206 G 1.000** 983.037
207 V 1.000** 983.037
208 A 1.000** 983.037
209 T 1.000** 983.037
210 Y 1.000** 983.037
211 F 1.000** 983.037
212 N 1.000** 983.037
213 S 1.000** 983.037
214 R 1.000** 983.037
215 A 1.000** 983.037
216 S 1.000** 983.037
217 I 1.000** 983.037
218 A 1.000** 983.037
219 R 1.000** 983.037
220 Q 1.000** 983.037
221 S 1.000** 983.037
222 A 1.000** 983.037
223 E 1.000** 983.037
224 A 1.000** 983.037
225 A 1.000** 983.037
226 E 1.000** 983.037
227 N 1.000** 983.037
228 P 1.000** 983.037
229 Q 1.000** 983.037
230 T 1.000** 983.037
231 A 1.000** 983.037
232 L 1.000** 983.037
233 M 1.000** 983.037
234 N 1.000** 983.037
235 K 1.000** 983.037
236 I 1.000** 983.037
237 A 1.000** 983.037
238 L 1.000** 983.037
239 Y 1.000** 983.037
240 V 1.000** 983.037
241 F 1.000** 983.037
242 P 1.000** 983.037
243 F 1.000** 983.037
244 G 1.000** 983.037
245 V 1.000** 983.037
246 V 1.000** 983.037
247 V 1.000** 983.037
248 G 1.000** 983.037
249 G 1.000** 983.037
250 P 1.000** 983.037
251 F 1.000** 983.037
252 L 1.000** 983.037
253 P 1.000** 983.037
254 L 1.000** 983.037
255 A 1.000** 983.037
256 I 1.000** 983.037
257 I 1.000** 983.037
258 L 1.000** 983.037
259 Y 1.000** 983.037
260 W 1.000** 983.037
261 F 1.000** 983.037
262 S 1.000** 983.037
263 N 1.000** 983.037
264 N 1.000** 983.037
265 I 1.000** 983.037
266 W 1.000** 983.037
267 T 1.000** 983.037
268 F 1.000** 983.037
269 G 1.000** 983.037
270 Q 1.000** 983.037
271 Q 1.000** 983.037
272 H 1.000** 983.037
273 Y 1.000** 983.037
274 V 1.000** 983.037
275 F 1.000** 983.037
276 S 1.000** 983.037
277 M 1.000** 983.037
278 I 1.000** 983.037
279 E 1.000** 983.037
280 K 1.000** 983.037
281 E 1.000** 983.037
282 D 1.000** 983.037
283 E 1.000** 983.037
284 A 1.000** 983.037
285 K 1.000** 983.037
286 K 1.000** 983.037
287 Q 1.000** 983.037
288 K 1.000** 983.037
289 A 1.000** 983.037
290 I 1.000** 983.037
291 E 1.000** 983.037
292 R 1.000** 983.037
293 R 1.000** 983.037
294 T 1.000** 983.037
295 A 1.000** 983.037
296 N 1.000** 983.037
297 A 1.000** 983.037
298 P 1.000** 983.037
299 A 1.000** 983.037
300 P 1.000** 983.037
301 G 1.000** 983.037
302 S 1.000** 983.037
303 K 1.000** 983.037
304 P 1.000** 983.037
305 K 1.000** 983.037
306 Y 1.000** 983.037
307 V 1.000** 983.037
308 S 1.000** 983.037
309 T 1.000** 983.037
310 T 1.000** 983.037
311 A 1.000** 983.037
312 P 1.000** 983.037
313 V 1.000** 983.037
314 S 1.000** 983.037
315 V 1.000** 983.037
316 N 1.000** 983.037
317 G 1.000** 983.037
318 F 1.000** 983.037
319 S 1.000** 983.037
320 K 1.000** 983.037
321 D 1.000** 983.037
322 T 1.000** 983.037
323 M 1.000** 983.037
324 I 1.000** 983.037
325 S 1.000** 983.037
326 D 1.000** 983.037
327 D 1.000** 983.037
328 G 1.000** 983.037
329 A 1.000** 983.037
330 K 1.000** 983.037
331 L 1.000** 983.037
332 G 1.000** 983.037
333 S 1.000** 983.037
334 Q 1.000** 983.037
335 E 1.000** 983.037
336 A 1.000** 983.037
337 D 1.000** 983.037
338 S 1.000** 983.037
339 I 1.000** 983.037
340 D 1.000** 983.037
341 W 1.000** 983.037
342 V 1.000** 983.037
343 T 1.000** 983.037
344 E 1.000** 983.037
345 T 1.000** 983.037
346 K 1.000** 983.037
347 T 1.000** 983.037
348 A 1.000** 983.037
349 T 1.000** 983.037
350 T 1.000** 983.037
351 P 1.000** 983.051
352 A 1.000** 983.037
353 D 1.000** 983.037
354 K 1.000** 983.037
355 P 1.000** 983.037
356 D 1.000** 983.037
357 C 1.000** 983.037
358 V 1.000** 983.037
359 G 1.000** 983.037
360 Y 1.000** 983.037
361 N 1.000** 983.037
362 N 1.000** 983.037
363 N 1.000** 983.037
364 P 1.000** 983.037
365 T 1.000** 983.037
366 S 1.000** 983.037
367 H 1.000** 983.037
368 T 1.000** 983.037
369 R 1.000** 983.037
370 R 1.000** 983.037
371 S 1.000** 983.037
372 G 1.000** 983.037
373 Q 1.000** 983.037
374 R 1.000** 983.037
375 T 1.000** 983.037
376 K 1.000** 983.037
377 R 1.000** 983.037
378 R 1.000** 983.037
379 K 1.000** 983.037
380 R 1.000** 983.037
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909049_1_2897_MLBR_RS13795)
Pr(w>1) post mean +- SE for w
351 P 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1545.011320 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.002680 952.375913 3.247356 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002700
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.002680);
(NC_011896_1_WP_010909049_1_2897_MLBR_RS13795: 0.000004, NC_002677_1_NP_302731_1_1603_ML2710: 0.000004, NZ_LVXE01000010_1_WP_010909049_1_261_A3216_RS04945: 0.000004, NZ_LYPH01000099_1_WP_010909049_1_2889_A8144_RS13950: 0.000004, NZ_CP029543_1_WP_010909049_1_2937_DIJ64_RS14940: 0.000004, NZ_AP014567_1_WP_119608035_1_3001_yidC: 0.002680);
Detailed output identifying parameters
kappa (ts/tv) = 952.37591
Parameters in M7 (beta):
p = 3.24736 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 785.2 354.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 785.2 354.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 785.2 354.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 785.2 354.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 785.2 354.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.003 785.2 354.8 1.0000 0.0009 0.0009 0.7 0.3
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1544.635469 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.002690 952.376784 0.000010 0.005006 1.860815 951.442049
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002710
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.002690);
(NC_011896_1_WP_010909049_1_2897_MLBR_RS13795: 0.000004, NC_002677_1_NP_302731_1_1603_ML2710: 0.000004, NZ_LVXE01000010_1_WP_010909049_1_261_A3216_RS04945: 0.000004, NZ_LYPH01000099_1_WP_010909049_1_2889_A8144_RS13950: 0.000004, NZ_CP029543_1_WP_010909049_1_2937_DIJ64_RS14940: 0.000004, NZ_AP014567_1_WP_119608035_1_3001_yidC: 0.002690);
Detailed output identifying parameters
kappa (ts/tv) = 952.37678
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00501 q = 1.86082
(p1 = 0.99999) w = 951.44205
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 951.44205
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 785.2 354.8 951.4325 0.0000 0.0000 0.0 0.0
7..2 0.000 785.2 354.8 951.4325 0.0000 0.0000 0.0 0.0
7..3 0.000 785.2 354.8 951.4325 0.0000 0.0000 0.0 0.0
7..4 0.000 785.2 354.8 951.4325 0.0000 0.0000 0.0 0.0
7..5 0.000 785.2 354.8 951.4325 0.0000 0.0000 0.0 0.0
7..6 0.003 785.2 354.8 951.4325 0.0013 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909049_1_2897_MLBR_RS13795)
Pr(w>1) post mean +- SE for w
1 V 1.000** 951.432
2 S 1.000** 951.433
3 L 1.000** 951.433
4 L 1.000** 951.433
5 P 1.000** 951.433
6 F 1.000** 951.433
7 D 1.000** 951.433
8 F 1.000** 951.433
9 V 1.000** 951.433
10 S 1.000** 951.433
11 L 1.000** 951.433
12 D 1.000** 951.433
13 I 1.000** 951.433
14 V 1.000** 951.433
15 Y 1.000** 951.433
16 Y 1.000** 951.433
17 P 1.000** 951.433
18 V 1.000** 951.432
19 S 1.000** 951.433
20 W 1.000** 951.433
21 I 1.000** 951.432
22 M 1.000** 951.432
23 W 1.000** 951.433
24 V 1.000** 951.432
25 W 1.000** 951.433
26 Y 1.000** 951.433
27 K 1.000** 951.433
28 L 1.000** 951.433
29 F 1.000** 951.433
30 A 1.000** 951.432
31 A 1.000** 951.432
32 V 1.000** 951.432
33 L 1.000** 951.433
34 G 1.000** 951.433
35 P 1.000** 951.433
36 S 1.000** 951.433
37 N 1.000** 951.433
38 F 1.000** 951.433
39 F 1.000** 951.433
40 A 1.000** 951.433
41 W 1.000** 951.433
42 A 1.000** 951.432
43 L 1.000** 951.433
44 S 1.000** 951.433
45 V 1.000** 951.432
46 M 1.000** 951.432
47 F 1.000** 951.433
48 L 1.000** 951.433
49 V 1.000** 951.432
50 F 1.000** 951.433
51 T 1.000** 951.433
52 L 1.000** 951.433
53 R 1.000** 951.433
54 A 1.000** 951.432
55 L 1.000** 951.433
56 L 1.000** 951.433
57 Y 1.000** 951.433
58 K 1.000** 951.433
59 P 1.000** 951.433
60 F 1.000** 951.433
61 V 1.000** 951.432
62 R 1.000** 951.433
63 Q 1.000** 951.433
64 I 1.000** 951.433
65 R 1.000** 951.433
66 T 1.000** 951.433
67 T 1.000** 951.432
68 R 1.000** 951.433
69 Q 1.000** 951.433
70 M 1.000** 951.432
71 Q 1.000** 951.433
72 E 1.000** 951.433
73 L 1.000** 951.433
74 Q 1.000** 951.433
75 P 1.000** 951.433
76 R 1.000** 951.433
77 I 1.000** 951.432
78 R 1.000** 951.433
79 A 1.000** 951.432
80 L 1.000** 951.433
81 Q 1.000** 951.433
82 R 1.000** 951.433
83 K 1.000** 951.433
84 Y 1.000** 951.433
85 G 1.000** 951.433
86 K 1.000** 951.433
87 D 1.000** 951.433
88 R 1.000** 951.433
89 Q 1.000** 951.433
90 R 1.000** 951.433
91 M 1.000** 951.432
92 A 1.000** 951.432
93 L 1.000** 951.433
94 E 1.000** 951.433
95 M 1.000** 951.432
96 Q 1.000** 951.433
97 K 1.000** 951.433
98 L 1.000** 951.433
99 Q 1.000** 951.433
100 R 1.000** 951.433
101 E 1.000** 951.433
102 H 1.000** 951.433
103 G 1.000** 951.433
104 F 1.000** 951.433
105 N 1.000** 951.433
106 P 1.000** 951.433
107 I 1.000** 951.432
108 L 1.000** 951.433
109 G 1.000** 951.433
110 C 1.000** 951.433
111 L 1.000** 951.433
112 P 1.000** 951.433
113 M 1.000** 951.432
114 L 1.000** 951.433
115 A 1.000** 951.432
116 Q 1.000** 951.433
117 I 1.000** 951.432
118 P 1.000** 951.433
119 V 1.000** 951.432
120 F 1.000** 951.433
121 L 1.000** 951.433
122 G 1.000** 951.433
123 L 1.000** 951.433
124 Y 1.000** 951.433
125 H 1.000** 951.433
126 A 1.000** 951.432
127 L 1.000** 951.433
128 R 1.000** 951.433
129 S 1.000** 951.433
130 F 1.000** 951.433
131 N 1.000** 951.433
132 R 1.000** 951.433
133 T 1.000** 951.433
134 T 1.000** 951.432
135 G 1.000** 951.433
136 G 1.000** 951.433
137 F 1.000** 951.433
138 G 1.000** 951.433
139 Q 1.000** 951.433
140 P 1.000** 951.433
141 H 1.000** 951.433
142 M 1.000** 951.432
143 S 1.000** 951.433
144 V 1.000** 951.432
145 T 1.000** 951.433
146 E 1.000** 951.433
147 N 1.000** 951.433
148 R 1.000** 951.433
149 M 1.000** 951.432
150 T 1.000** 951.433
151 G 1.000** 951.433
152 N 1.000** 951.433
153 Y 1.000** 951.433
154 V 1.000** 951.432
155 F 1.000** 951.433
156 T 1.000** 951.433
157 P 1.000** 951.433
158 V 1.000** 951.432
159 D 1.000** 951.433
160 V 1.000** 951.432
161 G 1.000** 951.433
162 H 1.000** 951.433
163 F 1.000** 951.433
164 L 1.000** 951.433
165 D 1.000** 951.433
166 A 1.000** 951.433
167 N 1.000** 951.433
168 L 1.000** 951.433
169 W 1.000** 951.433
170 G 1.000** 951.433
171 A 1.000** 951.432
172 P 1.000** 951.433
173 I 1.000** 951.432
174 G 1.000** 951.433
175 A 1.000** 951.432
176 Y 1.000** 951.433
177 M 1.000** 951.432
178 T 1.000** 951.432
179 Q 1.000** 951.433
180 R 1.000** 951.433
181 S 1.000** 951.433
182 G 1.000** 951.433
183 L 1.000** 951.433
184 D 1.000** 951.433
185 A 1.000** 951.432
186 F 1.000** 951.433
187 I 1.000** 951.432
188 D 1.000** 951.433
189 F 1.000** 951.433
190 S 1.000** 951.433
191 R 1.000** 951.433
192 P 1.000** 951.433
193 A 1.000** 951.432
194 V 1.000** 951.432
195 I 1.000** 951.432
196 L 1.000** 951.433
197 V 1.000** 951.432
198 G 1.000** 951.433
199 I 1.000** 951.432
200 P 1.000** 951.433
201 M 1.000** 951.432
202 M 1.000** 951.432
203 V 1.000** 951.432
204 L 1.000** 951.433
205 A 1.000** 951.432
206 G 1.000** 951.433
207 V 1.000** 951.432
208 A 1.000** 951.432
209 T 1.000** 951.432
210 Y 1.000** 951.433
211 F 1.000** 951.433
212 N 1.000** 951.433
213 S 1.000** 951.433
214 R 1.000** 951.433
215 A 1.000** 951.432
216 S 1.000** 951.433
217 I 1.000** 951.432
218 A 1.000** 951.433
219 R 1.000** 951.433
220 Q 1.000** 951.433
221 S 1.000** 951.433
222 A 1.000** 951.432
223 E 1.000** 951.433
224 A 1.000** 951.433
225 A 1.000** 951.433
226 E 1.000** 951.433
227 N 1.000** 951.433
228 P 1.000** 951.433
229 Q 1.000** 951.433
230 T 1.000** 951.432
231 A 1.000** 951.432
232 L 1.000** 951.433
233 M 1.000** 951.432
234 N 1.000** 951.433
235 K 1.000** 951.433
236 I 1.000** 951.432
237 A 1.000** 951.432
238 L 1.000** 951.433
239 Y 1.000** 951.433
240 V 1.000** 951.432
241 F 1.000** 951.433
242 P 1.000** 951.433
243 F 1.000** 951.433
244 G 1.000** 951.433
245 V 1.000** 951.433
246 V 1.000** 951.432
247 V 1.000** 951.433
248 G 1.000** 951.433
249 G 1.000** 951.433
250 P 1.000** 951.433
251 F 1.000** 951.433
252 L 1.000** 951.433
253 P 1.000** 951.433
254 L 1.000** 951.433
255 A 1.000** 951.432
256 I 1.000** 951.432
257 I 1.000** 951.432
258 L 1.000** 951.433
259 Y 1.000** 951.433
260 W 1.000** 951.433
261 F 1.000** 951.433
262 S 1.000** 951.433
263 N 1.000** 951.433
264 N 1.000** 951.433
265 I 1.000** 951.433
266 W 1.000** 951.433
267 T 1.000** 951.432
268 F 1.000** 951.433
269 G 1.000** 951.433
270 Q 1.000** 951.433
271 Q 1.000** 951.433
272 H 1.000** 951.433
273 Y 1.000** 951.433
274 V 1.000** 951.432
275 F 1.000** 951.433
276 S 1.000** 951.433
277 M 1.000** 951.432
278 I 1.000** 951.433
279 E 1.000** 951.433
280 K 1.000** 951.433
281 E 1.000** 951.433
282 D 1.000** 951.433
283 E 1.000** 951.433
284 A 1.000** 951.432
285 K 1.000** 951.433
286 K 1.000** 951.433
287 Q 1.000** 951.433
288 K 1.000** 951.433
289 A 1.000** 951.432
290 I 1.000** 951.433
291 E 1.000** 951.433
292 R 1.000** 951.433
293 R 1.000** 951.433
294 T 1.000** 951.432
295 A 1.000** 951.432
296 N 1.000** 951.433
297 A 1.000** 951.432
298 P 1.000** 951.433
299 A 1.000** 951.432
300 P 1.000** 951.433
301 G 1.000** 951.433
302 S 1.000** 951.433
303 K 1.000** 951.433
304 P 1.000** 951.433
305 K 1.000** 951.433
306 Y 1.000** 951.433
307 V 1.000** 951.433
308 S 1.000** 951.433
309 T 1.000** 951.432
310 T 1.000** 951.432
311 A 1.000** 951.433
312 P 1.000** 951.433
313 V 1.000** 951.433
314 S 1.000** 951.433
315 V 1.000** 951.432
316 N 1.000** 951.433
317 G 1.000** 951.433
318 F 1.000** 951.433
319 S 1.000** 951.433
320 K 1.000** 951.433
321 D 1.000** 951.433
322 T 1.000** 951.433
323 M 1.000** 951.432
324 I 1.000** 951.432
325 S 1.000** 951.433
326 D 1.000** 951.433
327 D 1.000** 951.433
328 G 1.000** 951.433
329 A 1.000** 951.433
330 K 1.000** 951.433
331 L 1.000** 951.433
332 G 1.000** 951.433
333 S 1.000** 951.433
334 Q 1.000** 951.433
335 E 1.000** 951.433
336 A 1.000** 951.432
337 D 1.000** 951.433
338 S 1.000** 951.433
339 I 1.000** 951.432
340 D 1.000** 951.433
341 W 1.000** 951.433
342 V 1.000** 951.432
343 T 1.000** 951.432
344 E 1.000** 951.433
345 T 1.000** 951.432
346 K 1.000** 951.433
347 T 1.000** 951.433
348 A 1.000** 951.432
349 T 1.000** 951.433
350 T 1.000** 951.432
351 P 1.000** 951.442
352 A 1.000** 951.432
353 D 1.000** 951.433
354 K 1.000** 951.433
355 P 1.000** 951.433
356 D 1.000** 951.433
357 C 1.000** 951.433
358 V 1.000** 951.433
359 G 1.000** 951.433
360 Y 1.000** 951.433
361 N 1.000** 951.433
362 N 1.000** 951.433
363 N 1.000** 951.433
364 P 1.000** 951.433
365 T 1.000** 951.433
366 S 1.000** 951.433
367 H 1.000** 951.433
368 T 1.000** 951.432
369 R 1.000** 951.433
370 R 1.000** 951.433
371 S 1.000** 951.433
372 G 1.000** 951.433
373 Q 1.000** 951.433
374 R 1.000** 951.433
375 T 1.000** 951.433
376 K 1.000** 951.433
377 R 1.000** 951.433
378 R 1.000** 951.433
379 K 1.000** 951.433
380 R 1.000** 951.433
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909049_1_2897_MLBR_RS13795)
Pr(w>1) post mean +- SE for w
1 V 0.639 4.860 +- 3.856
2 S 0.639 4.860 +- 3.856
3 L 0.639 4.860 +- 3.856
4 L 0.639 4.860 +- 3.856
5 P 0.639 4.860 +- 3.856
6 F 0.639 4.860 +- 3.856
7 D 0.639 4.860 +- 3.856
8 F 0.639 4.860 +- 3.856
9 V 0.639 4.860 +- 3.856
10 S 0.639 4.860 +- 3.856
11 L 0.639 4.860 +- 3.856
12 D 0.639 4.860 +- 3.856
13 I 0.639 4.860 +- 3.856
14 V 0.639 4.860 +- 3.856
15 Y 0.639 4.860 +- 3.856
16 Y 0.639 4.860 +- 3.856
17 P 0.639 4.860 +- 3.856
18 V 0.639 4.860 +- 3.856
19 S 0.639 4.860 +- 3.856
20 W 0.639 4.860 +- 3.856
21 I 0.639 4.860 +- 3.856
22 M 0.639 4.860 +- 3.856
23 W 0.639 4.860 +- 3.856
24 V 0.639 4.860 +- 3.856
25 W 0.639 4.860 +- 3.856
26 Y 0.639 4.860 +- 3.856
27 K 0.639 4.860 +- 3.856
28 L 0.639 4.860 +- 3.856
29 F 0.639 4.860 +- 3.856
30 A 0.639 4.860 +- 3.856
31 A 0.639 4.860 +- 3.856
32 V 0.639 4.860 +- 3.856
33 L 0.639 4.860 +- 3.856
34 G 0.639 4.860 +- 3.856
35 P 0.639 4.860 +- 3.856
36 S 0.639 4.860 +- 3.856
37 N 0.639 4.860 +- 3.856
38 F 0.639 4.860 +- 3.856
39 F 0.639 4.860 +- 3.856
40 A 0.639 4.860 +- 3.856
41 W 0.639 4.860 +- 3.856
42 A 0.639 4.860 +- 3.856
43 L 0.639 4.860 +- 3.856
44 S 0.639 4.860 +- 3.856
45 V 0.639 4.860 +- 3.856
46 M 0.639 4.860 +- 3.856
47 F 0.639 4.860 +- 3.856
48 L 0.639 4.860 +- 3.856
49 V 0.639 4.860 +- 3.856
50 F 0.639 4.860 +- 3.856
51 T 0.639 4.860 +- 3.856
52 L 0.639 4.860 +- 3.856
53 R 0.639 4.860 +- 3.856
54 A 0.639 4.860 +- 3.856
55 L 0.639 4.860 +- 3.856
56 L 0.639 4.860 +- 3.856
57 Y 0.639 4.860 +- 3.856
58 K 0.639 4.860 +- 3.856
59 P 0.639 4.860 +- 3.856
60 F 0.639 4.860 +- 3.856
61 V 0.639 4.860 +- 3.856
62 R 0.639 4.860 +- 3.856
63 Q 0.639 4.860 +- 3.856
64 I 0.639 4.860 +- 3.856
65 R 0.639 4.860 +- 3.856
66 T 0.639 4.860 +- 3.856
67 T 0.639 4.860 +- 3.856
68 R 0.639 4.860 +- 3.856
69 Q 0.639 4.860 +- 3.856
70 M 0.639 4.860 +- 3.856
71 Q 0.639 4.860 +- 3.856
72 E 0.639 4.860 +- 3.856
73 L 0.639 4.860 +- 3.856
74 Q 0.639 4.860 +- 3.856
75 P 0.639 4.860 +- 3.856
76 R 0.639 4.860 +- 3.856
77 I 0.639 4.860 +- 3.856
78 R 0.639 4.860 +- 3.856
79 A 0.639 4.860 +- 3.856
80 L 0.639 4.860 +- 3.856
81 Q 0.639 4.860 +- 3.856
82 R 0.639 4.860 +- 3.856
83 K 0.639 4.860 +- 3.856
84 Y 0.639 4.860 +- 3.856
85 G 0.639 4.860 +- 3.856
86 K 0.639 4.860 +- 3.856
87 D 0.639 4.860 +- 3.856
88 R 0.639 4.860 +- 3.856
89 Q 0.639 4.860 +- 3.856
90 R 0.639 4.860 +- 3.856
91 M 0.639 4.860 +- 3.856
92 A 0.639 4.860 +- 3.856
93 L 0.639 4.860 +- 3.856
94 E 0.639 4.860 +- 3.856
95 M 0.639 4.860 +- 3.856
96 Q 0.639 4.860 +- 3.856
97 K 0.639 4.860 +- 3.856
98 L 0.639 4.860 +- 3.856
99 Q 0.639 4.860 +- 3.856
100 R 0.639 4.860 +- 3.856
101 E 0.639 4.860 +- 3.856
102 H 0.639 4.860 +- 3.856
103 G 0.639 4.860 +- 3.856
104 F 0.639 4.860 +- 3.856
105 N 0.639 4.860 +- 3.856
106 P 0.639 4.860 +- 3.856
107 I 0.639 4.860 +- 3.856
108 L 0.639 4.860 +- 3.856
109 G 0.639 4.860 +- 3.856
110 C 0.639 4.860 +- 3.856
111 L 0.639 4.860 +- 3.856
112 P 0.639 4.860 +- 3.856
113 M 0.639 4.860 +- 3.856
114 L 0.639 4.860 +- 3.856
115 A 0.639 4.860 +- 3.856
116 Q 0.639 4.860 +- 3.856
117 I 0.639 4.860 +- 3.856
118 P 0.639 4.860 +- 3.856
119 V 0.639 4.860 +- 3.856
120 F 0.639 4.860 +- 3.856
121 L 0.639 4.860 +- 3.856
122 G 0.639 4.860 +- 3.856
123 L 0.639 4.860 +- 3.856
124 Y 0.639 4.860 +- 3.856
125 H 0.639 4.860 +- 3.856
126 A 0.639 4.860 +- 3.856
127 L 0.639 4.860 +- 3.856
128 R 0.639 4.860 +- 3.856
129 S 0.639 4.860 +- 3.856
130 F 0.639 4.860 +- 3.856
131 N 0.639 4.860 +- 3.856
132 R 0.639 4.860 +- 3.856
133 T 0.639 4.860 +- 3.856
134 T 0.639 4.860 +- 3.856
135 G 0.639 4.860 +- 3.856
136 G 0.639 4.860 +- 3.856
137 F 0.639 4.860 +- 3.856
138 G 0.639 4.860 +- 3.856
139 Q 0.639 4.860 +- 3.856
140 P 0.639 4.860 +- 3.856
141 H 0.639 4.860 +- 3.856
142 M 0.639 4.860 +- 3.856
143 S 0.639 4.860 +- 3.856
144 V 0.639 4.860 +- 3.856
145 T 0.639 4.860 +- 3.856
146 E 0.639 4.860 +- 3.856
147 N 0.639 4.860 +- 3.856
148 R 0.639 4.860 +- 3.856
149 M 0.639 4.860 +- 3.856
150 T 0.639 4.860 +- 3.856
151 G 0.639 4.860 +- 3.856
152 N 0.639 4.860 +- 3.856
153 Y 0.639 4.860 +- 3.856
154 V 0.639 4.860 +- 3.856
155 F 0.639 4.860 +- 3.856
156 T 0.639 4.860 +- 3.856
157 P 0.639 4.860 +- 3.856
158 V 0.639 4.860 +- 3.856
159 D 0.639 4.860 +- 3.856
160 V 0.639 4.860 +- 3.856
161 G 0.639 4.860 +- 3.856
162 H 0.639 4.860 +- 3.856
163 F 0.639 4.860 +- 3.856
164 L 0.639 4.860 +- 3.856
165 D 0.639 4.860 +- 3.856
166 A 0.639 4.860 +- 3.856
167 N 0.639 4.860 +- 3.856
168 L 0.639 4.860 +- 3.856
169 W 0.639 4.860 +- 3.856
170 G 0.639 4.860 +- 3.856
171 A 0.639 4.860 +- 3.856
172 P 0.639 4.860 +- 3.856
173 I 0.639 4.860 +- 3.856
174 G 0.639 4.860 +- 3.856
175 A 0.639 4.860 +- 3.856
176 Y 0.639 4.860 +- 3.856
177 M 0.639 4.860 +- 3.856
178 T 0.639 4.860 +- 3.856
179 Q 0.639 4.860 +- 3.856
180 R 0.639 4.860 +- 3.856
181 S 0.639 4.860 +- 3.856
182 G 0.639 4.860 +- 3.856
183 L 0.639 4.860 +- 3.856
184 D 0.639 4.860 +- 3.856
185 A 0.639 4.860 +- 3.856
186 F 0.639 4.860 +- 3.856
187 I 0.639 4.860 +- 3.856
188 D 0.639 4.860 +- 3.856
189 F 0.639 4.860 +- 3.856
190 S 0.639 4.860 +- 3.856
191 R 0.639 4.860 +- 3.856
192 P 0.639 4.860 +- 3.856
193 A 0.639 4.860 +- 3.856
194 V 0.639 4.860 +- 3.856
195 I 0.639 4.860 +- 3.856
196 L 0.639 4.860 +- 3.856
197 V 0.639 4.860 +- 3.856
198 G 0.639 4.860 +- 3.856
199 I 0.639 4.860 +- 3.856
200 P 0.639 4.860 +- 3.856
201 M 0.639 4.860 +- 3.856
202 M 0.639 4.860 +- 3.856
203 V 0.639 4.860 +- 3.856
204 L 0.639 4.860 +- 3.856
205 A 0.639 4.860 +- 3.856
206 G 0.639 4.860 +- 3.856
207 V 0.639 4.860 +- 3.856
208 A 0.639 4.860 +- 3.856
209 T 0.639 4.860 +- 3.856
210 Y 0.639 4.860 +- 3.856
211 F 0.639 4.860 +- 3.856
212 N 0.639 4.860 +- 3.856
213 S 0.639 4.860 +- 3.856
214 R 0.639 4.860 +- 3.856
215 A 0.639 4.860 +- 3.856
216 S 0.639 4.860 +- 3.856
217 I 0.639 4.860 +- 3.856
218 A 0.639 4.860 +- 3.856
219 R 0.639 4.860 +- 3.856
220 Q 0.639 4.860 +- 3.856
221 S 0.639 4.860 +- 3.856
222 A 0.639 4.860 +- 3.856
223 E 0.639 4.860 +- 3.856
224 A 0.639 4.860 +- 3.856
225 A 0.639 4.860 +- 3.856
226 E 0.639 4.860 +- 3.856
227 N 0.639 4.860 +- 3.856
228 P 0.639 4.860 +- 3.856
229 Q 0.639 4.860 +- 3.856
230 T 0.639 4.860 +- 3.856
231 A 0.639 4.860 +- 3.856
232 L 0.639 4.860 +- 3.856
233 M 0.639 4.860 +- 3.856
234 N 0.639 4.860 +- 3.856
235 K 0.639 4.860 +- 3.856
236 I 0.639 4.860 +- 3.856
237 A 0.639 4.860 +- 3.856
238 L 0.639 4.860 +- 3.856
239 Y 0.639 4.860 +- 3.856
240 V 0.639 4.860 +- 3.856
241 F 0.639 4.860 +- 3.856
242 P 0.639 4.860 +- 3.856
243 F 0.639 4.860 +- 3.856
244 G 0.639 4.860 +- 3.856
245 V 0.639 4.860 +- 3.856
246 V 0.639 4.860 +- 3.856
247 V 0.639 4.860 +- 3.856
248 G 0.639 4.860 +- 3.856
249 G 0.639 4.860 +- 3.856
250 P 0.639 4.860 +- 3.856
251 F 0.639 4.860 +- 3.856
252 L 0.639 4.860 +- 3.856
253 P 0.639 4.860 +- 3.856
254 L 0.639 4.860 +- 3.856
255 A 0.639 4.860 +- 3.856
256 I 0.639 4.860 +- 3.856
257 I 0.639 4.860 +- 3.856
258 L 0.639 4.860 +- 3.856
259 Y 0.639 4.860 +- 3.856
260 W 0.639 4.860 +- 3.856
261 F 0.639 4.860 +- 3.856
262 S 0.639 4.860 +- 3.856
263 N 0.639 4.860 +- 3.856
264 N 0.639 4.860 +- 3.856
265 I 0.639 4.860 +- 3.856
266 W 0.639 4.860 +- 3.856
267 T 0.639 4.860 +- 3.856
268 F 0.639 4.860 +- 3.856
269 G 0.639 4.860 +- 3.856
270 Q 0.639 4.860 +- 3.856
271 Q 0.639 4.860 +- 3.856
272 H 0.639 4.860 +- 3.856
273 Y 0.639 4.860 +- 3.856
274 V 0.639 4.860 +- 3.856
275 F 0.639 4.860 +- 3.856
276 S 0.639 4.860 +- 3.856
277 M 0.639 4.860 +- 3.856
278 I 0.639 4.860 +- 3.856
279 E 0.639 4.860 +- 3.856
280 K 0.639 4.860 +- 3.856
281 E 0.639 4.860 +- 3.856
282 D 0.639 4.860 +- 3.856
283 E 0.639 4.860 +- 3.856
284 A 0.639 4.860 +- 3.856
285 K 0.639 4.860 +- 3.856
286 K 0.639 4.860 +- 3.856
287 Q 0.639 4.860 +- 3.856
288 K 0.639 4.860 +- 3.856
289 A 0.639 4.860 +- 3.856
290 I 0.639 4.860 +- 3.856
291 E 0.639 4.860 +- 3.856
292 R 0.639 4.860 +- 3.856
293 R 0.639 4.860 +- 3.856
294 T 0.639 4.860 +- 3.856
295 A 0.639 4.860 +- 3.856
296 N 0.639 4.860 +- 3.856
297 A 0.639 4.860 +- 3.856
298 P 0.639 4.860 +- 3.856
299 A 0.639 4.860 +- 3.856
300 P 0.639 4.860 +- 3.856
301 G 0.639 4.860 +- 3.856
302 S 0.639 4.860 +- 3.856
303 K 0.639 4.860 +- 3.856
304 P 0.639 4.860 +- 3.856
305 K 0.639 4.860 +- 3.856
306 Y 0.639 4.860 +- 3.856
307 V 0.639 4.860 +- 3.856
308 S 0.639 4.860 +- 3.856
309 T 0.639 4.860 +- 3.856
310 T 0.639 4.860 +- 3.856
311 A 0.639 4.860 +- 3.856
312 P 0.639 4.860 +- 3.856
313 V 0.639 4.860 +- 3.856
314 S 0.639 4.860 +- 3.856
315 V 0.639 4.860 +- 3.856
316 N 0.639 4.860 +- 3.856
317 G 0.639 4.860 +- 3.856
318 F 0.639 4.860 +- 3.856
319 S 0.639 4.860 +- 3.856
320 K 0.639 4.860 +- 3.856
321 D 0.639 4.860 +- 3.856
322 T 0.639 4.860 +- 3.856
323 M 0.639 4.860 +- 3.856
324 I 0.639 4.860 +- 3.856
325 S 0.639 4.860 +- 3.856
326 D 0.639 4.860 +- 3.856
327 D 0.639 4.860 +- 3.856
328 G 0.639 4.860 +- 3.856
329 A 0.639 4.860 +- 3.856
330 K 0.639 4.860 +- 3.856
331 L 0.639 4.860 +- 3.856
332 G 0.639 4.860 +- 3.856
333 S 0.639 4.860 +- 3.856
334 Q 0.639 4.860 +- 3.856
335 E 0.639 4.860 +- 3.856
336 A 0.639 4.860 +- 3.856
337 D 0.639 4.860 +- 3.856
338 S 0.639 4.860 +- 3.856
339 I 0.639 4.860 +- 3.856
340 D 0.639 4.860 +- 3.856
341 W 0.639 4.860 +- 3.856
342 V 0.639 4.860 +- 3.856
343 T 0.639 4.860 +- 3.856
344 E 0.639 4.860 +- 3.856
345 T 0.639 4.860 +- 3.856
346 K 0.639 4.860 +- 3.856
347 T 0.639 4.860 +- 3.856
348 A 0.639 4.860 +- 3.856
349 T 0.639 4.860 +- 3.856
350 T 0.639 4.860 +- 3.856
351 P 0.923 6.858 +- 3.003
352 A 0.639 4.860 +- 3.856
353 D 0.639 4.860 +- 3.856
354 K 0.639 4.860 +- 3.856
355 P 0.639 4.860 +- 3.856
356 D 0.639 4.860 +- 3.856
357 C 0.639 4.860 +- 3.856
358 V 0.639 4.860 +- 3.856
359 G 0.639 4.860 +- 3.856
360 Y 0.639 4.860 +- 3.856
361 N 0.639 4.860 +- 3.856
362 N 0.639 4.860 +- 3.856
363 N 0.639 4.860 +- 3.856
364 P 0.639 4.860 +- 3.856
365 T 0.639 4.860 +- 3.856
366 S 0.639 4.860 +- 3.856
367 H 0.639 4.860 +- 3.856
368 T 0.639 4.860 +- 3.856
369 R 0.639 4.860 +- 3.856
370 R 0.639 4.860 +- 3.856
371 S 0.639 4.860 +- 3.856
372 G 0.639 4.860 +- 3.856
373 Q 0.639 4.860 +- 3.856
374 R 0.639 4.860 +- 3.856
375 T 0.639 4.860 +- 3.856
376 K 0.639 4.860 +- 3.856
377 R 0.639 4.860 +- 3.856
378 R 0.639 4.860 +- 3.856
379 K 0.639 4.860 +- 3.856
380 R 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:19