--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 12:36:27 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/mmaA1/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1178.51         -1184.13
2      -1178.50         -1182.30
--------------------------------------
TOTAL    -1178.50         -1183.58
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.905452    0.094808    0.356476    1.519429    0.867081   1465.60   1483.30    1.000
r(A<->C){all}   0.169669    0.020159    0.000136    0.461478    0.133191    192.46    225.71    1.003
r(A<->G){all}   0.166236    0.020571    0.000033    0.457779    0.128493    194.55    209.56    1.000
r(A<->T){all}   0.167918    0.019109    0.000033    0.443459    0.134105    167.09    189.00    1.001
r(C<->G){all}   0.169471    0.019703    0.000073    0.458198    0.134536    149.15    209.13    1.001
r(C<->T){all}   0.158770    0.017565    0.000156    0.430053    0.126714    175.49    181.17    1.001
r(G<->T){all}   0.167935    0.019048    0.000011    0.438642    0.133907    204.27    267.00    1.000
pi(A){all}      0.226681    0.000202    0.199648    0.255317    0.226341   1318.79   1338.82    1.000
pi(C){all}      0.305590    0.000236    0.277730    0.338775    0.305417   1373.16   1427.49    1.000
pi(G){all}      0.272672    0.000231    0.243215    0.302381    0.272589   1287.38   1316.64    1.000
pi(T){all}      0.195057    0.000181    0.168997    0.221741    0.194641   1146.54   1266.23    1.001
alpha{1,2}      0.433590    0.237180    0.000274    1.428154    0.260938    792.76    840.56    1.000
alpha{3}        0.461069    0.245521    0.000113    1.412858    0.295526   1192.78   1249.30    1.001
pinvar{all}     0.998195    0.000005    0.994021    0.999999    0.998879   1196.19   1252.25    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1124.719587
Model 2: PositiveSelection	-1124.719587
Model 0: one-ratio	-1124.719741
Model 7: beta	-1124.719587
Model 8: beta&w>1	-1124.719587


Model 0 vs 1	3.0800000013186946E-4

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
>C2
MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
>C3
MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
>C4
MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
>C5
MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
>C6
MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=286 

C1              MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
C2              MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
C3              MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
C4              MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
C5              MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
C6              MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
                **************************************************

C1              KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
C2              KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
C3              KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
C4              KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
C5              KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
C6              KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
                **************************************************

C1              RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
C2              RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
C3              RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
C4              RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
C5              RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
C6              RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
                **************************************************

C1              ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
C2              ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
C3              ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
C4              ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
C5              ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
C6              ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
                **************************************************

C1              GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
C2              GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
C3              GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
C4              GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
C5              GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
C6              GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
                **************************************************

C1              AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
C2              AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
C3              AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
C4              AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
C5              AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
C6              AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
                ************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  286 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  286 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8580]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [8580]--->[8580]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.503 Mb, Max= 30.845 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
C2              MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
C3              MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
C4              MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
C5              MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
C6              MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
                **************************************************

C1              KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
C2              KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
C3              KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
C4              KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
C5              KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
C6              KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
                **************************************************

C1              RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
C2              RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
C3              RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
C4              RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
C5              RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
C6              RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
                **************************************************

C1              ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
C2              ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
C3              ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
C4              ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
C5              ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
C6              ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
                **************************************************

C1              GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
C2              GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
C3              GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
C4              GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
C5              GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
C6              GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
                **************************************************

C1              AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
C2              AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
C3              AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
C4              AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
C5              AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
C6              AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
                ************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT
C2              ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT
C3              ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT
C4              ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT
C5              ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT
C6              ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT
                **************************************************

C1              CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT
C2              CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT
C3              CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT
C4              CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT
C5              CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT
C6              CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT
                **************************************************

C1              GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA
C2              GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA
C3              GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA
C4              GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA
C5              GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA
C6              GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA
                **************************************************

C1              AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT
C2              AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT
C3              AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT
C4              AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT
C5              AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT
C6              AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT
                **************************************************

C1              GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA
C2              GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA
C3              GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA
C4              GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA
C5              GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA
C6              GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA
                **************************************************

C1              AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG
C2              AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG
C3              AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG
C4              AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG
C5              AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG
C6              AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG
                **************************************************

C1              CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC
C2              CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC
C3              CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC
C4              CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC
C5              CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC
C6              CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC
                **************************************************

C1              TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA
C2              TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA
C3              TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA
C4              TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA
C5              TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA
C6              TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA
                **************************************************

C1              GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC
C2              GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC
C3              GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC
C4              GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC
C5              GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC
C6              GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC
                **************************************************

C1              GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG
C2              GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG
C3              GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG
C4              GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG
C5              GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG
C6              GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG
                **************************************************

C1              CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA
C2              CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA
C3              CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA
C4              CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA
C5              CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA
C6              CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA
                **************************************************

C1              CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG
C2              CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG
C3              CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG
C4              CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG
C5              CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG
C6              CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG
                **************************************************

C1              GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC
C2              GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC
C3              GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC
C4              GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC
C5              GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC
C6              GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC
                **************************************************

C1              GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA
C2              GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA
C3              GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA
C4              GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA
C5              GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA
C6              GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA
                **************************************************

C1              CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC
C2              CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC
C3              CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC
C4              CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC
C5              CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC
C6              CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC
                **************************************************

C1              GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG
C2              GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG
C3              GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG
C4              GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG
C5              GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG
C6              GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG
                **************************************************

C1              GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC
C2              GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC
C3              GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC
C4              GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC
C5              GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC
C6              GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC
                **************************************************

C1              TGACAAAA
C2              TGACAAAA
C3              TGACAAAA
C4              TGACAAAA
C5              TGACAAAA
C6              TGACAAAA
                ********



>C1
ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT
CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT
GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA
AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT
GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA
AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG
CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC
TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA
GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC
GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG
CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA
CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG
GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC
GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA
CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC
GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG
GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC
TGACAAAA
>C2
ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT
CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT
GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA
AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT
GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA
AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG
CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC
TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA
GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC
GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG
CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA
CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG
GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC
GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA
CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC
GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG
GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC
TGACAAAA
>C3
ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT
CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT
GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA
AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT
GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA
AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG
CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC
TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA
GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC
GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG
CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA
CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG
GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC
GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA
CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC
GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG
GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC
TGACAAAA
>C4
ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT
CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT
GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA
AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT
GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA
AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG
CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC
TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA
GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC
GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG
CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA
CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG
GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC
GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA
CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC
GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG
GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC
TGACAAAA
>C5
ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT
CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT
GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA
AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT
GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA
AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG
CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC
TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA
GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC
GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG
CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA
CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG
GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC
GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA
CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC
GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG
GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC
TGACAAAA
>C6
ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT
CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT
GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA
AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT
GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA
AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG
CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC
TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA
GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC
GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG
CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA
CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG
GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC
GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA
CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC
GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG
GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC
TGACAAAA
>C1
MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
>C2
MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
>C3
MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
>C4
MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
>C5
MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
>C6
MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA
KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA
RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF
ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP
GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL
AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 858 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579782910
      Setting output file names to "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 453803439
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9770657971
      Seed = 1797622190
      Swapseed = 1579782910
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1920.245138 -- -24.965149
         Chain 2 -- -1920.244845 -- -24.965149
         Chain 3 -- -1920.245138 -- -24.965149
         Chain 4 -- -1920.244845 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1920.245138 -- -24.965149
         Chain 2 -- -1920.245028 -- -24.965149
         Chain 3 -- -1920.245138 -- -24.965149
         Chain 4 -- -1920.244845 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1920.245] (-1920.245) (-1920.245) (-1920.245) * [-1920.245] (-1920.245) (-1920.245) (-1920.245) 
        500 -- (-1198.812) [-1187.077] (-1189.474) (-1187.699) * (-1196.942) (-1197.387) (-1196.585) [-1194.232] -- 0:00:00
       1000 -- (-1196.735) (-1182.914) [-1187.990] (-1192.990) * (-1184.374) [-1188.840] (-1185.463) (-1196.025) -- 0:00:00
       1500 -- (-1207.905) [-1184.965] (-1187.573) (-1186.077) * (-1186.847) (-1187.418) [-1187.200] (-1191.547) -- 0:00:00
       2000 -- (-1186.950) (-1183.769) [-1188.052] (-1188.207) * [-1187.980] (-1185.269) (-1180.406) (-1184.190) -- 0:00:00
       2500 -- (-1189.516) (-1185.704) [-1186.349] (-1188.973) * (-1194.801) (-1186.622) [-1196.433] (-1187.595) -- 0:00:00
       3000 -- [-1187.734] (-1198.755) (-1187.351) (-1187.003) * (-1191.928) (-1189.979) [-1192.262] (-1191.015) -- 0:00:00
       3500 -- (-1197.212) (-1187.108) [-1190.451] (-1192.915) * (-1198.449) (-1201.411) [-1193.922] (-1186.493) -- 0:00:00
       4000 -- (-1191.912) [-1183.996] (-1187.102) (-1190.502) * [-1187.838] (-1197.293) (-1186.426) (-1190.297) -- 0:04:09
       4500 -- (-1187.909) (-1190.753) (-1187.282) [-1183.159] * (-1189.891) (-1192.148) (-1189.260) [-1185.401] -- 0:03:41
       5000 -- (-1184.783) (-1190.949) (-1189.674) [-1188.760] * (-1188.593) [-1184.412] (-1188.670) (-1194.133) -- 0:03:19

      Average standard deviation of split frequencies: 0.082703

       5500 -- (-1184.062) (-1191.197) (-1187.050) [-1184.584] * (-1189.934) (-1195.798) (-1191.932) [-1184.524] -- 0:03:00
       6000 -- (-1185.302) [-1188.633] (-1184.667) (-1188.028) * (-1188.249) [-1186.455] (-1187.308) (-1181.404) -- 0:02:45
       6500 -- (-1193.079) [-1187.562] (-1186.329) (-1188.144) * (-1187.969) [-1187.405] (-1199.032) (-1185.596) -- 0:02:32
       7000 -- [-1190.919] (-1187.235) (-1191.531) (-1187.352) * (-1190.909) (-1177.719) (-1186.464) [-1190.496] -- 0:02:21
       7500 -- (-1198.665) (-1184.938) [-1185.904] (-1189.317) * [-1186.888] (-1178.276) (-1183.710) (-1188.547) -- 0:02:12
       8000 -- [-1183.428] (-1187.770) (-1187.346) (-1192.537) * (-1198.060) (-1179.847) (-1187.326) [-1190.057] -- 0:02:04
       8500 -- (-1185.953) [-1187.596] (-1189.253) (-1189.413) * (-1194.806) (-1178.687) [-1190.655] (-1190.911) -- 0:01:56
       9000 -- [-1186.441] (-1192.925) (-1190.289) (-1194.817) * (-1194.933) (-1185.110) [-1185.742] (-1187.687) -- 0:01:50
       9500 -- (-1199.673) (-1186.741) (-1185.287) [-1188.549] * (-1184.471) (-1177.318) [-1185.331] (-1190.761) -- 0:01:44
      10000 -- (-1183.605) (-1191.083) (-1192.706) [-1186.096] * (-1197.160) (-1179.235) [-1188.577] (-1194.629) -- 0:01:39

      Average standard deviation of split frequencies: 0.046299

      10500 -- (-1198.235) (-1195.125) [-1188.196] (-1189.364) * (-1192.057) (-1178.914) (-1194.488) [-1189.248] -- 0:01:34
      11000 -- (-1185.961) (-1190.614) [-1188.155] (-1188.326) * (-1188.250) (-1178.353) [-1185.409] (-1182.557) -- 0:01:29
      11500 -- (-1181.301) (-1190.265) [-1184.478] (-1192.479) * (-1192.594) [-1180.516] (-1187.967) (-1178.898) -- 0:01:25
      12000 -- (-1192.614) (-1189.002) (-1189.809) [-1186.033] * (-1190.764) (-1180.454) [-1186.293] (-1179.001) -- 0:01:22
      12500 -- [-1194.291] (-1187.313) (-1194.948) (-1184.657) * [-1184.135] (-1178.405) (-1191.540) (-1180.478) -- 0:01:19
      13000 -- (-1195.090) (-1180.867) [-1186.184] (-1186.823) * (-1186.837) (-1178.368) [-1186.496] (-1178.091) -- 0:01:15
      13500 -- (-1192.338) (-1190.089) [-1184.014] (-1190.710) * [-1191.909] (-1177.945) (-1187.153) (-1179.062) -- 0:01:13
      14000 -- (-1181.941) (-1188.932) [-1187.211] (-1186.911) * [-1187.013] (-1176.971) (-1195.025) (-1181.646) -- 0:01:10
      14500 -- [-1194.367] (-1190.644) (-1185.474) (-1196.774) * (-1187.246) (-1177.837) [-1185.296] (-1180.752) -- 0:01:07
      15000 -- [-1188.433] (-1193.611) (-1186.327) (-1185.052) * (-1192.601) [-1177.120] (-1193.538) (-1178.517) -- 0:01:05

      Average standard deviation of split frequencies: 0.053033

      15500 -- (-1199.538) (-1184.847) [-1186.274] (-1190.395) * (-1187.714) (-1179.413) (-1186.797) [-1182.131] -- 0:01:03
      16000 -- (-1185.957) (-1191.213) (-1188.453) [-1188.486] * (-1194.590) [-1180.716] (-1190.850) (-1183.123) -- 0:01:01
      16500 -- (-1189.139) (-1183.808) (-1188.026) [-1188.727] * (-1192.975) [-1180.213] (-1194.448) (-1181.118) -- 0:00:59
      17000 -- [-1184.705] (-1194.099) (-1193.264) (-1191.758) * (-1190.199) [-1177.942] (-1195.642) (-1180.283) -- 0:00:57
      17500 -- (-1200.219) [-1189.873] (-1186.530) (-1194.143) * (-1191.234) [-1182.518] (-1182.888) (-1181.289) -- 0:00:56
      18000 -- [-1191.540] (-1191.774) (-1194.385) (-1183.210) * (-1184.832) [-1180.461] (-1182.651) (-1182.909) -- 0:00:54
      18500 -- (-1181.239) [-1194.802] (-1194.558) (-1189.565) * (-1184.331) [-1180.363] (-1190.164) (-1181.918) -- 0:00:53
      19000 -- [-1189.404] (-1187.367) (-1189.443) (-1184.780) * (-1181.879) (-1179.768) (-1191.165) [-1183.444] -- 0:00:51
      19500 -- [-1188.428] (-1213.793) (-1187.824) (-1189.830) * (-1184.127) (-1181.130) [-1187.148] (-1179.212) -- 0:01:40
      20000 -- (-1182.414) (-1189.447) [-1187.362] (-1189.219) * [-1179.443] (-1177.774) (-1187.112) (-1179.579) -- 0:01:38

      Average standard deviation of split frequencies: 0.055012

      20500 -- [-1183.410] (-1182.103) (-1191.199) (-1196.992) * (-1180.519) [-1178.122] (-1192.556) (-1180.685) -- 0:01:35
      21000 -- (-1184.214) (-1182.151) [-1186.353] (-1198.258) * (-1177.500) (-1178.125) [-1188.026] (-1178.988) -- 0:01:33
      21500 -- (-1196.167) (-1181.777) (-1200.348) [-1182.673] * (-1179.214) [-1178.412] (-1190.281) (-1186.390) -- 0:01:31
      22000 -- (-1193.892) (-1180.280) [-1188.212] (-1188.919) * (-1183.030) [-1180.123] (-1187.841) (-1179.181) -- 0:01:28
      22500 -- [-1184.847] (-1181.748) (-1188.551) (-1188.543) * (-1184.959) (-1178.560) [-1188.933] (-1178.734) -- 0:01:26
      23000 -- [-1187.849] (-1182.168) (-1184.728) (-1179.478) * [-1181.869] (-1179.803) (-1178.892) (-1179.080) -- 0:01:24
      23500 -- (-1197.793) [-1179.343] (-1196.829) (-1180.086) * [-1179.516] (-1180.748) (-1181.611) (-1179.039) -- 0:01:23
      24000 -- (-1190.409) [-1177.989] (-1186.612) (-1178.268) * (-1180.140) [-1180.239] (-1181.707) (-1181.018) -- 0:01:21
      24500 -- (-1179.767) [-1177.989] (-1189.948) (-1178.281) * (-1178.488) (-1184.585) [-1183.134] (-1182.691) -- 0:01:19
      25000 -- (-1180.260) [-1177.143] (-1194.039) (-1177.682) * (-1179.512) (-1180.096) (-1187.821) [-1177.957] -- 0:01:18

      Average standard deviation of split frequencies: 0.050939

      25500 -- [-1178.084] (-1177.231) (-1193.456) (-1180.732) * (-1176.898) (-1182.643) (-1183.115) [-1178.264] -- 0:01:16
      26000 -- (-1179.886) (-1177.525) [-1187.429] (-1179.619) * (-1176.940) (-1180.144) (-1182.227) [-1178.650] -- 0:01:14
      26500 -- [-1179.559] (-1178.782) (-1186.683) (-1182.114) * [-1176.997] (-1180.424) (-1180.040) (-1183.107) -- 0:01:13
      27000 -- (-1181.577) (-1180.770) (-1189.655) [-1177.935] * [-1177.034] (-1178.725) (-1181.872) (-1179.056) -- 0:01:12
      27500 -- (-1186.413) (-1177.410) (-1190.844) [-1179.761] * [-1177.369] (-1179.763) (-1181.884) (-1179.196) -- 0:01:10
      28000 -- (-1179.414) (-1182.606) (-1190.009) [-1181.989] * (-1182.504) [-1179.182] (-1179.846) (-1177.822) -- 0:01:09
      28500 -- [-1179.843] (-1180.362) (-1184.058) (-1178.556) * (-1180.659) (-1179.208) (-1182.266) [-1177.837] -- 0:01:08
      29000 -- (-1178.761) [-1179.971] (-1185.871) (-1178.556) * (-1180.259) [-1177.987] (-1179.185) (-1181.467) -- 0:01:06
      29500 -- (-1183.273) (-1179.493) (-1185.249) [-1179.982] * [-1178.152] (-1178.458) (-1178.746) (-1177.609) -- 0:01:05
      30000 -- [-1178.690] (-1181.251) (-1189.182) (-1180.043) * (-1179.596) [-1180.243] (-1178.651) (-1177.576) -- 0:01:04

      Average standard deviation of split frequencies: 0.057442

      30500 -- (-1177.417) (-1178.708) [-1183.539] (-1179.021) * [-1178.874] (-1179.571) (-1179.314) (-1177.519) -- 0:01:03
      31000 -- (-1177.195) [-1179.005] (-1189.786) (-1178.927) * (-1180.092) (-1177.988) (-1183.479) [-1177.974] -- 0:01:02
      31500 -- (-1177.358) (-1177.632) (-1191.187) [-1182.837] * (-1177.440) (-1177.226) [-1179.515] (-1177.490) -- 0:01:01
      32000 -- (-1177.176) (-1179.737) (-1199.418) [-1179.124] * (-1178.258) (-1178.408) (-1184.163) [-1178.320] -- 0:01:00
      32500 -- [-1176.928] (-1180.484) (-1187.989) (-1178.466) * (-1179.982) (-1180.583) (-1178.956) [-1179.647] -- 0:00:59
      33000 -- (-1177.748) (-1184.086) [-1187.076] (-1177.797) * (-1180.088) (-1178.297) (-1177.932) [-1180.116] -- 0:00:58
      33500 -- [-1177.531] (-1178.921) (-1188.228) (-1178.903) * (-1179.200) (-1178.171) [-1177.603] (-1182.511) -- 0:00:57
      34000 -- (-1176.984) (-1178.427) (-1186.688) [-1179.317] * (-1177.548) [-1177.844] (-1178.148) (-1181.003) -- 0:00:56
      34500 -- [-1177.078] (-1177.478) (-1192.672) (-1179.847) * (-1178.326) [-1177.826] (-1177.644) (-1180.706) -- 0:00:55
      35000 -- (-1177.203) (-1178.767) (-1189.848) [-1177.832] * (-1178.954) (-1179.001) [-1180.668] (-1180.193) -- 0:00:55

      Average standard deviation of split frequencies: 0.041248

      35500 -- (-1178.690) [-1178.208] (-1186.760) (-1177.576) * [-1178.548] (-1181.447) (-1181.180) (-1182.905) -- 0:01:21
      36000 -- (-1179.766) (-1180.012) (-1186.066) [-1178.392] * (-1177.778) (-1182.331) [-1177.502] (-1179.162) -- 0:01:20
      36500 -- (-1178.084) (-1179.532) (-1182.346) [-1177.709] * (-1177.515) (-1181.408) (-1178.661) [-1180.417] -- 0:01:19
      37000 -- (-1178.084) (-1178.808) [-1186.576] (-1177.571) * (-1180.575) (-1182.148) (-1178.427) [-1178.850] -- 0:01:18
      37500 -- (-1178.674) [-1180.593] (-1196.589) (-1177.431) * (-1178.625) (-1180.215) [-1179.567] (-1180.334) -- 0:01:17
      38000 -- (-1182.214) (-1181.558) [-1190.073] (-1178.016) * (-1178.595) (-1180.599) [-1178.901] (-1178.099) -- 0:01:15
      38500 -- [-1180.475] (-1179.227) (-1187.467) (-1179.034) * (-1177.688) (-1183.552) [-1180.332] (-1177.526) -- 0:01:14
      39000 -- (-1181.721) [-1177.467] (-1182.493) (-1177.639) * (-1179.300) (-1180.157) (-1179.509) [-1177.223] -- 0:01:13
      39500 -- (-1180.586) (-1187.477) (-1189.378) [-1180.769] * (-1181.655) (-1178.495) (-1179.182) [-1178.667] -- 0:01:12
      40000 -- [-1177.432] (-1179.340) (-1187.666) (-1177.716) * (-1181.652) (-1178.333) (-1180.907) [-1179.322] -- 0:01:12

      Average standard deviation of split frequencies: 0.038640

      40500 -- (-1177.615) (-1178.028) [-1186.508] (-1178.487) * (-1177.982) [-1178.372] (-1180.075) (-1182.353) -- 0:01:11
      41000 -- (-1177.544) [-1178.819] (-1189.519) (-1180.963) * [-1178.163] (-1178.628) (-1178.356) (-1179.609) -- 0:01:10
      41500 -- [-1179.380] (-1182.748) (-1196.205) (-1181.246) * (-1178.001) (-1178.394) (-1177.248) [-1179.211] -- 0:01:09
      42000 -- (-1178.637) [-1178.320] (-1183.962) (-1181.143) * (-1177.623) (-1179.275) [-1178.571] (-1180.605) -- 0:01:08
      42500 -- [-1183.963] (-1181.529) (-1193.796) (-1180.138) * (-1180.413) (-1179.063) (-1182.025) [-1178.389] -- 0:01:07
      43000 -- (-1178.258) (-1179.312) [-1186.984] (-1178.570) * (-1185.304) (-1181.546) [-1179.122] (-1178.435) -- 0:01:06
      43500 -- [-1179.272] (-1183.319) (-1205.725) (-1178.498) * (-1178.368) (-1181.633) [-1180.249] (-1177.324) -- 0:01:05
      44000 -- (-1179.144) [-1179.472] (-1187.420) (-1179.469) * [-1178.554] (-1180.109) (-1182.512) (-1178.139) -- 0:01:05
      44500 -- (-1183.638) (-1181.208) [-1180.881] (-1182.590) * [-1178.862] (-1179.743) (-1178.337) (-1178.762) -- 0:01:04
      45000 -- (-1179.633) (-1181.365) [-1189.140] (-1177.193) * [-1179.969] (-1178.065) (-1178.056) (-1181.908) -- 0:01:03

      Average standard deviation of split frequencies: 0.035355

      45500 -- (-1182.488) (-1178.346) [-1184.790] (-1177.385) * (-1180.140) [-1180.033] (-1177.070) (-1177.430) -- 0:01:02
      46000 -- (-1181.179) (-1178.696) (-1178.798) [-1178.446] * [-1180.039] (-1178.849) (-1179.714) (-1178.347) -- 0:01:02
      46500 -- (-1183.154) [-1177.709] (-1180.244) (-1178.215) * (-1179.316) [-1178.818] (-1180.012) (-1184.858) -- 0:01:01
      47000 -- [-1178.796] (-1177.806) (-1183.342) (-1177.599) * [-1178.607] (-1177.140) (-1183.527) (-1185.001) -- 0:01:00
      47500 -- [-1178.571] (-1179.337) (-1183.159) (-1178.360) * (-1178.515) (-1180.648) (-1181.862) [-1182.867] -- 0:01:00
      48000 -- (-1178.088) (-1181.615) (-1182.495) [-1177.991] * [-1178.819] (-1179.009) (-1181.580) (-1177.902) -- 0:00:59
      48500 -- [-1178.172] (-1183.590) (-1181.654) (-1179.109) * (-1178.202) [-1179.166] (-1178.786) (-1177.969) -- 0:00:58
      49000 -- (-1179.363) (-1181.767) [-1178.638] (-1178.529) * (-1178.200) (-1182.494) (-1177.883) [-1179.246] -- 0:00:58
      49500 -- (-1179.420) (-1182.505) (-1178.038) [-1178.038] * (-1178.044) (-1184.172) [-1179.327] (-1178.952) -- 0:00:57
      50000 -- (-1178.274) (-1181.726) [-1180.216] (-1177.981) * [-1179.903] (-1180.088) (-1179.859) (-1178.158) -- 0:00:57

      Average standard deviation of split frequencies: 0.039077

      50500 -- [-1179.857] (-1184.044) (-1182.295) (-1180.273) * (-1179.578) (-1178.324) [-1178.767] (-1177.234) -- 0:00:56
      51000 -- [-1177.644] (-1179.848) (-1183.674) (-1179.362) * (-1179.841) (-1179.346) (-1177.807) [-1180.206] -- 0:00:55
      51500 -- [-1178.014] (-1179.387) (-1181.459) (-1179.818) * (-1178.279) [-1179.216] (-1177.934) (-1179.586) -- 0:01:13
      52000 -- (-1178.263) [-1177.550] (-1178.965) (-1177.229) * (-1180.150) (-1177.493) (-1178.490) [-1181.423] -- 0:01:12
      52500 -- [-1178.203] (-1179.417) (-1181.563) (-1178.665) * (-1180.748) (-1181.429) (-1180.824) [-1177.770] -- 0:01:12
      53000 -- (-1181.263) [-1178.649] (-1183.983) (-1179.757) * [-1179.645] (-1178.840) (-1181.225) (-1177.200) -- 0:01:11
      53500 -- (-1182.473) (-1178.785) (-1179.200) [-1178.374] * [-1178.865] (-1180.127) (-1180.818) (-1177.374) -- 0:01:10
      54000 -- (-1179.176) (-1179.655) (-1180.294) [-1179.021] * [-1178.873] (-1180.169) (-1180.085) (-1178.299) -- 0:01:10
      54500 -- (-1177.528) [-1178.736] (-1178.228) (-1178.635) * (-1181.486) (-1180.864) (-1178.893) [-1177.918] -- 0:01:09
      55000 -- (-1178.045) [-1181.299] (-1177.526) (-1179.925) * [-1178.537] (-1180.071) (-1178.200) (-1180.397) -- 0:01:08

      Average standard deviation of split frequencies: 0.039985

      55500 -- (-1182.802) (-1179.342) (-1177.766) [-1179.254] * (-1178.132) (-1185.572) (-1177.756) [-1179.464] -- 0:01:08
      56000 -- (-1180.477) (-1178.695) (-1178.857) [-1178.492] * (-1179.030) (-1184.768) (-1178.205) [-1177.991] -- 0:01:07
      56500 -- (-1179.811) [-1178.030] (-1177.998) (-1178.712) * (-1178.186) (-1178.062) (-1179.057) [-1178.549] -- 0:01:06
      57000 -- [-1184.280] (-1178.618) (-1177.922) (-1180.541) * (-1179.149) (-1177.348) [-1180.657] (-1179.988) -- 0:01:06
      57500 -- (-1181.499) [-1178.970] (-1178.244) (-1178.495) * (-1178.345) (-1179.767) [-1178.317] (-1181.223) -- 0:01:05
      58000 -- (-1179.607) (-1181.100) [-1178.286] (-1178.739) * (-1179.644) (-1178.831) (-1177.680) [-1181.793] -- 0:01:04
      58500 -- (-1180.655) (-1180.773) (-1179.905) [-1178.146] * (-1181.397) [-1180.839] (-1180.100) (-1183.849) -- 0:01:04
      59000 -- (-1179.415) (-1181.373) (-1179.679) [-1178.209] * (-1181.103) [-1177.353] (-1178.334) (-1180.938) -- 0:01:03
      59500 -- (-1185.559) (-1178.163) [-1177.648] (-1178.444) * (-1177.383) (-1179.243) [-1178.779] (-1178.446) -- 0:01:03
      60000 -- (-1185.041) [-1178.227] (-1177.508) (-1178.418) * (-1178.073) [-1177.374] (-1177.353) (-1177.890) -- 0:01:02

      Average standard deviation of split frequencies: 0.035152

      60500 -- (-1188.079) (-1177.862) (-1177.341) [-1177.857] * (-1180.690) (-1181.111) (-1178.324) [-1178.822] -- 0:01:02
      61000 -- [-1178.879] (-1178.708) (-1177.316) (-1178.471) * (-1182.082) (-1178.306) (-1179.085) [-1180.548] -- 0:01:01
      61500 -- [-1179.044] (-1178.599) (-1181.577) (-1179.143) * (-1184.070) (-1180.043) (-1179.628) [-1181.151] -- 0:01:01
      62000 -- (-1180.789) (-1181.144) [-1180.775] (-1179.530) * (-1184.070) (-1180.280) (-1179.683) [-1180.986] -- 0:01:00
      62500 -- (-1183.857) (-1177.940) [-1179.333] (-1181.118) * (-1182.337) (-1179.598) [-1176.897] (-1180.380) -- 0:01:00
      63000 -- [-1182.541] (-1177.878) (-1179.697) (-1180.313) * [-1182.016] (-1180.334) (-1177.133) (-1180.447) -- 0:00:59
      63500 -- (-1182.082) [-1177.571] (-1180.878) (-1179.229) * [-1178.174] (-1178.652) (-1179.404) (-1178.875) -- 0:00:58
      64000 -- (-1178.245) [-1177.135] (-1179.748) (-1181.059) * (-1179.993) (-1178.161) (-1180.100) [-1180.326] -- 0:00:58
      64500 -- (-1177.729) (-1178.342) (-1178.815) [-1180.122] * [-1177.663] (-1177.112) (-1183.057) (-1183.367) -- 0:00:58
      65000 -- [-1179.395] (-1178.766) (-1181.738) (-1180.887) * [-1177.716] (-1180.464) (-1177.740) (-1177.248) -- 0:00:57

      Average standard deviation of split frequencies: 0.035063

      65500 -- (-1179.244) [-1182.240] (-1179.559) (-1178.817) * [-1179.475] (-1178.414) (-1178.498) (-1180.378) -- 0:00:57
      66000 -- (-1177.748) (-1182.144) [-1179.206] (-1178.016) * (-1182.856) [-1179.793] (-1178.979) (-1178.728) -- 0:00:56
      66500 -- (-1177.830) (-1186.964) [-1178.749] (-1177.071) * (-1184.956) (-1180.385) [-1180.884] (-1179.455) -- 0:00:56
      67000 -- (-1177.979) (-1180.561) (-1178.482) [-1177.467] * (-1180.689) [-1178.978] (-1179.245) (-1178.940) -- 0:01:09
      67500 -- [-1177.143] (-1181.473) (-1179.502) (-1177.934) * (-1183.224) (-1178.227) (-1178.069) [-1183.288] -- 0:01:09
      68000 -- (-1185.292) (-1178.056) (-1178.874) [-1178.835] * [-1182.716] (-1179.784) (-1186.122) (-1180.267) -- 0:01:08
      68500 -- [-1180.076] (-1180.609) (-1179.385) (-1176.937) * [-1178.386] (-1178.134) (-1182.480) (-1179.048) -- 0:01:07
      69000 -- (-1179.001) (-1180.690) (-1180.055) [-1178.174] * (-1179.563) (-1181.051) (-1183.656) [-1176.989] -- 0:01:07
      69500 -- [-1177.663] (-1180.579) (-1178.314) (-1180.370) * (-1178.694) [-1180.226] (-1182.631) (-1180.364) -- 0:01:06
      70000 -- (-1179.068) (-1178.495) [-1178.165] (-1178.745) * (-1177.410) (-1180.263) (-1184.456) [-1178.318] -- 0:01:06

      Average standard deviation of split frequencies: 0.036356

      70500 -- [-1179.068] (-1180.360) (-1178.415) (-1178.868) * (-1178.044) (-1178.054) [-1177.351] (-1177.939) -- 0:01:05
      71000 -- (-1178.370) (-1183.770) (-1181.617) [-1177.674] * [-1178.043] (-1178.488) (-1177.294) (-1179.127) -- 0:01:05
      71500 -- (-1177.818) [-1179.506] (-1181.071) (-1179.080) * (-1179.292) (-1178.983) (-1177.562) [-1180.658] -- 0:01:04
      72000 -- [-1178.468] (-1179.959) (-1179.926) (-1179.076) * (-1179.348) [-1181.516] (-1180.202) (-1178.472) -- 0:01:04
      72500 -- (-1177.187) [-1178.952] (-1180.081) (-1178.780) * (-1180.408) [-1178.702] (-1180.129) (-1178.013) -- 0:01:03
      73000 -- [-1177.053] (-1182.171) (-1179.589) (-1178.737) * (-1178.909) (-1178.420) [-1179.126] (-1178.900) -- 0:01:03
      73500 -- (-1177.876) (-1178.498) (-1183.570) [-1179.708] * (-1177.692) [-1182.865] (-1177.736) (-1178.805) -- 0:01:03
      74000 -- (-1180.099) [-1179.993] (-1182.847) (-1178.537) * [-1179.583] (-1180.434) (-1178.064) (-1179.171) -- 0:01:02
      74500 -- (-1179.967) [-1177.576] (-1180.850) (-1178.835) * (-1178.596) (-1178.649) (-1177.142) [-1179.175] -- 0:01:02
      75000 -- (-1178.387) [-1181.101] (-1179.966) (-1179.217) * (-1178.496) (-1177.735) (-1179.523) [-1179.690] -- 0:01:01

      Average standard deviation of split frequencies: 0.034115

      75500 -- [-1177.670] (-1187.231) (-1178.952) (-1180.265) * [-1178.288] (-1179.180) (-1180.176) (-1178.993) -- 0:01:01
      76000 -- [-1179.463] (-1181.026) (-1178.498) (-1181.192) * [-1178.426] (-1177.917) (-1178.394) (-1189.975) -- 0:01:00
      76500 -- [-1179.307] (-1177.551) (-1178.723) (-1178.646) * (-1179.707) (-1178.806) [-1179.283] (-1184.608) -- 0:01:00
      77000 -- [-1177.962] (-1178.929) (-1182.110) (-1179.631) * (-1180.918) (-1178.633) (-1177.991) [-1177.561] -- 0:00:59
      77500 -- (-1181.976) (-1178.931) [-1177.875] (-1182.025) * (-1180.360) [-1178.873] (-1179.104) (-1178.292) -- 0:00:59
      78000 -- (-1179.635) (-1180.754) [-1178.018] (-1184.000) * (-1180.508) [-1179.139] (-1179.004) (-1179.679) -- 0:00:59
      78500 -- (-1181.382) (-1178.632) (-1179.507) [-1179.777] * (-1177.086) [-1180.315] (-1177.814) (-1178.742) -- 0:00:58
      79000 -- (-1178.230) [-1179.536] (-1178.165) (-1178.780) * (-1177.780) [-1178.096] (-1178.520) (-1178.247) -- 0:00:58
      79500 -- (-1178.175) (-1178.041) (-1180.234) [-1177.330] * (-1177.829) (-1179.800) (-1180.578) [-1177.483] -- 0:00:57
      80000 -- [-1177.936] (-1177.415) (-1182.848) (-1178.725) * (-1179.773) [-1178.960] (-1180.042) (-1180.895) -- 0:00:57

      Average standard deviation of split frequencies: 0.031557

      80500 -- (-1179.125) (-1177.685) (-1179.781) [-1178.575] * (-1182.673) (-1181.064) (-1183.635) [-1179.120] -- 0:00:57
      81000 -- (-1177.515) (-1177.779) (-1179.736) [-1178.068] * [-1177.961] (-1182.167) (-1178.208) (-1179.136) -- 0:00:56
      81500 -- [-1177.327] (-1177.658) (-1179.087) (-1178.089) * (-1177.798) [-1177.929] (-1180.141) (-1179.024) -- 0:00:56
      82000 -- [-1178.083] (-1179.271) (-1178.395) (-1179.155) * (-1178.540) [-1178.551] (-1181.539) (-1178.804) -- 0:00:55
      82500 -- (-1178.926) [-1179.144] (-1183.068) (-1180.005) * [-1181.551] (-1178.394) (-1180.353) (-1182.143) -- 0:00:55
      83000 -- [-1179.530] (-1178.303) (-1178.431) (-1179.998) * (-1180.047) [-1177.897] (-1179.697) (-1181.822) -- 0:00:55
      83500 -- (-1177.827) [-1178.137] (-1180.186) (-1178.564) * (-1181.272) [-1181.168] (-1179.992) (-1180.243) -- 0:01:05
      84000 -- [-1177.589] (-1178.665) (-1178.070) (-1181.276) * (-1180.191) (-1178.590) [-1177.216] (-1178.990) -- 0:01:05
      84500 -- (-1179.170) [-1178.684] (-1178.125) (-1178.943) * (-1181.475) (-1179.811) (-1178.204) [-1179.229] -- 0:01:05
      85000 -- [-1178.990] (-1177.823) (-1178.271) (-1180.947) * (-1179.590) (-1178.967) [-1178.362] (-1181.252) -- 0:01:04

      Average standard deviation of split frequencies: 0.027158

      85500 -- (-1177.382) (-1179.215) (-1178.254) [-1178.062] * [-1179.769] (-1178.328) (-1179.882) (-1182.397) -- 0:01:04
      86000 -- (-1177.383) (-1177.872) [-1178.106] (-1177.392) * (-1179.848) (-1177.477) [-1178.068] (-1179.168) -- 0:01:03
      86500 -- (-1179.851) (-1184.875) (-1181.167) [-1177.660] * (-1182.135) (-1178.128) (-1177.926) [-1178.603] -- 0:01:03
      87000 -- (-1178.873) [-1180.737] (-1179.614) (-1177.450) * (-1178.605) [-1177.834] (-1177.076) (-1179.169) -- 0:01:02
      87500 -- [-1180.743] (-1182.270) (-1185.797) (-1179.362) * (-1180.006) [-1179.660] (-1187.032) (-1180.325) -- 0:01:02
      88000 -- (-1179.654) [-1178.557] (-1180.873) (-1178.627) * (-1180.661) (-1178.857) [-1182.059] (-1179.021) -- 0:01:02
      88500 -- (-1178.801) [-1178.660] (-1181.046) (-1178.859) * [-1177.818] (-1182.621) (-1182.901) (-1179.026) -- 0:01:01
      89000 -- (-1179.570) (-1178.279) [-1179.252] (-1178.580) * (-1179.031) (-1183.178) [-1179.352] (-1180.561) -- 0:01:01
      89500 -- (-1180.513) (-1177.475) (-1181.072) [-1179.374] * (-1178.602) (-1180.565) [-1180.396] (-1179.074) -- 0:01:01
      90000 -- (-1178.359) (-1178.320) (-1180.533) [-1178.987] * (-1179.049) (-1178.525) [-1181.660] (-1178.552) -- 0:01:00

      Average standard deviation of split frequencies: 0.025997

      90500 -- (-1180.866) (-1181.877) (-1180.794) [-1177.896] * (-1178.950) (-1179.170) (-1182.148) [-1178.148] -- 0:01:00
      91000 -- [-1179.428] (-1182.254) (-1177.426) (-1177.425) * (-1180.231) (-1179.430) (-1180.894) [-1180.001] -- 0:00:59
      91500 -- (-1183.790) [-1179.875] (-1179.500) (-1177.208) * (-1182.605) [-1178.170] (-1182.436) (-1179.307) -- 0:00:59
      92000 -- [-1177.675] (-1179.862) (-1178.195) (-1177.178) * (-1179.696) (-1177.528) (-1183.204) [-1178.354] -- 0:00:59
      92500 -- [-1178.189] (-1180.262) (-1178.896) (-1177.640) * (-1179.006) (-1177.528) [-1183.134] (-1178.658) -- 0:00:58
      93000 -- (-1178.791) [-1179.875] (-1178.141) (-1178.953) * (-1178.280) (-1180.643) (-1179.373) [-1177.930] -- 0:00:58
      93500 -- (-1178.441) (-1178.173) [-1177.336] (-1179.178) * (-1181.512) (-1181.417) (-1178.558) [-1178.380] -- 0:00:58
      94000 -- (-1183.415) [-1180.188] (-1177.336) (-1177.555) * (-1178.133) [-1177.508] (-1178.346) (-1181.409) -- 0:00:57
      94500 -- (-1179.758) [-1178.989] (-1177.868) (-1177.506) * (-1177.658) (-1179.418) (-1177.740) [-1180.652] -- 0:00:57
      95000 -- (-1177.233) (-1179.653) (-1178.150) [-1182.344] * [-1177.492] (-1181.629) (-1178.325) (-1178.297) -- 0:00:57

      Average standard deviation of split frequencies: 0.027137

      95500 -- (-1180.113) (-1178.338) [-1180.113] (-1177.749) * (-1177.702) [-1180.201] (-1178.560) (-1177.565) -- 0:00:56
      96000 -- (-1182.005) (-1178.178) (-1179.193) [-1179.312] * (-1177.884) (-1177.589) [-1178.781] (-1177.566) -- 0:00:56
      96500 -- (-1179.020) [-1178.841] (-1181.884) (-1180.896) * (-1179.213) (-1180.564) (-1180.386) [-1178.291] -- 0:00:56
      97000 -- (-1178.498) (-1177.595) (-1180.989) [-1178.366] * (-1178.810) (-1179.458) [-1178.514] (-1180.364) -- 0:00:55
      97500 -- (-1187.977) [-1179.108] (-1178.102) (-1181.459) * (-1177.981) (-1182.584) (-1177.830) [-1177.993] -- 0:00:55
      98000 -- (-1182.233) (-1182.239) (-1178.066) [-1178.169] * (-1178.715) (-1179.438) [-1179.438] (-1178.906) -- 0:00:55
      98500 -- (-1181.819) (-1182.740) (-1180.341) [-1179.632] * (-1179.181) (-1180.504) (-1182.601) [-1179.825] -- 0:00:54
      99000 -- [-1180.910] (-1179.638) (-1177.817) (-1183.859) * (-1180.755) (-1181.523) [-1177.566] (-1178.452) -- 0:00:54
      99500 -- [-1180.577] (-1186.080) (-1177.811) (-1182.240) * (-1177.850) (-1177.391) [-1177.203] (-1178.716) -- 0:00:54
      100000 -- (-1183.367) (-1185.360) (-1177.807) [-1179.719] * [-1179.660] (-1178.297) (-1177.384) (-1179.676) -- 0:01:02

      Average standard deviation of split frequencies: 0.026125

      100500 -- (-1183.053) (-1181.083) [-1177.428] (-1181.155) * (-1178.639) (-1178.481) (-1178.559) [-1179.578] -- 0:01:02
      101000 -- (-1181.615) [-1180.434] (-1179.208) (-1182.206) * [-1179.242] (-1180.303) (-1177.161) (-1179.191) -- 0:01:02
      101500 -- (-1180.096) [-1177.869] (-1177.995) (-1178.017) * [-1177.337] (-1179.676) (-1179.305) (-1179.067) -- 0:01:01
      102000 -- (-1178.159) (-1178.104) [-1180.163] (-1179.431) * (-1177.133) [-1179.790] (-1178.187) (-1179.761) -- 0:01:01
      102500 -- (-1178.964) (-1178.600) (-1178.300) [-1180.921] * (-1177.464) [-1178.318] (-1183.242) (-1178.784) -- 0:01:01
      103000 -- (-1180.318) (-1177.744) (-1181.534) [-1178.858] * [-1178.497] (-1182.680) (-1177.889) (-1182.106) -- 0:01:00
      103500 -- [-1183.642] (-1179.704) (-1181.318) (-1180.092) * [-1179.350] (-1178.348) (-1178.931) (-1178.491) -- 0:01:00
      104000 -- [-1183.489] (-1178.273) (-1179.311) (-1181.254) * (-1181.368) (-1177.806) (-1179.914) [-1178.842] -- 0:01:00
      104500 -- [-1183.822] (-1177.982) (-1178.585) (-1180.446) * (-1179.991) (-1179.109) (-1181.092) [-1177.995] -- 0:00:59
      105000 -- (-1180.904) [-1179.592] (-1178.585) (-1180.837) * (-1176.978) [-1177.570] (-1180.141) (-1178.098) -- 0:00:59

      Average standard deviation of split frequencies: 0.024354

      105500 -- (-1180.392) (-1183.195) (-1180.076) [-1179.451] * (-1179.758) (-1178.628) [-1178.442] (-1177.453) -- 0:00:59
      106000 -- (-1179.780) (-1178.912) (-1180.289) [-1177.274] * (-1178.384) [-1177.790] (-1179.899) (-1177.465) -- 0:00:59
      106500 -- (-1181.477) (-1178.963) (-1180.193) [-1177.991] * (-1182.068) (-1178.503) [-1181.099] (-1177.716) -- 0:00:58
      107000 -- (-1182.736) (-1179.069) (-1178.621) [-1178.852] * [-1178.189] (-1177.906) (-1184.370) (-1178.453) -- 0:00:58
      107500 -- (-1180.664) (-1183.218) [-1178.627] (-1178.756) * (-1177.349) (-1178.225) (-1177.879) [-1178.208] -- 0:00:58
      108000 -- (-1180.258) [-1177.865] (-1178.321) (-1178.835) * (-1177.465) [-1178.382] (-1177.880) (-1181.425) -- 0:00:57
      108500 -- (-1179.972) (-1179.687) [-1179.311] (-1181.806) * (-1179.482) [-1178.364] (-1179.943) (-1181.947) -- 0:00:57
      109000 -- (-1182.307) (-1178.273) (-1181.308) [-1179.290] * (-1177.182) [-1179.276] (-1180.892) (-1182.894) -- 0:00:57
      109500 -- (-1182.130) (-1179.170) [-1180.487] (-1178.009) * [-1178.069] (-1181.164) (-1182.153) (-1180.990) -- 0:00:56
      110000 -- (-1181.744) (-1178.808) (-1177.619) [-1179.314] * [-1179.073] (-1182.066) (-1181.644) (-1182.962) -- 0:00:56

      Average standard deviation of split frequencies: 0.022515

      110500 -- [-1178.773] (-1178.874) (-1179.066) (-1179.542) * (-1181.532) [-1182.103] (-1182.042) (-1186.059) -- 0:00:56
      111000 -- (-1178.231) (-1179.539) [-1178.032] (-1181.382) * (-1179.991) (-1179.300) (-1179.541) [-1182.098] -- 0:00:56
      111500 -- (-1179.276) [-1178.168] (-1179.210) (-1180.996) * (-1180.789) (-1178.966) [-1178.464] (-1182.233) -- 0:00:55
      112000 -- (-1177.537) [-1178.237] (-1178.420) (-1178.051) * (-1178.431) (-1179.484) (-1180.246) [-1178.939] -- 0:00:55
      112500 -- (-1177.336) (-1182.317) (-1178.994) [-1179.674] * (-1178.446) (-1177.320) (-1178.177) [-1178.366] -- 0:00:55
      113000 -- (-1177.506) [-1177.841] (-1177.293) (-1179.748) * (-1179.404) (-1177.934) [-1179.453] (-1179.973) -- 0:00:54
      113500 -- (-1177.496) (-1177.724) (-1177.450) [-1179.669] * (-1178.285) [-1178.315] (-1178.180) (-1182.375) -- 0:00:54
      114000 -- (-1178.228) [-1177.576] (-1179.770) (-1179.270) * (-1178.521) (-1180.998) [-1177.671] (-1180.442) -- 0:00:54
      114500 -- (-1179.749) [-1178.161] (-1177.172) (-1179.183) * (-1184.192) [-1177.857] (-1178.254) (-1180.018) -- 0:00:54
      115000 -- (-1179.685) (-1180.332) [-1177.364] (-1178.136) * (-1180.280) (-1179.143) (-1177.600) [-1178.437] -- 0:00:53

      Average standard deviation of split frequencies: 0.024169

      115500 -- [-1179.453] (-1179.901) (-1179.214) (-1178.509) * (-1177.628) (-1178.580) (-1177.915) [-1179.493] -- 0:00:53
      116000 -- (-1176.789) [-1179.866] (-1177.655) (-1178.358) * [-1178.201] (-1179.391) (-1177.816) (-1178.043) -- 0:01:00
      116500 -- (-1177.362) (-1178.448) [-1178.213] (-1179.786) * (-1177.940) (-1178.213) [-1181.589] (-1178.757) -- 0:01:00
      117000 -- (-1177.788) [-1179.868] (-1177.766) (-1179.816) * (-1178.633) (-1180.598) (-1184.695) [-1178.639] -- 0:01:00
      117500 -- [-1177.532] (-1178.926) (-1177.496) (-1181.051) * [-1178.056] (-1178.212) (-1186.870) (-1179.511) -- 0:01:00
      118000 -- (-1177.338) (-1180.121) [-1181.884] (-1182.028) * (-1178.840) (-1179.196) [-1178.680] (-1181.651) -- 0:00:59
      118500 -- (-1177.398) (-1181.747) [-1179.846] (-1181.098) * (-1178.055) [-1179.476] (-1179.256) (-1181.665) -- 0:00:59
      119000 -- (-1179.101) (-1179.878) (-1177.782) [-1180.772] * [-1177.652] (-1182.240) (-1179.442) (-1180.115) -- 0:00:59
      119500 -- (-1176.999) [-1179.383] (-1178.916) (-1178.337) * (-1178.724) [-1177.661] (-1181.640) (-1179.229) -- 0:00:58
      120000 -- (-1177.431) (-1181.620) (-1178.025) [-1178.647] * (-1178.770) (-1177.137) (-1181.498) [-1178.798] -- 0:00:58

      Average standard deviation of split frequencies: 0.024308

      120500 -- (-1176.843) (-1179.541) (-1178.264) [-1179.539] * [-1178.446] (-1178.120) (-1179.285) (-1178.564) -- 0:00:58
      121000 -- (-1178.349) (-1179.418) (-1179.175) [-1180.141] * (-1179.352) [-1178.317] (-1181.249) (-1177.301) -- 0:00:58
      121500 -- [-1179.474] (-1178.790) (-1179.786) (-1182.365) * (-1180.084) [-1180.158] (-1178.834) (-1177.275) -- 0:00:57
      122000 -- (-1182.079) [-1177.784] (-1182.507) (-1177.300) * [-1181.440] (-1181.531) (-1181.726) (-1177.966) -- 0:00:57
      122500 -- (-1180.143) [-1178.262] (-1178.783) (-1178.171) * (-1178.455) [-1178.080] (-1182.977) (-1177.428) -- 0:00:57
      123000 -- (-1180.877) (-1178.388) (-1180.849) [-1177.488] * (-1178.992) (-1178.805) (-1178.206) [-1177.746] -- 0:00:57
      123500 -- (-1179.198) [-1179.922] (-1181.950) (-1178.019) * [-1180.619] (-1179.192) (-1177.930) (-1182.657) -- 0:00:56
      124000 -- (-1179.478) (-1180.245) [-1179.472] (-1182.642) * [-1178.964] (-1180.891) (-1178.088) (-1178.449) -- 0:00:56
      124500 -- (-1178.185) (-1181.517) [-1177.760] (-1178.765) * (-1179.086) (-1180.792) [-1177.990] (-1180.363) -- 0:00:56
      125000 -- (-1181.056) [-1178.927] (-1177.817) (-1179.314) * [-1178.807] (-1178.323) (-1177.767) (-1180.539) -- 0:00:56

      Average standard deviation of split frequencies: 0.021463

      125500 -- (-1183.586) (-1180.345) [-1178.946] (-1182.549) * [-1178.564] (-1178.925) (-1179.841) (-1178.763) -- 0:00:55
      126000 -- [-1184.502] (-1184.305) (-1180.514) (-1180.507) * [-1177.989] (-1182.931) (-1178.186) (-1178.254) -- 0:00:55
      126500 -- [-1180.891] (-1189.342) (-1179.695) (-1179.158) * (-1178.262) (-1177.861) (-1178.671) [-1178.353] -- 0:00:55
      127000 -- [-1179.147] (-1177.577) (-1178.614) (-1179.743) * (-1179.409) [-1178.102] (-1182.064) (-1182.269) -- 0:00:54
      127500 -- (-1178.972) (-1178.857) (-1178.056) [-1179.579] * (-1181.026) [-1178.718] (-1179.483) (-1180.105) -- 0:00:54
      128000 -- (-1181.548) [-1177.454] (-1178.151) (-1178.700) * (-1181.344) (-1180.626) (-1178.082) [-1180.960] -- 0:00:54
      128500 -- [-1179.939] (-1179.376) (-1179.563) (-1179.841) * (-1183.141) [-1180.353] (-1179.319) (-1177.416) -- 0:00:54
      129000 -- [-1178.477] (-1180.918) (-1177.542) (-1182.258) * (-1179.649) (-1179.036) [-1178.550] (-1177.265) -- 0:00:54
      129500 -- (-1178.915) (-1180.303) [-1177.272] (-1182.810) * [-1179.640] (-1180.534) (-1178.927) (-1177.519) -- 0:00:53
      130000 -- (-1178.210) (-1182.818) [-1177.108] (-1181.603) * [-1181.912] (-1179.480) (-1177.846) (-1177.843) -- 0:00:53

      Average standard deviation of split frequencies: 0.022026

      130500 -- (-1178.293) (-1184.744) (-1177.970) [-1180.460] * [-1179.408] (-1179.840) (-1177.187) (-1179.196) -- 0:00:53
      131000 -- (-1178.107) [-1181.265] (-1180.717) (-1179.149) * (-1180.890) (-1179.379) [-1177.298] (-1185.144) -- 0:00:53
      131500 -- (-1178.840) [-1178.730] (-1180.316) (-1178.591) * [-1178.194] (-1181.020) (-1178.005) (-1189.450) -- 0:00:52
      132000 -- (-1182.774) [-1178.721] (-1178.725) (-1178.840) * [-1177.337] (-1180.753) (-1177.443) (-1180.707) -- 0:00:52
      132500 -- (-1179.720) [-1181.352] (-1179.557) (-1178.781) * (-1182.195) (-1178.858) (-1177.747) [-1177.505] -- 0:00:58
      133000 -- [-1179.523] (-1178.341) (-1177.812) (-1178.268) * [-1179.950] (-1179.154) (-1178.235) (-1178.033) -- 0:00:58
      133500 -- (-1178.206) (-1178.803) [-1179.707] (-1181.488) * (-1178.885) [-1180.800] (-1181.573) (-1178.985) -- 0:00:58
      134000 -- (-1179.587) [-1178.283] (-1180.991) (-1178.479) * (-1178.918) [-1177.316] (-1179.048) (-1180.499) -- 0:00:58
      134500 -- (-1178.366) (-1178.414) (-1177.775) [-1178.325] * (-1181.943) [-1178.249] (-1180.039) (-1184.035) -- 0:00:57
      135000 -- (-1180.250) [-1178.614] (-1181.823) (-1181.788) * (-1180.523) (-1180.651) (-1179.994) [-1180.897] -- 0:00:57

      Average standard deviation of split frequencies: 0.023652

      135500 -- [-1180.328] (-1180.146) (-1183.351) (-1177.694) * (-1181.371) (-1181.388) [-1185.072] (-1179.844) -- 0:00:57
      136000 -- (-1178.248) (-1180.462) (-1180.069) [-1179.272] * (-1183.051) (-1178.296) (-1178.948) [-1177.247] -- 0:00:57
      136500 -- (-1178.790) (-1185.942) [-1179.922] (-1178.085) * (-1178.297) (-1180.346) (-1179.306) [-1178.045] -- 0:00:56
      137000 -- (-1178.018) (-1182.152) (-1178.837) [-1179.362] * (-1178.776) [-1179.482] (-1179.642) (-1177.479) -- 0:00:56
      137500 -- (-1180.839) (-1180.201) [-1177.923] (-1182.370) * [-1178.599] (-1179.346) (-1181.042) (-1178.007) -- 0:00:56
      138000 -- (-1184.065) (-1178.669) [-1177.629] (-1184.843) * (-1177.547) [-1178.097] (-1179.110) (-1178.353) -- 0:00:56
      138500 -- (-1184.888) [-1178.884] (-1179.629) (-1178.398) * (-1182.451) (-1178.716) [-1178.602] (-1179.787) -- 0:00:55
      139000 -- (-1183.483) [-1179.949] (-1179.870) (-1178.373) * (-1179.687) (-1182.449) (-1178.717) [-1179.433] -- 0:00:55
      139500 -- (-1180.406) [-1181.307] (-1179.297) (-1177.395) * (-1181.666) [-1180.203] (-1181.702) (-1181.259) -- 0:00:55
      140000 -- (-1180.101) (-1178.331) (-1181.564) [-1177.750] * (-1178.666) (-1179.699) [-1180.848] (-1178.271) -- 0:00:55

      Average standard deviation of split frequencies: 0.024641

      140500 -- (-1180.454) [-1177.142] (-1180.226) (-1177.859) * (-1178.102) [-1180.921] (-1182.967) (-1181.106) -- 0:00:55
      141000 -- (-1179.024) [-1178.166] (-1179.892) (-1178.823) * (-1178.102) [-1177.369] (-1179.540) (-1182.175) -- 0:00:54
      141500 -- (-1178.312) [-1177.542] (-1180.473) (-1177.627) * (-1180.050) [-1177.838] (-1181.200) (-1177.793) -- 0:00:54
      142000 -- (-1178.272) (-1177.905) [-1178.872] (-1180.684) * [-1180.194] (-1177.441) (-1179.708) (-1178.267) -- 0:00:54
      142500 -- (-1181.168) [-1177.416] (-1179.281) (-1179.912) * (-1179.448) [-1177.348] (-1180.486) (-1177.390) -- 0:00:54
      143000 -- (-1179.958) [-1178.160] (-1178.827) (-1177.232) * (-1181.008) (-1180.030) (-1177.543) [-1177.253] -- 0:00:53
      143500 -- [-1177.697] (-1177.486) (-1179.296) (-1177.234) * (-1180.023) (-1179.234) [-1177.947] (-1177.257) -- 0:00:53
      144000 -- (-1178.373) (-1177.586) (-1178.989) [-1179.903] * (-1180.226) (-1180.232) (-1178.388) [-1184.220] -- 0:00:53
      144500 -- (-1177.820) (-1180.104) [-1181.000] (-1179.181) * (-1178.064) (-1178.653) [-1179.477] (-1181.790) -- 0:00:53
      145000 -- [-1177.803] (-1179.327) (-1181.032) (-1184.090) * (-1179.894) (-1180.531) (-1179.136) [-1178.684] -- 0:00:53

      Average standard deviation of split frequencies: 0.022781

      145500 -- (-1178.109) [-1182.439] (-1181.069) (-1183.932) * (-1180.658) [-1178.152] (-1181.712) (-1179.622) -- 0:00:52
      146000 -- [-1181.117] (-1177.700) (-1180.815) (-1188.735) * (-1179.483) (-1181.127) (-1181.772) [-1178.560] -- 0:00:52
      146500 -- [-1180.584] (-1178.404) (-1178.638) (-1184.530) * (-1186.765) [-1178.777] (-1183.354) (-1178.183) -- 0:00:52
      147000 -- [-1181.052] (-1179.394) (-1178.691) (-1179.445) * (-1178.865) [-1180.439] (-1180.004) (-1181.060) -- 0:00:52
      147500 -- (-1179.431) (-1179.502) (-1178.183) [-1177.628] * (-1180.324) (-1180.877) (-1180.699) [-1181.706] -- 0:00:52
      148000 -- (-1180.662) (-1177.439) (-1178.157) [-1178.349] * [-1183.316] (-1178.526) (-1177.179) (-1180.547) -- 0:00:51
      148500 -- [-1180.683] (-1178.279) (-1180.084) (-1179.682) * (-1180.695) (-1179.217) [-1179.541] (-1182.438) -- 0:00:57
      149000 -- (-1181.481) [-1179.521] (-1177.303) (-1177.688) * (-1180.954) [-1178.298] (-1180.071) (-1180.031) -- 0:00:57
      149500 -- (-1186.833) (-1180.069) (-1177.277) [-1178.132] * [-1185.173] (-1183.708) (-1181.129) (-1180.129) -- 0:00:56
      150000 -- (-1184.279) (-1178.909) [-1179.003] (-1179.540) * [-1177.820] (-1178.456) (-1181.022) (-1179.538) -- 0:00:56

      Average standard deviation of split frequencies: 0.018443

      150500 -- (-1180.289) (-1178.519) [-1177.915] (-1179.154) * (-1178.545) [-1179.524] (-1177.310) (-1183.158) -- 0:00:56
      151000 -- (-1180.570) (-1178.535) (-1180.362) [-1179.615] * (-1179.804) [-1180.893] (-1177.547) (-1181.835) -- 0:00:56
      151500 -- (-1177.815) (-1178.508) [-1181.917] (-1180.928) * (-1181.663) (-1178.450) [-1177.462] (-1178.912) -- 0:00:56
      152000 -- (-1178.647) (-1181.039) (-1180.257) [-1179.153] * (-1182.798) [-1178.652] (-1178.720) (-1180.895) -- 0:00:55
      152500 -- (-1177.802) (-1179.224) (-1181.952) [-1179.360] * (-1179.352) (-1177.621) (-1180.252) [-1181.748] -- 0:00:55
      153000 -- [-1177.956] (-1178.478) (-1182.155) (-1180.726) * (-1177.569) (-1179.245) (-1179.338) [-1181.336] -- 0:00:55
      153500 -- [-1178.117] (-1178.855) (-1178.557) (-1179.810) * (-1177.850) (-1180.595) (-1178.514) [-1178.721] -- 0:00:55
      154000 -- (-1179.988) (-1177.221) [-1179.214] (-1179.194) * [-1177.973] (-1179.453) (-1180.934) (-1180.035) -- 0:00:54
      154500 -- (-1182.112) (-1179.388) [-1178.110] (-1178.958) * (-1179.190) (-1180.401) [-1178.568] (-1179.051) -- 0:00:54
      155000 -- [-1178.489] (-1177.939) (-1182.812) (-1177.556) * (-1179.096) (-1185.115) (-1179.989) [-1183.516] -- 0:00:54

      Average standard deviation of split frequencies: 0.018449

      155500 -- (-1178.494) (-1178.129) [-1178.175] (-1180.139) * (-1178.861) [-1178.918] (-1179.304) (-1178.464) -- 0:00:54
      156000 -- (-1179.704) [-1179.420] (-1179.513) (-1178.535) * [-1178.741] (-1180.100) (-1178.862) (-1177.557) -- 0:00:54
      156500 -- (-1178.274) (-1178.024) (-1178.797) [-1182.328] * [-1177.337] (-1180.307) (-1177.797) (-1178.191) -- 0:00:53
      157000 -- [-1177.771] (-1177.722) (-1179.168) (-1180.420) * [-1178.141] (-1179.143) (-1178.986) (-1179.295) -- 0:00:53
      157500 -- [-1179.297] (-1177.725) (-1177.288) (-1180.958) * [-1177.602] (-1181.098) (-1179.258) (-1182.624) -- 0:00:53
      158000 -- (-1179.315) (-1179.004) [-1184.591] (-1179.398) * (-1178.870) (-1180.213) (-1180.350) [-1178.960] -- 0:00:53
      158500 -- (-1178.977) (-1178.896) (-1182.837) [-1180.073] * [-1179.200] (-1177.804) (-1177.490) (-1179.437) -- 0:00:53
      159000 -- (-1179.681) [-1180.798] (-1181.865) (-1178.848) * (-1180.702) [-1180.862] (-1177.713) (-1178.243) -- 0:00:52
      159500 -- [-1179.732] (-1178.696) (-1177.069) (-1177.038) * [-1186.775] (-1181.125) (-1177.828) (-1178.943) -- 0:00:52
      160000 -- (-1178.798) (-1179.603) (-1178.788) [-1178.362] * [-1182.688] (-1178.316) (-1179.109) (-1179.965) -- 0:00:52

      Average standard deviation of split frequencies: 0.020538

      160500 -- [-1178.357] (-1178.985) (-1180.449) (-1179.034) * (-1183.833) (-1179.340) (-1182.643) [-1178.075] -- 0:00:52
      161000 -- (-1178.418) [-1179.845] (-1180.099) (-1178.866) * (-1177.905) [-1178.159] (-1179.571) (-1179.148) -- 0:00:52
      161500 -- (-1179.199) (-1180.427) [-1179.460] (-1182.723) * [-1178.201] (-1179.685) (-1180.111) (-1178.932) -- 0:00:51
      162000 -- (-1180.339) (-1180.374) [-1182.896] (-1180.314) * [-1178.562] (-1177.745) (-1182.097) (-1179.592) -- 0:00:51
      162500 -- (-1179.770) [-1179.364] (-1181.384) (-1179.238) * (-1179.202) (-1180.277) [-1179.729] (-1178.428) -- 0:00:51
      163000 -- (-1178.971) (-1182.738) [-1181.628] (-1184.156) * (-1183.472) [-1177.781] (-1183.050) (-1179.398) -- 0:00:51
      163500 -- (-1181.518) (-1179.474) (-1179.292) [-1179.834] * (-1179.162) (-1178.211) (-1179.589) [-1180.191] -- 0:00:51
      164000 -- (-1181.374) (-1180.757) (-1178.450) [-1178.268] * (-1181.814) [-1182.792] (-1177.187) (-1179.495) -- 0:00:50
      164500 -- [-1178.765] (-1179.388) (-1177.702) (-1178.546) * (-1181.573) [-1178.459] (-1178.150) (-1180.829) -- 0:00:55
      165000 -- (-1179.848) [-1179.809] (-1185.399) (-1179.071) * (-1183.994) [-1179.373] (-1178.412) (-1179.597) -- 0:00:55

      Average standard deviation of split frequencies: 0.019281

      165500 -- (-1177.419) (-1178.951) [-1177.831] (-1181.433) * [-1179.762] (-1180.903) (-1179.128) (-1179.255) -- 0:00:55
      166000 -- (-1180.990) (-1180.084) [-1177.779] (-1178.416) * [-1181.525] (-1179.765) (-1178.832) (-1179.143) -- 0:00:55
      166500 -- (-1181.880) [-1178.221] (-1178.180) (-1177.986) * (-1178.748) (-1177.679) (-1180.216) [-1177.164] -- 0:00:55
      167000 -- (-1180.361) [-1179.734] (-1180.038) (-1178.043) * (-1179.236) (-1179.478) [-1177.775] (-1177.788) -- 0:00:54
      167500 -- (-1182.739) [-1177.214] (-1178.680) (-1178.947) * (-1177.853) (-1179.223) (-1181.043) [-1178.295] -- 0:00:54
      168000 -- (-1179.925) [-1177.755] (-1181.410) (-1177.811) * (-1179.262) (-1177.592) [-1179.321] (-1179.934) -- 0:00:54
      168500 -- (-1177.835) (-1179.450) (-1178.307) [-1178.716] * (-1178.653) [-1180.427] (-1177.819) (-1179.048) -- 0:00:54
      169000 -- (-1177.380) (-1179.744) (-1181.734) [-1178.723] * (-1179.757) [-1179.521] (-1177.890) (-1178.585) -- 0:00:54
      169500 -- [-1177.708] (-1179.438) (-1177.734) (-1177.163) * (-1179.005) (-1178.610) [-1177.921] (-1180.112) -- 0:00:53
      170000 -- [-1177.730] (-1180.765) (-1181.955) (-1177.386) * (-1178.329) [-1178.279] (-1177.916) (-1180.185) -- 0:00:53

      Average standard deviation of split frequencies: 0.017736

      170500 -- (-1177.741) (-1180.161) [-1180.473] (-1178.702) * (-1179.710) (-1178.243) (-1181.190) [-1179.844] -- 0:00:53
      171000 -- (-1178.829) (-1177.363) (-1179.262) [-1179.872] * [-1180.516] (-1178.220) (-1179.680) (-1179.614) -- 0:00:53
      171500 -- (-1184.382) (-1179.230) (-1181.325) [-1180.131] * [-1177.171] (-1178.371) (-1180.428) (-1178.377) -- 0:00:53
      172000 -- (-1180.015) (-1177.605) (-1177.352) [-1178.756] * [-1177.184] (-1178.263) (-1181.421) (-1182.369) -- 0:00:52
      172500 -- (-1179.864) (-1178.054) (-1178.758) [-1180.517] * (-1180.137) (-1178.250) (-1179.520) [-1180.552] -- 0:00:52
      173000 -- (-1180.553) [-1178.646] (-1179.179) (-1182.068) * (-1180.315) [-1177.755] (-1178.951) (-1176.993) -- 0:00:52
      173500 -- [-1179.941] (-1179.429) (-1179.788) (-1178.893) * [-1181.586] (-1180.964) (-1180.060) (-1177.128) -- 0:00:52
      174000 -- (-1181.078) (-1178.586) [-1178.808] (-1177.229) * [-1182.323] (-1181.963) (-1180.292) (-1178.526) -- 0:00:52
      174500 -- [-1180.296] (-1179.781) (-1178.133) (-1177.262) * (-1180.884) (-1180.440) (-1178.368) [-1178.536] -- 0:00:52
      175000 -- (-1179.159) (-1180.326) (-1178.196) [-1178.747] * (-1181.335) [-1179.769] (-1179.056) (-1178.605) -- 0:00:51

      Average standard deviation of split frequencies: 0.016916

      175500 -- (-1179.211) (-1179.112) (-1178.263) [-1178.681] * (-1185.168) (-1183.083) (-1180.931) [-1177.615] -- 0:00:51
      176000 -- [-1186.095] (-1177.839) (-1178.399) (-1180.789) * (-1179.787) [-1182.985] (-1177.563) (-1179.207) -- 0:00:51
      176500 -- [-1178.466] (-1180.410) (-1178.555) (-1179.476) * (-1179.958) [-1180.281] (-1180.120) (-1181.352) -- 0:00:51
      177000 -- [-1179.408] (-1181.250) (-1178.261) (-1179.954) * [-1176.988] (-1177.232) (-1178.133) (-1180.491) -- 0:00:51
      177500 -- (-1183.965) [-1179.625] (-1179.238) (-1181.313) * (-1180.229) [-1177.516] (-1179.560) (-1178.640) -- 0:00:50
      178000 -- (-1181.593) (-1181.418) [-1177.211] (-1178.754) * (-1181.084) [-1179.529] (-1179.107) (-1179.380) -- 0:00:50
      178500 -- (-1183.376) (-1177.995) (-1179.924) [-1180.483] * [-1177.636] (-1178.023) (-1178.735) (-1177.490) -- 0:00:50
      179000 -- (-1189.862) [-1178.970] (-1179.194) (-1180.085) * [-1177.746] (-1178.741) (-1177.647) (-1182.536) -- 0:00:50
      179500 -- (-1180.897) (-1178.551) [-1178.622] (-1182.499) * (-1177.396) (-1178.258) (-1180.868) [-1177.487] -- 0:00:50
      180000 -- (-1180.416) [-1178.430] (-1178.341) (-1177.748) * (-1180.262) (-1182.866) (-1177.858) [-1178.071] -- 0:00:50

      Average standard deviation of split frequencies: 0.017540

      180500 -- [-1181.809] (-1178.493) (-1180.503) (-1180.412) * [-1183.527] (-1182.011) (-1178.418) (-1178.334) -- 0:00:49
      181000 -- (-1179.503) (-1179.646) [-1177.754] (-1179.910) * (-1181.806) (-1180.039) [-1178.843] (-1178.602) -- 0:00:54
      181500 -- [-1182.734] (-1182.051) (-1179.201) (-1179.657) * [-1180.278] (-1178.453) (-1178.844) (-1183.684) -- 0:00:54
      182000 -- [-1177.883] (-1180.385) (-1178.799) (-1180.840) * [-1182.251] (-1179.715) (-1179.603) (-1183.330) -- 0:00:53
      182500 -- (-1177.657) (-1178.757) [-1179.853] (-1179.513) * [-1178.443] (-1180.489) (-1177.737) (-1179.149) -- 0:00:53
      183000 -- (-1180.040) (-1177.449) [-1178.258] (-1177.961) * (-1179.177) [-1180.077] (-1177.927) (-1178.292) -- 0:00:53
      183500 -- (-1180.152) [-1177.923] (-1181.702) (-1180.341) * (-1179.574) (-1179.752) (-1178.941) [-1179.130] -- 0:00:53
      184000 -- (-1182.760) [-1177.906] (-1179.910) (-1181.378) * (-1178.632) (-1178.494) [-1179.936] (-1179.033) -- 0:00:53
      184500 -- (-1186.142) [-1177.218] (-1178.517) (-1182.202) * (-1177.917) (-1178.147) (-1178.803) [-1179.083] -- 0:00:53
      185000 -- (-1180.023) [-1177.720] (-1178.921) (-1178.166) * (-1182.164) (-1179.422) (-1181.196) [-1179.042] -- 0:00:52

      Average standard deviation of split frequencies: 0.018304

      185500 -- [-1180.117] (-1178.703) (-1179.682) (-1178.200) * (-1181.722) (-1177.479) (-1178.470) [-1178.212] -- 0:00:52
      186000 -- (-1178.296) [-1177.934] (-1178.361) (-1177.992) * [-1183.588] (-1178.799) (-1178.714) (-1179.063) -- 0:00:52
      186500 -- (-1178.307) (-1177.926) [-1179.999] (-1178.025) * (-1179.737) [-1179.905] (-1177.895) (-1178.883) -- 0:00:52
      187000 -- (-1183.322) (-1179.342) [-1178.994] (-1177.609) * [-1179.440] (-1178.386) (-1178.846) (-1178.848) -- 0:00:52
      187500 -- [-1178.876] (-1178.272) (-1178.549) (-1179.403) * (-1180.008) (-1179.777) (-1179.146) [-1177.768] -- 0:00:52
      188000 -- [-1179.512] (-1178.520) (-1179.460) (-1183.907) * (-1179.057) (-1179.739) (-1178.460) [-1177.668] -- 0:00:51
      188500 -- (-1178.499) (-1177.903) [-1178.595] (-1182.242) * [-1180.091] (-1178.051) (-1177.518) (-1178.563) -- 0:00:51
      189000 -- [-1178.288] (-1177.567) (-1178.636) (-1178.742) * [-1179.811] (-1178.600) (-1178.127) (-1177.341) -- 0:00:51
      189500 -- [-1178.527] (-1178.889) (-1178.253) (-1180.654) * [-1178.488] (-1177.914) (-1178.064) (-1178.554) -- 0:00:51
      190000 -- (-1181.048) [-1180.536] (-1182.442) (-1188.046) * (-1177.244) (-1177.914) (-1177.591) [-1180.569] -- 0:00:51

      Average standard deviation of split frequencies: 0.019092

      190500 -- (-1179.426) [-1180.054] (-1182.750) (-1188.704) * [-1177.200] (-1179.779) (-1181.513) (-1178.038) -- 0:00:50
      191000 -- (-1177.034) [-1179.055] (-1181.418) (-1182.420) * (-1179.186) (-1179.006) (-1179.946) [-1178.683] -- 0:00:50
      191500 -- (-1177.034) [-1179.282] (-1181.410) (-1179.500) * [-1184.238] (-1181.922) (-1180.142) (-1179.878) -- 0:00:50
      192000 -- (-1180.372) [-1178.446] (-1179.996) (-1179.181) * (-1185.977) (-1180.390) (-1178.388) [-1180.722] -- 0:00:50
      192500 -- (-1179.197) (-1177.115) (-1181.430) [-1179.034] * [-1177.193] (-1185.908) (-1177.669) (-1178.828) -- 0:00:50
      193000 -- (-1180.593) [-1177.502] (-1181.378) (-1179.088) * (-1178.143) (-1181.339) [-1177.874] (-1177.733) -- 0:00:50
      193500 -- [-1179.534] (-1178.484) (-1181.578) (-1181.246) * (-1177.080) (-1178.995) [-1179.443] (-1181.116) -- 0:00:50
      194000 -- (-1182.394) (-1177.418) (-1181.025) [-1179.759] * (-1177.103) [-1180.675] (-1180.098) (-1178.760) -- 0:00:49
      194500 -- (-1180.387) [-1177.651] (-1178.451) (-1179.844) * (-1178.588) (-1179.556) [-1178.697] (-1177.482) -- 0:00:49
      195000 -- (-1180.916) (-1177.865) (-1181.060) [-1178.379] * (-1177.297) (-1183.283) (-1177.545) [-1177.464] -- 0:00:49

      Average standard deviation of split frequencies: 0.018439

      195500 -- (-1177.350) (-1179.480) [-1180.043] (-1182.565) * (-1180.923) (-1177.767) [-1178.824] (-1177.722) -- 0:00:49
      196000 -- (-1179.302) (-1177.880) (-1179.844) [-1178.814] * (-1187.350) (-1177.699) (-1179.536) [-1180.997] -- 0:00:49
      196500 -- (-1177.658) [-1177.637] (-1179.850) (-1179.305) * (-1183.147) (-1179.633) [-1177.790] (-1177.387) -- 0:00:49
      197000 -- (-1178.772) [-1178.019] (-1181.309) (-1184.125) * [-1180.368] (-1178.913) (-1180.592) (-1182.384) -- 0:00:48
      197500 -- [-1179.409] (-1177.669) (-1180.208) (-1185.180) * (-1180.352) (-1181.080) [-1179.094] (-1177.740) -- 0:00:52
      198000 -- (-1179.392) [-1179.214] (-1184.666) (-1177.665) * (-1180.289) (-1179.297) [-1180.159] (-1178.283) -- 0:00:52
      198500 -- [-1178.432] (-1177.132) (-1180.685) (-1177.267) * (-1178.954) (-1179.416) (-1180.858) [-1178.352] -- 0:00:52
      199000 -- (-1179.312) (-1177.131) (-1180.239) [-1178.656] * (-1179.988) (-1178.373) (-1180.956) [-1177.209] -- 0:00:52
      199500 -- (-1180.057) (-1178.458) [-1177.891] (-1177.506) * [-1179.176] (-1179.718) (-1180.222) (-1179.283) -- 0:00:52
      200000 -- (-1177.703) (-1177.901) (-1183.230) [-1178.734] * (-1178.740) (-1179.868) (-1179.348) [-1183.433] -- 0:00:51

      Average standard deviation of split frequencies: 0.016738

      200500 -- (-1178.304) (-1177.925) [-1178.802] (-1185.547) * [-1180.723] (-1180.430) (-1179.269) (-1180.278) -- 0:00:51
      201000 -- (-1179.448) [-1179.484] (-1182.266) (-1179.509) * [-1180.455] (-1181.280) (-1179.618) (-1179.165) -- 0:00:51
      201500 -- [-1179.724] (-1179.672) (-1179.124) (-1178.651) * [-1180.602] (-1179.777) (-1179.317) (-1178.561) -- 0:00:51
      202000 -- (-1179.146) (-1179.524) (-1179.047) [-1179.213] * (-1185.780) (-1181.971) [-1181.339] (-1178.324) -- 0:00:51
      202500 -- (-1178.095) [-1178.834] (-1180.421) (-1178.194) * (-1179.256) (-1179.085) [-1183.352] (-1179.408) -- 0:00:51
      203000 -- (-1180.711) (-1177.609) [-1179.672] (-1178.939) * [-1179.463] (-1179.344) (-1181.953) (-1181.520) -- 0:00:51
      203500 -- [-1181.394] (-1181.048) (-1180.471) (-1178.353) * (-1179.889) (-1179.923) [-1180.318] (-1180.771) -- 0:00:50
      204000 -- (-1181.386) (-1179.040) (-1182.174) [-1178.410] * (-1179.202) [-1178.899] (-1179.222) (-1182.239) -- 0:00:50
      204500 -- (-1177.729) (-1177.355) [-1179.244] (-1179.173) * (-1182.667) (-1181.617) [-1181.019] (-1185.611) -- 0:00:50
      205000 -- [-1179.098] (-1177.095) (-1177.861) (-1181.458) * (-1182.138) [-1179.549] (-1179.573) (-1183.336) -- 0:00:50

      Average standard deviation of split frequencies: 0.015898

      205500 -- (-1178.375) [-1179.098] (-1181.797) (-1178.620) * [-1178.836] (-1177.249) (-1185.325) (-1178.726) -- 0:00:50
      206000 -- (-1177.060) (-1179.911) [-1177.724] (-1181.484) * [-1178.515] (-1179.583) (-1186.902) (-1179.098) -- 0:00:50
      206500 -- [-1178.498] (-1178.769) (-1177.804) (-1177.575) * (-1180.510) [-1178.126] (-1179.545) (-1179.091) -- 0:00:49
      207000 -- (-1177.984) (-1177.527) [-1177.506] (-1179.962) * (-1180.314) (-1178.687) [-1178.658] (-1182.184) -- 0:00:49
      207500 -- [-1180.024] (-1179.116) (-1177.990) (-1177.828) * (-1179.240) (-1177.745) (-1179.571) [-1179.517] -- 0:00:49
      208000 -- (-1187.255) (-1185.630) [-1178.404] (-1178.022) * (-1179.931) (-1177.551) [-1177.423] (-1178.798) -- 0:00:49
      208500 -- (-1181.232) (-1184.404) [-1181.376] (-1186.302) * [-1178.722] (-1177.552) (-1177.445) (-1185.689) -- 0:00:49
      209000 -- (-1181.551) (-1181.085) (-1181.360) [-1181.346] * (-1177.874) (-1177.133) [-1183.001] (-1178.333) -- 0:00:49
      209500 -- (-1180.292) [-1179.465] (-1181.338) (-1181.823) * (-1180.678) (-1178.782) [-1179.278] (-1177.603) -- 0:00:49
      210000 -- (-1180.943) (-1178.523) (-1180.098) [-1181.973] * (-1179.351) (-1181.291) [-1180.053] (-1177.016) -- 0:00:48

      Average standard deviation of split frequencies: 0.015291

      210500 -- (-1180.954) [-1179.460] (-1178.461) (-1182.570) * (-1182.149) (-1180.149) [-1177.288] (-1179.379) -- 0:00:48
      211000 -- (-1178.697) (-1180.967) (-1188.386) [-1179.704] * (-1180.014) (-1181.446) [-1177.453] (-1180.363) -- 0:00:48
      211500 -- (-1178.796) (-1183.108) (-1179.783) [-1179.573] * (-1179.931) (-1182.184) [-1177.456] (-1179.139) -- 0:00:48
      212000 -- (-1178.658) [-1180.840] (-1180.428) (-1178.012) * (-1189.593) (-1182.008) (-1178.310) [-1180.428] -- 0:00:48
      212500 -- (-1178.441) (-1179.113) (-1179.314) [-1179.107] * [-1177.582] (-1180.019) (-1180.591) (-1180.217) -- 0:00:48
      213000 -- (-1178.698) (-1181.167) [-1178.207] (-1185.617) * (-1179.532) [-1179.171] (-1179.642) (-1179.555) -- 0:00:51
      213500 -- [-1178.643] (-1184.321) (-1179.799) (-1180.491) * (-1179.541) (-1179.938) [-1179.443] (-1178.888) -- 0:00:51
      214000 -- (-1179.613) (-1177.853) [-1179.492] (-1180.276) * (-1180.971) (-1177.432) [-1178.264] (-1179.382) -- 0:00:51
      214500 -- (-1179.868) [-1177.237] (-1177.697) (-1180.425) * [-1179.161] (-1177.921) (-1178.827) (-1177.783) -- 0:00:51
      215000 -- (-1178.845) [-1178.214] (-1182.620) (-1178.990) * (-1178.654) (-1180.405) [-1178.653] (-1178.345) -- 0:00:51

      Average standard deviation of split frequencies: 0.016441

      215500 -- [-1181.338] (-1178.890) (-1184.363) (-1179.329) * (-1177.508) [-1181.279] (-1180.507) (-1179.508) -- 0:00:50
      216000 -- (-1183.208) (-1180.624) (-1180.401) [-1177.722] * (-1177.491) [-1180.425] (-1178.174) (-1179.363) -- 0:00:50
      216500 -- [-1179.775] (-1179.622) (-1178.406) (-1179.797) * (-1178.008) (-1179.234) [-1177.881] (-1184.954) -- 0:00:50
      217000 -- (-1179.822) (-1181.361) [-1179.786] (-1181.071) * (-1179.642) (-1180.335) [-1178.586] (-1181.918) -- 0:00:50
      217500 -- (-1178.195) (-1181.360) [-1178.617] (-1181.074) * [-1178.013] (-1179.366) (-1178.459) (-1178.596) -- 0:00:50
      218000 -- [-1177.495] (-1177.806) (-1177.596) (-1179.161) * [-1177.049] (-1178.298) (-1178.656) (-1178.578) -- 0:00:50
      218500 -- [-1179.235] (-1178.320) (-1178.686) (-1178.747) * (-1180.059) [-1179.018] (-1178.497) (-1184.016) -- 0:00:50
      219000 -- (-1179.401) (-1178.082) (-1179.793) [-1178.383] * (-1178.870) (-1180.041) (-1178.815) [-1180.581] -- 0:00:49
      219500 -- (-1182.155) (-1180.898) (-1179.511) [-1179.534] * (-1178.133) (-1180.199) [-1177.639] (-1181.086) -- 0:00:49
      220000 -- (-1180.597) [-1183.905] (-1180.137) (-1178.998) * (-1180.973) (-1179.104) [-1177.639] (-1177.271) -- 0:00:49

      Average standard deviation of split frequencies: 0.014812

      220500 -- (-1179.925) (-1177.441) [-1178.599] (-1179.223) * (-1184.116) (-1177.984) (-1181.605) [-1177.598] -- 0:00:49
      221000 -- (-1186.624) [-1179.471] (-1179.595) (-1184.832) * (-1180.374) [-1178.802] (-1177.545) (-1178.887) -- 0:00:49
      221500 -- (-1182.892) [-1177.254] (-1182.319) (-1180.323) * (-1178.287) (-1177.623) [-1177.039] (-1179.387) -- 0:00:49
      222000 -- [-1180.717] (-1181.584) (-1183.464) (-1183.010) * (-1178.448) (-1178.454) [-1178.035] (-1179.594) -- 0:00:49
      222500 -- [-1182.461] (-1181.420) (-1178.983) (-1184.338) * (-1178.920) (-1177.739) (-1177.711) [-1178.295] -- 0:00:48
      223000 -- [-1178.153] (-1178.744) (-1179.201) (-1180.474) * (-1178.045) (-1177.302) [-1178.996] (-1179.604) -- 0:00:48
      223500 -- (-1181.556) (-1180.132) (-1178.285) [-1178.525] * (-1178.262) (-1177.417) (-1179.206) [-1179.467] -- 0:00:48
      224000 -- (-1178.905) [-1179.417] (-1182.861) (-1178.494) * [-1181.925] (-1179.981) (-1178.906) (-1185.766) -- 0:00:48
      224500 -- (-1182.114) [-1177.345] (-1178.280) (-1178.282) * (-1180.282) (-1177.709) [-1180.712] (-1181.411) -- 0:00:48
      225000 -- (-1178.651) (-1177.827) [-1180.488] (-1178.785) * (-1179.830) (-1180.060) (-1179.733) [-1183.560] -- 0:00:48

      Average standard deviation of split frequencies: 0.013374

      225500 -- [-1182.614] (-1177.774) (-1181.297) (-1177.466) * (-1177.581) [-1177.028] (-1177.934) (-1180.935) -- 0:00:48
      226000 -- (-1182.403) (-1180.720) (-1181.774) [-1177.845] * [-1181.913] (-1177.758) (-1177.899) (-1179.865) -- 0:00:47
      226500 -- (-1178.906) (-1178.448) [-1178.403] (-1178.311) * [-1179.370] (-1179.772) (-1179.696) (-1179.213) -- 0:00:47
      227000 -- (-1179.347) (-1177.471) [-1178.669] (-1180.009) * (-1178.407) (-1180.592) (-1178.626) [-1177.190] -- 0:00:47
      227500 -- (-1178.342) [-1179.546] (-1178.955) (-1177.298) * (-1184.326) (-1179.430) (-1178.125) [-1177.494] -- 0:00:47
      228000 -- (-1178.488) [-1177.832] (-1179.126) (-1177.300) * (-1180.460) (-1181.432) (-1178.868) [-1177.948] -- 0:00:47
      228500 -- [-1179.869] (-1179.965) (-1177.744) (-1177.300) * (-1183.510) [-1178.721] (-1179.924) (-1177.949) -- 0:00:47
      229000 -- (-1182.396) (-1182.761) [-1180.330] (-1178.040) * [-1180.821] (-1177.614) (-1178.562) (-1177.993) -- 0:00:47
      229500 -- (-1178.862) [-1179.767] (-1184.617) (-1183.333) * [-1178.262] (-1178.631) (-1179.948) (-1178.611) -- 0:00:50
      230000 -- (-1179.602) (-1179.267) (-1181.947) [-1179.219] * (-1178.611) (-1178.002) (-1183.083) [-1178.569] -- 0:00:50

      Average standard deviation of split frequencies: 0.011354

      230500 -- (-1182.294) (-1181.544) [-1183.140] (-1180.295) * (-1181.163) (-1183.028) [-1181.395] (-1177.932) -- 0:00:50
      231000 -- [-1178.588] (-1181.023) (-1179.684) (-1178.719) * (-1179.998) (-1179.128) [-1181.701] (-1178.039) -- 0:00:49
      231500 -- (-1179.377) (-1183.187) [-1179.003] (-1182.645) * [-1179.770] (-1179.290) (-1177.348) (-1185.172) -- 0:00:49
      232000 -- [-1177.437] (-1180.128) (-1178.823) (-1178.462) * (-1177.325) (-1180.257) [-1178.216] (-1185.857) -- 0:00:49
      232500 -- (-1183.078) [-1178.777] (-1178.165) (-1178.948) * (-1177.416) (-1184.557) (-1180.158) [-1179.864] -- 0:00:49
      233000 -- (-1179.753) [-1178.645] (-1178.019) (-1178.574) * (-1181.035) (-1178.255) [-1178.718] (-1182.154) -- 0:00:49
      233500 -- (-1178.689) (-1182.101) (-1178.775) [-1179.770] * (-1182.596) (-1178.836) (-1179.446) [-1177.279] -- 0:00:49
      234000 -- (-1181.240) (-1182.449) [-1178.341] (-1179.046) * [-1182.072] (-1178.964) (-1178.653) (-1177.166) -- 0:00:49
      234500 -- (-1182.840) (-1178.379) [-1178.180] (-1179.099) * (-1181.669) (-1179.341) (-1177.752) [-1179.354] -- 0:00:48
      235000 -- (-1178.267) [-1179.196] (-1179.998) (-1177.784) * (-1178.845) (-1178.318) (-1178.435) [-1177.725] -- 0:00:48

      Average standard deviation of split frequencies: 0.013206

      235500 -- (-1181.009) (-1177.283) (-1178.734) [-1178.660] * (-1177.686) (-1180.823) [-1179.222] (-1179.613) -- 0:00:48
      236000 -- (-1178.395) (-1177.642) [-1178.046] (-1177.440) * [-1181.508] (-1178.486) (-1181.369) (-1179.067) -- 0:00:48
      236500 -- (-1179.214) (-1180.849) [-1178.899] (-1178.255) * (-1182.860) [-1179.018] (-1182.412) (-1179.697) -- 0:00:48
      237000 -- (-1182.855) (-1178.654) [-1178.601] (-1177.225) * (-1178.057) (-1182.080) (-1179.313) [-1177.609] -- 0:00:48
      237500 -- [-1181.301] (-1178.874) (-1178.252) (-1177.420) * (-1179.271) [-1179.825] (-1180.413) (-1177.658) -- 0:00:48
      238000 -- (-1183.921) [-1177.978] (-1177.833) (-1177.002) * (-1180.557) [-1179.195] (-1180.903) (-1180.403) -- 0:00:48
      238500 -- [-1181.928] (-1177.694) (-1179.977) (-1177.319) * (-1178.293) (-1178.400) (-1177.552) [-1179.265] -- 0:00:47
      239000 -- (-1181.476) (-1177.705) [-1179.701] (-1177.860) * (-1180.113) (-1184.284) (-1180.808) [-1180.378] -- 0:00:47
      239500 -- [-1180.080] (-1181.006) (-1178.553) (-1178.890) * [-1179.801] (-1178.183) (-1182.329) (-1179.025) -- 0:00:47
      240000 -- (-1179.379) (-1181.249) (-1181.119) [-1177.506] * (-1178.860) (-1177.690) [-1178.009] (-1183.810) -- 0:00:47

      Average standard deviation of split frequencies: 0.012213

      240500 -- (-1179.487) [-1179.850] (-1181.296) (-1177.311) * [-1181.006] (-1177.815) (-1178.544) (-1182.439) -- 0:00:47
      241000 -- (-1178.482) [-1178.500] (-1179.174) (-1179.631) * (-1178.940) (-1181.549) [-1179.074] (-1180.293) -- 0:00:47
      241500 -- (-1178.517) [-1178.012] (-1180.550) (-1180.710) * (-1181.219) [-1179.040] (-1177.540) (-1179.492) -- 0:00:47
      242000 -- (-1178.129) [-1177.872] (-1179.728) (-1180.599) * (-1177.367) (-1177.758) (-1178.329) [-1177.901] -- 0:00:46
      242500 -- (-1179.753) (-1177.849) [-1177.350] (-1182.523) * (-1180.776) (-1177.206) (-1178.756) [-1178.083] -- 0:00:46
      243000 -- (-1180.261) [-1177.269] (-1177.724) (-1179.576) * (-1177.925) [-1178.415] (-1180.747) (-1177.499) -- 0:00:46
      243500 -- (-1178.915) (-1178.226) (-1181.410) [-1178.653] * (-1179.421) [-1178.625] (-1184.015) (-1178.031) -- 0:00:46
      244000 -- (-1178.273) (-1179.076) (-1187.953) [-1178.021] * (-1179.480) (-1179.253) (-1179.979) [-1177.978] -- 0:00:46
      244500 -- (-1178.966) (-1180.268) (-1184.689) [-1179.241] * [-1179.401] (-1178.730) (-1182.839) (-1177.667) -- 0:00:46
      245000 -- (-1180.410) (-1179.161) [-1179.904] (-1177.888) * (-1179.599) (-1180.347) [-1179.232] (-1177.626) -- 0:00:46

      Average standard deviation of split frequencies: 0.013307

      245500 -- [-1178.565] (-1178.217) (-1178.073) (-1180.034) * (-1177.305) (-1177.797) [-1177.320] (-1178.299) -- 0:00:46
      246000 -- (-1184.352) [-1178.219] (-1178.358) (-1179.075) * [-1177.717] (-1178.310) (-1178.357) (-1178.003) -- 0:00:49
      246500 -- (-1180.618) (-1178.115) [-1178.269] (-1178.248) * (-1179.971) (-1186.581) [-1177.970] (-1178.417) -- 0:00:48
      247000 -- [-1178.720] (-1180.747) (-1178.776) (-1181.942) * (-1183.136) (-1179.094) [-1178.169] (-1180.231) -- 0:00:48
      247500 -- (-1178.683) (-1178.677) [-1177.321] (-1180.632) * (-1179.900) (-1182.023) [-1179.222] (-1181.579) -- 0:00:48
      248000 -- (-1179.237) (-1177.335) [-1177.361] (-1180.867) * (-1181.354) [-1186.126] (-1176.989) (-1178.094) -- 0:00:48
      248500 -- (-1178.910) [-1178.419] (-1177.360) (-1177.536) * [-1181.541] (-1179.418) (-1181.006) (-1177.580) -- 0:00:48
      249000 -- (-1181.335) (-1180.837) [-1177.602] (-1178.556) * [-1181.535] (-1177.089) (-1182.467) (-1179.332) -- 0:00:48
      249500 -- (-1179.412) (-1177.303) (-1177.217) [-1180.307] * [-1181.161] (-1177.487) (-1181.658) (-1178.740) -- 0:00:48
      250000 -- (-1179.245) (-1180.351) [-1179.128] (-1181.742) * [-1180.963] (-1187.064) (-1177.558) (-1179.188) -- 0:00:48

      Average standard deviation of split frequencies: 0.011947

      250500 -- [-1179.731] (-1177.720) (-1185.750) (-1182.205) * [-1181.187] (-1180.072) (-1179.066) (-1178.225) -- 0:00:47
      251000 -- [-1180.788] (-1181.228) (-1178.765) (-1180.438) * [-1179.386] (-1181.584) (-1177.785) (-1179.098) -- 0:00:47
      251500 -- [-1180.866] (-1179.281) (-1178.790) (-1181.718) * (-1178.523) (-1182.335) [-1177.780] (-1179.647) -- 0:00:47
      252000 -- (-1180.450) (-1178.613) (-1177.779) [-1177.199] * (-1177.626) (-1179.830) (-1177.719) [-1180.618] -- 0:00:47
      252500 -- (-1181.139) (-1180.955) [-1177.758] (-1178.838) * (-1177.812) (-1181.306) (-1179.026) [-1177.075] -- 0:00:47
      253000 -- (-1185.455) (-1177.341) [-1177.409] (-1177.820) * [-1177.597] (-1180.516) (-1180.953) (-1178.135) -- 0:00:47
      253500 -- (-1177.702) (-1177.426) [-1177.022] (-1177.780) * (-1178.940) [-1179.462] (-1178.055) (-1180.470) -- 0:00:47
      254000 -- [-1178.397] (-1179.511) (-1177.038) (-1178.668) * (-1178.135) (-1179.780) (-1180.924) [-1181.679] -- 0:00:46
      254500 -- (-1177.734) (-1181.715) (-1177.009) [-1179.432] * [-1177.569] (-1177.835) (-1179.775) (-1180.547) -- 0:00:46
      255000 -- (-1178.369) [-1181.805] (-1177.227) (-1179.149) * (-1179.439) (-1181.030) [-1177.424] (-1177.187) -- 0:00:46

      Average standard deviation of split frequencies: 0.012023

      255500 -- (-1184.732) [-1179.993] (-1178.596) (-1177.347) * [-1181.852] (-1179.363) (-1177.656) (-1179.260) -- 0:00:46
      256000 -- [-1177.699] (-1178.926) (-1177.267) (-1180.568) * (-1183.050) (-1178.586) (-1177.910) [-1180.168] -- 0:00:46
      256500 -- (-1178.154) (-1180.646) (-1179.230) [-1178.791] * [-1181.341] (-1177.627) (-1177.693) (-1177.549) -- 0:00:46
      257000 -- [-1179.575] (-1182.154) (-1179.642) (-1178.281) * (-1178.985) (-1177.621) (-1179.217) [-1178.557] -- 0:00:46
      257500 -- (-1178.906) [-1179.676] (-1179.440) (-1182.124) * (-1178.422) [-1178.850] (-1177.562) (-1183.954) -- 0:00:46
      258000 -- (-1180.374) (-1181.197) [-1177.251] (-1179.880) * [-1178.712] (-1183.076) (-1177.674) (-1183.197) -- 0:00:46
      258500 -- (-1179.305) (-1177.434) (-1177.278) [-1178.689] * (-1179.515) [-1182.603] (-1179.742) (-1182.177) -- 0:00:45
      259000 -- (-1180.725) (-1177.981) [-1177.493] (-1179.710) * [-1178.928] (-1178.669) (-1180.257) (-1181.314) -- 0:00:45
      259500 -- (-1179.655) [-1179.348] (-1183.412) (-1180.450) * (-1178.943) (-1179.428) (-1179.491) [-1180.328] -- 0:00:45
      260000 -- (-1177.984) (-1179.558) [-1177.419] (-1180.151) * [-1179.780] (-1180.651) (-1177.852) (-1179.408) -- 0:00:45

      Average standard deviation of split frequencies: 0.011915

      260500 -- (-1181.006) [-1180.047] (-1181.469) (-1181.347) * (-1179.172) (-1180.775) [-1178.921] (-1179.558) -- 0:00:45
      261000 -- [-1180.086] (-1179.950) (-1184.904) (-1185.600) * (-1177.857) (-1181.181) [-1178.002] (-1179.559) -- 0:00:45
      261500 -- [-1178.514] (-1181.537) (-1178.852) (-1180.111) * [-1177.638] (-1178.791) (-1178.935) (-1177.796) -- 0:00:45
      262000 -- [-1180.769] (-1180.122) (-1179.547) (-1179.907) * (-1178.411) [-1177.821] (-1181.583) (-1179.508) -- 0:00:47
      262500 -- [-1178.221] (-1179.700) (-1178.911) (-1184.034) * (-1178.621) [-1177.703] (-1182.222) (-1179.604) -- 0:00:47
      263000 -- (-1177.542) [-1177.409] (-1182.875) (-1180.920) * (-1178.374) (-1181.459) [-1180.554] (-1178.625) -- 0:00:47
      263500 -- (-1181.318) (-1178.617) [-1177.571] (-1179.369) * [-1176.976] (-1182.136) (-1178.345) (-1178.598) -- 0:00:47
      264000 -- (-1180.913) (-1176.957) [-1179.621] (-1184.780) * (-1177.728) (-1178.778) [-1178.688] (-1180.805) -- 0:00:47
      264500 -- (-1180.405) (-1178.768) [-1179.877] (-1178.059) * [-1176.890] (-1178.973) (-1178.711) (-1179.740) -- 0:00:47
      265000 -- (-1180.033) [-1179.677] (-1177.442) (-1178.655) * (-1177.455) [-1180.269] (-1180.727) (-1180.069) -- 0:00:47

      Average standard deviation of split frequencies: 0.011676

      265500 -- (-1185.259) (-1177.633) [-1178.196] (-1178.874) * [-1180.294] (-1181.559) (-1179.172) (-1178.268) -- 0:00:47
      266000 -- [-1181.517] (-1177.719) (-1178.148) (-1178.648) * (-1178.445) (-1178.578) (-1178.146) [-1178.708] -- 0:00:46
      266500 -- (-1181.927) [-1177.506] (-1179.369) (-1179.333) * (-1179.760) (-1177.991) (-1178.573) [-1179.344] -- 0:00:46
      267000 -- (-1179.338) [-1181.844] (-1181.537) (-1180.995) * (-1179.059) (-1182.019) (-1178.654) [-1178.003] -- 0:00:46
      267500 -- (-1178.877) (-1181.293) (-1181.333) [-1179.113] * (-1178.806) (-1179.313) (-1181.546) [-1178.675] -- 0:00:46
      268000 -- (-1178.925) [-1180.219] (-1179.051) (-1179.079) * (-1184.172) (-1179.912) (-1179.613) [-1180.026] -- 0:00:46
      268500 -- (-1177.916) (-1177.771) (-1181.332) [-1180.669] * (-1180.887) (-1185.189) [-1181.533] (-1179.760) -- 0:00:46
      269000 -- (-1178.277) (-1179.473) (-1178.921) [-1182.734] * (-1183.260) (-1180.713) [-1178.140] (-1178.445) -- 0:00:46
      269500 -- (-1178.046) (-1180.478) (-1179.503) [-1179.902] * (-1177.785) [-1178.889] (-1178.514) (-1177.874) -- 0:00:46
      270000 -- (-1178.971) (-1179.498) [-1177.709] (-1180.805) * (-1178.884) [-1178.307] (-1180.807) (-1180.507) -- 0:00:45

      Average standard deviation of split frequencies: 0.012704

      270500 -- [-1178.082] (-1178.887) (-1180.725) (-1179.130) * [-1178.732] (-1181.312) (-1182.362) (-1181.149) -- 0:00:45
      271000 -- (-1179.399) (-1178.457) [-1178.727] (-1179.806) * (-1179.561) [-1178.232] (-1181.643) (-1182.795) -- 0:00:45
      271500 -- (-1177.080) [-1178.894] (-1178.800) (-1178.733) * (-1184.094) (-1178.387) (-1179.126) [-1181.037] -- 0:00:45
      272000 -- [-1178.357] (-1180.539) (-1182.573) (-1179.937) * (-1182.306) (-1183.460) (-1179.777) [-1179.478] -- 0:00:45
      272500 -- (-1178.087) (-1183.376) [-1180.509] (-1180.997) * (-1179.418) (-1185.500) (-1179.634) [-1182.061] -- 0:00:45
      273000 -- [-1178.684] (-1183.863) (-1179.889) (-1182.686) * [-1178.796] (-1179.308) (-1178.334) (-1181.551) -- 0:00:45
      273500 -- (-1178.431) (-1182.909) [-1179.752] (-1180.442) * (-1185.624) (-1178.554) (-1181.091) [-1178.818] -- 0:00:45
      274000 -- (-1182.378) (-1182.977) (-1179.371) [-1179.096] * (-1177.782) (-1182.889) [-1188.097] (-1179.096) -- 0:00:45
      274500 -- [-1181.976] (-1178.350) (-1181.512) (-1180.288) * (-1179.329) (-1178.991) [-1178.453] (-1179.270) -- 0:00:44
      275000 -- (-1180.002) (-1178.063) [-1180.447] (-1179.668) * (-1179.835) [-1179.533] (-1177.842) (-1186.234) -- 0:00:44

      Average standard deviation of split frequencies: 0.013344

      275500 -- [-1183.366] (-1177.614) (-1181.358) (-1178.144) * (-1178.724) [-1178.850] (-1178.580) (-1178.612) -- 0:00:44
      276000 -- (-1179.468) [-1177.304] (-1178.189) (-1178.527) * (-1181.568) [-1180.493] (-1180.010) (-1179.079) -- 0:00:44
      276500 -- [-1181.653] (-1181.508) (-1178.891) (-1178.169) * (-1180.956) [-1179.718] (-1181.171) (-1180.585) -- 0:00:44
      277000 -- (-1177.920) [-1178.590] (-1178.859) (-1180.784) * (-1179.207) (-1178.581) (-1179.775) [-1178.016] -- 0:00:44
      277500 -- (-1181.630) [-1178.323] (-1179.030) (-1179.234) * (-1178.740) (-1178.560) (-1179.757) [-1177.990] -- 0:00:44
      278000 -- [-1179.254] (-1177.773) (-1181.582) (-1177.852) * (-1179.012) (-1181.254) (-1181.525) [-1177.806] -- 0:00:46
      278500 -- (-1179.694) [-1177.599] (-1177.735) (-1178.632) * (-1179.962) (-1177.952) [-1181.619] (-1178.134) -- 0:00:46
      279000 -- [-1180.050] (-1180.096) (-1179.417) (-1178.724) * (-1178.770) [-1179.687] (-1178.256) (-1179.650) -- 0:00:46
      279500 -- (-1179.529) [-1177.633] (-1181.171) (-1182.807) * (-1179.757) (-1177.906) [-1178.731] (-1178.969) -- 0:00:46
      280000 -- (-1179.105) (-1179.054) (-1180.226) [-1181.500] * (-1179.784) (-1177.784) [-1180.028] (-1178.564) -- 0:00:46

      Average standard deviation of split frequencies: 0.013122

      280500 -- (-1178.239) (-1178.655) [-1178.282] (-1183.776) * (-1180.011) [-1180.964] (-1179.077) (-1177.472) -- 0:00:46
      281000 -- [-1178.975] (-1182.555) (-1178.508) (-1179.011) * (-1178.866) [-1181.347] (-1178.836) (-1180.428) -- 0:00:46
      281500 -- (-1178.073) (-1182.397) (-1179.076) [-1178.801] * (-1180.520) [-1177.907] (-1186.281) (-1180.155) -- 0:00:45
      282000 -- [-1178.073] (-1185.976) (-1179.076) (-1177.973) * (-1177.890) [-1179.477] (-1178.575) (-1179.765) -- 0:00:45
      282500 -- (-1179.453) (-1183.688) (-1179.401) [-1177.748] * (-1179.928) [-1180.275] (-1178.405) (-1179.004) -- 0:00:45
      283000 -- (-1180.048) (-1180.570) (-1179.244) [-1178.168] * (-1181.131) (-1179.796) [-1177.452] (-1180.540) -- 0:00:45
      283500 -- (-1179.268) (-1179.456) [-1179.814] (-1178.709) * (-1181.411) [-1181.454] (-1179.219) (-1186.402) -- 0:00:45
      284000 -- (-1176.938) (-1179.260) [-1179.515] (-1178.369) * (-1180.258) (-1179.757) [-1180.817] (-1181.611) -- 0:00:45
      284500 -- (-1181.586) [-1179.078] (-1181.973) (-1178.327) * [-1181.571] (-1178.301) (-1179.567) (-1178.680) -- 0:00:45
      285000 -- (-1177.741) (-1181.230) (-1177.681) [-1178.249] * (-1179.563) [-1177.054] (-1179.536) (-1180.215) -- 0:00:45

      Average standard deviation of split frequencies: 0.013392

      285500 -- (-1178.070) [-1181.752] (-1178.739) (-1178.376) * (-1181.493) [-1177.347] (-1183.567) (-1179.373) -- 0:00:45
      286000 -- (-1178.674) [-1178.724] (-1177.952) (-1179.965) * (-1179.473) [-1177.868] (-1179.662) (-1178.354) -- 0:00:44
      286500 -- (-1183.075) (-1178.136) (-1181.709) [-1178.523] * [-1180.532] (-1178.524) (-1181.457) (-1179.242) -- 0:00:44
      287000 -- (-1180.827) (-1178.108) [-1178.445] (-1182.421) * (-1181.897) [-1181.496] (-1180.270) (-1177.989) -- 0:00:44
      287500 -- (-1181.549) [-1178.805] (-1179.891) (-1183.453) * [-1178.467] (-1178.587) (-1180.200) (-1179.406) -- 0:00:44
      288000 -- (-1183.275) (-1177.158) (-1179.444) [-1178.673] * (-1180.875) (-1180.727) [-1179.886] (-1177.163) -- 0:00:44
      288500 -- [-1180.704] (-1180.608) (-1179.499) (-1179.637) * (-1181.603) (-1182.384) [-1180.837] (-1177.665) -- 0:00:44
      289000 -- [-1180.087] (-1181.704) (-1178.908) (-1180.900) * [-1180.297] (-1180.245) (-1178.401) (-1178.120) -- 0:00:44
      289500 -- (-1179.891) (-1180.725) [-1182.608] (-1181.875) * [-1177.675] (-1182.022) (-1184.199) (-1177.241) -- 0:00:44
      290000 -- (-1180.264) [-1183.580] (-1180.222) (-1182.955) * (-1177.602) [-1180.487] (-1177.215) (-1179.307) -- 0:00:44

      Average standard deviation of split frequencies: 0.012164

      290500 -- [-1178.234] (-1183.143) (-1177.026) (-1178.119) * (-1179.072) (-1178.122) [-1177.949] (-1181.868) -- 0:00:43
      291000 -- (-1178.571) [-1179.802] (-1177.653) (-1179.663) * (-1182.653) (-1181.390) (-1180.728) [-1180.079] -- 0:00:43
      291500 -- (-1180.340) (-1180.995) [-1177.578] (-1180.592) * [-1178.003] (-1180.700) (-1179.045) (-1178.826) -- 0:00:43
      292000 -- (-1181.491) (-1181.807) [-1178.560] (-1179.228) * (-1178.633) [-1183.621] (-1181.361) (-1180.041) -- 0:00:43
      292500 -- (-1179.486) [-1181.188] (-1179.618) (-1180.766) * (-1180.804) (-1179.618) (-1179.519) [-1179.430] -- 0:00:43
      293000 -- (-1184.786) (-1178.832) (-1182.790) [-1180.255] * [-1178.480] (-1178.978) (-1179.673) (-1179.443) -- 0:00:43
      293500 -- (-1183.177) [-1178.058] (-1182.574) (-1178.536) * (-1177.455) (-1178.391) (-1178.954) [-1180.464] -- 0:00:43
      294000 -- [-1179.862] (-1177.084) (-1180.699) (-1181.547) * (-1181.137) [-1180.985] (-1180.950) (-1179.041) -- 0:00:43
      294500 -- (-1179.226) (-1177.179) (-1178.852) [-1179.315] * (-1180.190) [-1181.367] (-1178.573) (-1181.749) -- 0:00:45
      295000 -- [-1182.306] (-1177.515) (-1180.754) (-1179.859) * (-1187.799) (-1178.536) (-1181.206) [-1186.239] -- 0:00:45

      Average standard deviation of split frequencies: 0.011845

      295500 -- [-1181.174] (-1177.955) (-1180.188) (-1179.581) * (-1178.817) [-1178.545] (-1177.773) (-1180.990) -- 0:00:45
      296000 -- [-1184.126] (-1179.727) (-1178.790) (-1182.521) * (-1178.655) (-1177.589) [-1179.103] (-1178.582) -- 0:00:45
      296500 -- (-1180.916) [-1179.592] (-1177.948) (-1179.000) * [-1178.029] (-1179.840) (-1181.005) (-1183.405) -- 0:00:45
      297000 -- (-1180.005) (-1181.950) (-1182.256) [-1179.104] * (-1178.029) [-1182.234] (-1180.054) (-1182.237) -- 0:00:44
      297500 -- (-1178.679) (-1182.164) [-1179.434] (-1178.518) * (-1177.612) [-1180.678] (-1181.280) (-1179.026) -- 0:00:44
      298000 -- (-1178.811) (-1179.732) [-1178.492] (-1179.703) * [-1178.408] (-1179.053) (-1178.262) (-1178.935) -- 0:00:44
      298500 -- (-1178.360) (-1180.544) [-1182.978] (-1179.687) * (-1177.274) (-1177.785) (-1181.059) [-1178.854] -- 0:00:44
      299000 -- (-1179.921) (-1178.589) [-1177.560] (-1182.265) * [-1179.899] (-1181.393) (-1180.524) (-1180.558) -- 0:00:44
      299500 -- [-1179.195] (-1178.638) (-1181.811) (-1179.356) * (-1178.382) (-1181.757) [-1178.360] (-1180.264) -- 0:00:44
      300000 -- (-1177.670) (-1181.751) [-1179.085] (-1178.502) * (-1178.831) (-1184.278) (-1177.325) [-1179.943] -- 0:00:44

      Average standard deviation of split frequencies: 0.012739

      300500 -- [-1177.824] (-1178.386) (-1178.625) (-1180.149) * [-1177.113] (-1182.307) (-1177.542) (-1180.929) -- 0:00:44
      301000 -- (-1177.792) [-1178.157] (-1180.852) (-1178.911) * (-1177.546) (-1180.227) [-1182.920] (-1180.011) -- 0:00:44
      301500 -- [-1179.222] (-1179.024) (-1182.595) (-1180.316) * [-1177.487] (-1178.545) (-1183.454) (-1179.481) -- 0:00:44
      302000 -- [-1179.682] (-1177.541) (-1178.045) (-1178.006) * (-1177.418) [-1177.502] (-1181.822) (-1177.992) -- 0:00:43
      302500 -- [-1183.459] (-1177.153) (-1178.783) (-1177.789) * (-1177.436) (-1177.503) (-1178.422) [-1179.331] -- 0:00:43
      303000 -- (-1179.292) (-1179.478) (-1177.984) [-1178.547] * (-1177.274) (-1183.598) (-1179.199) [-1177.661] -- 0:00:43
      303500 -- (-1178.684) (-1182.482) (-1177.341) [-1178.992] * (-1177.510) (-1176.929) [-1182.215] (-1180.169) -- 0:00:43
      304000 -- (-1177.848) (-1178.107) [-1177.208] (-1178.486) * (-1179.915) (-1178.554) (-1180.478) [-1182.169] -- 0:00:43
      304500 -- (-1178.786) [-1178.168] (-1182.085) (-1180.399) * (-1177.973) [-1177.577] (-1181.881) (-1182.055) -- 0:00:43
      305000 -- (-1179.659) (-1177.972) [-1178.652] (-1181.577) * (-1177.635) (-1179.458) (-1180.945) [-1179.529] -- 0:00:43

      Average standard deviation of split frequencies: 0.012998

      305500 -- (-1183.310) (-1179.148) [-1180.284] (-1180.016) * (-1178.996) [-1177.945] (-1180.985) (-1179.190) -- 0:00:43
      306000 -- [-1181.497] (-1180.913) (-1182.085) (-1180.328) * (-1180.020) (-1179.383) [-1182.038] (-1177.641) -- 0:00:43
      306500 -- (-1178.139) (-1179.062) [-1182.129] (-1179.622) * (-1182.097) (-1178.626) (-1178.615) [-1177.787] -- 0:00:42
      307000 -- (-1178.375) [-1178.539] (-1180.299) (-1177.909) * (-1182.342) (-1178.853) (-1180.201) [-1179.349] -- 0:00:42
      307500 -- [-1179.103] (-1177.182) (-1177.134) (-1178.575) * (-1180.724) (-1177.548) (-1181.051) [-1178.688] -- 0:00:42
      308000 -- (-1178.076) (-1176.935) [-1184.301] (-1181.578) * (-1187.752) (-1179.145) (-1180.152) [-1178.998] -- 0:00:42
      308500 -- [-1177.496] (-1177.022) (-1181.276) (-1179.175) * (-1184.463) [-1178.305] (-1180.283) (-1178.387) -- 0:00:42
      309000 -- [-1178.984] (-1181.196) (-1178.663) (-1182.473) * [-1179.095] (-1179.470) (-1188.397) (-1178.641) -- 0:00:42
      309500 -- (-1180.683) (-1177.949) (-1180.377) [-1178.434] * (-1179.287) [-1181.820] (-1180.864) (-1178.065) -- 0:00:42
      310000 -- (-1182.571) (-1177.659) (-1177.851) [-1179.895] * (-1178.443) (-1183.976) [-1183.610] (-1178.376) -- 0:00:42

      Average standard deviation of split frequencies: 0.013182

      310500 -- (-1184.386) [-1177.276] (-1178.187) (-1180.325) * (-1177.467) [-1178.352] (-1181.660) (-1179.276) -- 0:00:44
      311000 -- (-1178.292) [-1177.008] (-1178.850) (-1180.588) * [-1178.859] (-1177.572) (-1180.213) (-1179.047) -- 0:00:44
      311500 -- (-1177.531) [-1178.260] (-1178.645) (-1178.897) * (-1177.491) [-1177.155] (-1178.113) (-1179.383) -- 0:00:44
      312000 -- [-1178.374] (-1181.562) (-1182.424) (-1182.433) * (-1180.816) (-1183.550) [-1178.085] (-1180.622) -- 0:00:44
      312500 -- (-1177.596) (-1179.518) (-1178.931) [-1179.041] * [-1180.606] (-1180.164) (-1181.153) (-1181.912) -- 0:00:44
      313000 -- (-1177.426) (-1180.049) [-1184.854] (-1179.660) * [-1179.406] (-1179.862) (-1180.525) (-1178.479) -- 0:00:43
      313500 -- (-1177.534) [-1179.418] (-1178.077) (-1178.386) * [-1181.338] (-1177.759) (-1177.574) (-1180.403) -- 0:00:43
      314000 -- [-1178.239] (-1180.079) (-1178.360) (-1179.051) * (-1180.232) (-1179.520) (-1180.859) [-1178.670] -- 0:00:43
      314500 -- (-1179.241) [-1179.907] (-1178.511) (-1183.512) * (-1178.907) (-1179.434) [-1181.384] (-1178.564) -- 0:00:43
      315000 -- [-1178.648] (-1178.286) (-1180.407) (-1180.805) * (-1178.816) (-1180.804) (-1178.663) [-1177.233] -- 0:00:43

      Average standard deviation of split frequencies: 0.012494

      315500 -- (-1181.291) [-1179.615] (-1178.550) (-1181.769) * (-1177.911) (-1179.843) (-1179.897) [-1177.373] -- 0:00:43
      316000 -- (-1181.020) (-1178.603) [-1185.160] (-1179.309) * (-1177.599) (-1177.558) [-1178.323] (-1177.331) -- 0:00:43
      316500 -- (-1179.392) (-1179.133) (-1180.328) [-1177.584] * [-1179.214] (-1178.211) (-1179.119) (-1182.115) -- 0:00:43
      317000 -- (-1182.509) (-1179.832) (-1180.728) [-1177.584] * (-1184.084) (-1177.481) (-1177.565) [-1180.019] -- 0:00:43
      317500 -- (-1183.077) (-1185.208) [-1177.933] (-1177.944) * [-1185.234] (-1178.923) (-1180.438) (-1181.606) -- 0:00:42
      318000 -- (-1184.249) (-1184.944) (-1182.870) [-1177.358] * (-1177.788) (-1178.723) [-1180.801] (-1178.763) -- 0:00:42
      318500 -- (-1183.132) [-1182.241] (-1178.123) (-1179.224) * (-1177.619) [-1179.590] (-1180.532) (-1179.375) -- 0:00:42
      319000 -- (-1180.993) (-1181.942) [-1178.126] (-1178.788) * (-1178.597) (-1181.311) (-1179.193) [-1177.240] -- 0:00:42
      319500 -- (-1183.053) [-1181.225] (-1178.815) (-1181.589) * (-1180.181) (-1179.120) (-1179.997) [-1177.463] -- 0:00:42
      320000 -- (-1183.459) [-1177.408] (-1177.478) (-1181.972) * [-1178.145] (-1185.347) (-1181.707) (-1180.555) -- 0:00:42

      Average standard deviation of split frequencies: 0.013323

      320500 -- (-1180.998) (-1181.459) [-1181.193] (-1181.648) * [-1179.307] (-1181.490) (-1180.377) (-1179.834) -- 0:00:42
      321000 -- (-1179.741) (-1181.268) (-1181.649) [-1177.241] * (-1179.861) [-1181.050] (-1179.090) (-1179.219) -- 0:00:42
      321500 -- [-1181.724] (-1179.958) (-1180.783) (-1177.893) * [-1179.229] (-1179.902) (-1181.872) (-1178.643) -- 0:00:42
      322000 -- (-1182.286) [-1179.380] (-1179.860) (-1179.993) * (-1179.171) (-1179.243) [-1178.547] (-1181.613) -- 0:00:42
      322500 -- (-1181.449) (-1180.269) [-1180.570] (-1179.516) * (-1182.791) [-1178.336] (-1180.489) (-1179.812) -- 0:00:42
      323000 -- (-1184.566) [-1177.931] (-1178.644) (-1180.384) * (-1179.221) (-1181.172) [-1180.649] (-1179.204) -- 0:00:41
      323500 -- (-1183.562) (-1177.854) [-1181.225] (-1179.773) * (-1182.403) [-1180.251] (-1177.836) (-1180.173) -- 0:00:41
      324000 -- (-1181.312) (-1180.620) [-1182.532] (-1179.832) * (-1180.758) (-1181.590) (-1182.245) [-1177.960] -- 0:00:41
      324500 -- (-1178.146) (-1178.553) [-1180.453] (-1177.536) * [-1181.390] (-1182.821) (-1180.607) (-1178.981) -- 0:00:41
      325000 -- (-1178.546) (-1181.275) (-1181.417) [-1177.112] * (-1179.105) [-1181.476] (-1179.472) (-1180.325) -- 0:00:41

      Average standard deviation of split frequencies: 0.013195

      325500 -- (-1178.322) (-1181.235) (-1179.516) [-1179.581] * [-1179.116] (-1179.614) (-1178.663) (-1178.073) -- 0:00:41
      326000 -- (-1179.040) (-1178.291) (-1181.299) [-1177.523] * (-1181.306) (-1179.710) [-1179.373] (-1177.491) -- 0:00:41
      326500 -- (-1181.542) (-1179.965) [-1181.104] (-1178.008) * (-1180.185) (-1178.117) [-1177.842] (-1178.219) -- 0:00:41
      327000 -- (-1178.296) (-1178.476) (-1181.520) [-1178.005] * [-1177.997] (-1177.438) (-1177.172) (-1178.588) -- 0:00:43
      327500 -- [-1178.943] (-1177.331) (-1178.029) (-1177.841) * (-1178.690) [-1180.903] (-1177.576) (-1178.552) -- 0:00:43
      328000 -- (-1179.087) (-1182.920) (-1178.630) [-1178.668] * (-1179.789) [-1179.261] (-1178.233) (-1180.565) -- 0:00:43
      328500 -- (-1177.625) (-1179.655) [-1178.249] (-1179.775) * (-1178.321) (-1179.428) (-1177.610) [-1178.753] -- 0:00:42
      329000 -- (-1180.304) (-1177.771) [-1178.551] (-1179.587) * (-1178.278) (-1178.187) [-1178.856] (-1177.734) -- 0:00:42
      329500 -- (-1180.473) (-1177.930) (-1181.797) [-1178.822] * (-1177.468) (-1179.775) [-1182.564] (-1182.267) -- 0:00:42
      330000 -- (-1180.229) [-1178.936] (-1179.763) (-1183.249) * (-1180.740) (-1177.481) [-1179.494] (-1183.348) -- 0:00:42

      Average standard deviation of split frequencies: 0.012652

      330500 -- (-1178.545) [-1178.531] (-1180.765) (-1184.012) * (-1183.170) [-1177.406] (-1179.586) (-1181.204) -- 0:00:42
      331000 -- (-1182.764) (-1180.666) (-1182.312) [-1178.449] * (-1180.878) [-1177.793] (-1180.207) (-1181.661) -- 0:00:42
      331500 -- (-1181.422) [-1179.680] (-1179.711) (-1178.009) * [-1178.975] (-1179.744) (-1179.841) (-1180.093) -- 0:00:42
      332000 -- (-1179.265) (-1177.261) [-1179.122] (-1178.028) * [-1179.020] (-1179.748) (-1178.941) (-1177.793) -- 0:00:42
      332500 -- (-1181.979) [-1177.132] (-1183.011) (-1178.816) * (-1182.166) (-1181.677) (-1179.236) [-1178.141] -- 0:00:42
      333000 -- (-1179.816) (-1177.881) [-1178.581] (-1178.764) * (-1179.358) (-1178.353) [-1179.201] (-1178.104) -- 0:00:42
      333500 -- [-1179.399] (-1178.658) (-1180.806) (-1182.005) * (-1180.272) (-1180.920) (-1181.810) [-1177.602] -- 0:00:41
      334000 -- [-1180.474] (-1178.537) (-1180.279) (-1177.808) * (-1181.888) (-1182.193) [-1179.011] (-1179.316) -- 0:00:41
      334500 -- (-1179.001) [-1179.654] (-1179.012) (-1180.770) * [-1183.944] (-1177.789) (-1182.054) (-1182.484) -- 0:00:41
      335000 -- (-1182.711) [-1178.758] (-1179.086) (-1179.550) * (-1181.850) (-1179.510) (-1179.148) [-1178.770] -- 0:00:41

      Average standard deviation of split frequencies: 0.012715

      335500 -- (-1180.940) (-1178.147) (-1179.382) [-1178.813] * [-1178.432] (-1181.242) (-1180.872) (-1181.582) -- 0:00:41
      336000 -- (-1184.997) [-1179.659] (-1179.385) (-1179.184) * (-1182.299) (-1180.993) (-1182.940) [-1180.584] -- 0:00:41
      336500 -- [-1183.542] (-1179.315) (-1178.803) (-1180.386) * (-1184.749) (-1181.053) (-1181.087) [-1181.596] -- 0:00:41
      337000 -- (-1179.001) (-1179.586) (-1179.024) [-1178.232] * (-1178.394) (-1177.753) [-1181.780] (-1179.208) -- 0:00:41
      337500 -- (-1179.291) (-1177.776) (-1180.416) [-1178.127] * (-1181.451) [-1182.814] (-1180.262) (-1179.855) -- 0:00:41
      338000 -- (-1182.445) (-1177.519) (-1179.193) [-1182.420] * [-1182.460] (-1183.358) (-1179.719) (-1178.504) -- 0:00:41
      338500 -- (-1179.174) (-1179.048) (-1179.150) [-1179.217] * (-1184.940) (-1180.627) (-1177.987) [-1181.394] -- 0:00:41
      339000 -- (-1179.872) [-1179.589] (-1179.166) (-1178.435) * (-1179.676) [-1179.809] (-1178.967) (-1182.166) -- 0:00:40
      339500 -- (-1182.274) [-1177.609] (-1177.930) (-1177.841) * (-1177.142) (-1179.632) [-1182.109] (-1179.629) -- 0:00:40
      340000 -- (-1180.160) (-1180.081) (-1178.905) [-1179.506] * [-1183.973] (-1181.722) (-1184.105) (-1179.434) -- 0:00:40

      Average standard deviation of split frequencies: 0.012540

      340500 -- (-1179.060) [-1181.149] (-1179.080) (-1180.019) * (-1182.051) (-1181.281) (-1181.487) [-1177.671] -- 0:00:40
      341000 -- (-1179.671) (-1179.800) (-1180.331) [-1178.215] * (-1179.370) [-1178.143] (-1179.056) (-1178.025) -- 0:00:40
      341500 -- (-1179.153) (-1179.097) [-1178.891] (-1179.313) * (-1179.363) [-1179.601] (-1178.526) (-1177.378) -- 0:00:40
      342000 -- (-1178.224) (-1177.883) [-1178.864] (-1180.104) * (-1180.333) (-1179.785) [-1177.433] (-1178.075) -- 0:00:40
      342500 -- (-1178.102) [-1185.640] (-1179.379) (-1178.504) * (-1183.909) (-1182.287) (-1177.963) [-1178.829] -- 0:00:40
      343000 -- (-1177.348) (-1179.051) (-1178.740) [-1178.768] * (-1179.397) (-1183.217) [-1177.194] (-1179.421) -- 0:00:42
      343500 -- [-1177.132] (-1178.614) (-1178.654) (-1178.753) * (-1179.826) (-1181.291) [-1178.961] (-1186.515) -- 0:00:42
      344000 -- (-1179.548) (-1179.534) [-1180.635] (-1179.556) * [-1179.129] (-1182.089) (-1179.221) (-1183.541) -- 0:00:41
      344500 -- (-1179.471) (-1179.424) [-1180.632] (-1177.587) * (-1180.602) (-1177.492) [-1180.540] (-1178.776) -- 0:00:41
      345000 -- (-1177.932) [-1178.749] (-1179.343) (-1178.846) * (-1180.251) (-1177.276) [-1179.494] (-1178.085) -- 0:00:41

      Average standard deviation of split frequencies: 0.013199

      345500 -- [-1177.783] (-1178.611) (-1178.848) (-1177.669) * (-1180.845) [-1177.450] (-1179.033) (-1177.588) -- 0:00:41
      346000 -- (-1178.040) (-1179.714) [-1178.365] (-1177.317) * (-1178.435) (-1179.146) (-1178.375) [-1181.448] -- 0:00:41
      346500 -- (-1179.122) (-1184.151) (-1178.198) [-1177.310] * [-1177.992] (-1177.732) (-1181.747) (-1181.247) -- 0:00:41
      347000 -- (-1178.950) [-1179.247] (-1179.572) (-1177.446) * [-1179.979] (-1179.627) (-1178.371) (-1182.526) -- 0:00:41
      347500 -- (-1178.869) (-1177.628) (-1183.417) [-1179.552] * (-1179.206) (-1177.414) [-1178.216] (-1177.960) -- 0:00:41
      348000 -- (-1181.566) (-1178.157) (-1181.681) [-1180.972] * (-1179.599) (-1177.434) (-1178.483) [-1178.195] -- 0:00:41
      348500 -- (-1180.243) [-1179.755] (-1179.899) (-1178.917) * (-1184.916) [-1181.780] (-1181.939) (-1179.350) -- 0:00:41
      349000 -- (-1177.868) (-1182.171) (-1177.768) [-1177.543] * [-1179.990] (-1178.574) (-1178.380) (-1179.210) -- 0:00:41
      349500 -- [-1178.077] (-1182.687) (-1177.939) (-1182.239) * (-1178.632) [-1180.575] (-1179.905) (-1178.891) -- 0:00:40
      350000 -- (-1177.871) (-1182.124) [-1177.619] (-1181.309) * (-1178.501) (-1180.719) [-1179.310] (-1180.381) -- 0:00:40

      Average standard deviation of split frequencies: 0.012731

      350500 -- (-1177.967) (-1179.859) [-1177.972] (-1182.175) * (-1179.904) [-1179.741] (-1179.790) (-1179.789) -- 0:00:40
      351000 -- (-1178.635) [-1179.747] (-1179.520) (-1182.862) * (-1179.893) (-1181.639) [-1177.999] (-1178.325) -- 0:00:40
      351500 -- [-1177.611] (-1177.492) (-1181.530) (-1179.517) * [-1180.239] (-1182.033) (-1177.360) (-1178.698) -- 0:00:40
      352000 -- (-1178.734) [-1177.420] (-1177.729) (-1178.907) * [-1179.575] (-1180.392) (-1179.830) (-1178.597) -- 0:00:40
      352500 -- (-1179.388) (-1177.700) (-1177.094) [-1180.595] * (-1179.774) (-1177.777) (-1179.355) [-1179.120] -- 0:00:40
      353000 -- [-1190.994] (-1182.402) (-1176.993) (-1179.719) * (-1178.752) (-1178.366) (-1182.142) [-1180.197] -- 0:00:40
      353500 -- (-1183.249) (-1181.366) (-1178.162) [-1177.937] * (-1179.057) (-1179.254) (-1186.134) [-1180.072] -- 0:00:40
      354000 -- (-1182.275) (-1177.972) (-1178.289) [-1180.550] * (-1179.028) [-1179.546] (-1181.573) (-1178.191) -- 0:00:40
      354500 -- [-1179.627] (-1177.744) (-1180.471) (-1177.694) * (-1178.986) (-1180.970) [-1180.318] (-1179.859) -- 0:00:40
      355000 -- (-1178.207) (-1177.757) [-1177.392] (-1177.351) * [-1179.417] (-1181.402) (-1179.028) (-1178.231) -- 0:00:39

      Average standard deviation of split frequencies: 0.013904

      355500 -- (-1178.062) (-1179.961) (-1179.021) [-1181.663] * (-1180.265) (-1182.918) (-1179.082) [-1177.517] -- 0:00:39
      356000 -- (-1177.772) (-1178.430) [-1177.717] (-1178.886) * (-1177.877) (-1187.546) [-1179.649] (-1178.154) -- 0:00:39
      356500 -- (-1178.220) (-1178.506) (-1181.453) [-1182.029] * [-1178.077] (-1182.429) (-1179.555) (-1179.269) -- 0:00:39
      357000 -- (-1180.616) (-1185.949) [-1180.127] (-1180.133) * (-1177.236) [-1177.431] (-1180.723) (-1179.582) -- 0:00:39
      357500 -- (-1180.701) (-1180.591) (-1178.651) [-1179.162] * (-1181.181) [-1178.317] (-1178.205) (-1178.669) -- 0:00:41
      358000 -- (-1180.835) [-1178.667] (-1183.317) (-1181.349) * (-1179.802) [-1176.960] (-1180.491) (-1178.696) -- 0:00:41
      358500 -- (-1184.763) [-1178.208] (-1178.733) (-1180.185) * [-1179.501] (-1179.615) (-1180.207) (-1182.483) -- 0:00:41
      359000 -- (-1179.371) (-1179.328) [-1178.121] (-1177.896) * (-1182.558) (-1182.322) [-1178.422] (-1179.374) -- 0:00:41
      359500 -- (-1183.529) [-1177.850] (-1178.012) (-1178.486) * [-1180.043] (-1179.098) (-1181.949) (-1179.769) -- 0:00:40
      360000 -- (-1177.045) (-1181.750) [-1179.985] (-1178.430) * (-1178.983) [-1179.920] (-1178.873) (-1181.190) -- 0:00:40

      Average standard deviation of split frequencies: 0.013397

      360500 -- (-1177.682) (-1182.766) [-1179.660] (-1182.652) * [-1178.150] (-1181.209) (-1178.690) (-1179.943) -- 0:00:40
      361000 -- [-1179.750] (-1179.247) (-1182.030) (-1178.871) * (-1183.547) [-1180.290] (-1179.808) (-1178.949) -- 0:00:40
      361500 -- (-1184.559) (-1181.585) [-1179.425] (-1180.814) * [-1184.427] (-1179.991) (-1180.670) (-1182.023) -- 0:00:40
      362000 -- [-1179.241] (-1181.295) (-1179.650) (-1178.295) * (-1181.828) (-1180.179) (-1184.121) [-1182.114] -- 0:00:40
      362500 -- [-1179.058] (-1178.200) (-1178.382) (-1179.429) * [-1180.046] (-1179.262) (-1179.013) (-1182.912) -- 0:00:40
      363000 -- [-1177.880] (-1179.146) (-1181.829) (-1179.068) * [-1180.256] (-1178.441) (-1177.556) (-1181.513) -- 0:00:40
      363500 -- [-1177.730] (-1178.138) (-1179.319) (-1178.173) * (-1179.100) [-1177.626] (-1177.873) (-1186.446) -- 0:00:40
      364000 -- [-1179.123] (-1181.172) (-1182.011) (-1180.330) * (-1179.424) (-1178.111) [-1178.417] (-1181.238) -- 0:00:40
      364500 -- (-1180.837) (-1178.906) [-1181.103] (-1179.414) * [-1179.022] (-1183.444) (-1179.860) (-1181.925) -- 0:00:40
      365000 -- (-1181.145) [-1177.974] (-1179.310) (-1179.040) * [-1178.554] (-1182.180) (-1178.878) (-1179.158) -- 0:00:40

      Average standard deviation of split frequencies: 0.013604

      365500 -- (-1183.129) [-1177.746] (-1180.678) (-1178.123) * (-1181.447) [-1177.408] (-1181.403) (-1177.701) -- 0:00:39
      366000 -- (-1179.451) (-1177.634) [-1179.970] (-1181.650) * [-1179.185] (-1178.549) (-1183.641) (-1179.371) -- 0:00:39
      366500 -- [-1181.554] (-1183.338) (-1179.295) (-1180.562) * (-1177.518) (-1178.467) (-1181.147) [-1177.293] -- 0:00:39
      367000 -- (-1178.203) [-1180.677] (-1182.042) (-1181.320) * [-1178.243] (-1179.289) (-1179.526) (-1176.902) -- 0:00:39
      367500 -- (-1178.867) (-1181.556) [-1180.373] (-1180.100) * (-1179.825) (-1180.587) [-1178.407] (-1179.673) -- 0:00:39
      368000 -- [-1180.388] (-1178.992) (-1180.277) (-1181.485) * (-1178.179) (-1180.859) [-1180.273] (-1177.698) -- 0:00:39
      368500 -- [-1177.836] (-1179.705) (-1181.608) (-1187.539) * [-1177.871] (-1178.227) (-1178.618) (-1177.059) -- 0:00:39
      369000 -- (-1178.779) [-1179.605] (-1183.947) (-1186.221) * (-1178.431) (-1177.885) (-1178.118) [-1181.004] -- 0:00:39
      369500 -- (-1179.789) (-1178.298) [-1182.155] (-1181.919) * [-1180.152] (-1180.521) (-1180.195) (-1178.351) -- 0:00:39
      370000 -- (-1178.976) (-1179.323) [-1179.489] (-1182.470) * (-1179.530) (-1179.377) (-1178.120) [-1177.574] -- 0:00:39

      Average standard deviation of split frequencies: 0.013433

      370500 -- [-1177.807] (-1182.904) (-1178.061) (-1182.041) * (-1177.471) [-1180.305] (-1178.147) (-1179.580) -- 0:00:39
      371000 -- (-1181.594) [-1178.159] (-1179.218) (-1185.034) * [-1181.313] (-1179.883) (-1180.736) (-1178.801) -- 0:00:38
      371500 -- (-1179.426) [-1179.389] (-1177.143) (-1184.784) * (-1179.033) (-1179.676) (-1177.894) [-1178.785] -- 0:00:38
      372000 -- (-1178.285) (-1177.856) [-1178.203] (-1177.013) * [-1177.623] (-1181.140) (-1182.016) (-1178.032) -- 0:00:38
      372500 -- [-1177.532] (-1177.898) (-1178.450) (-1177.478) * [-1180.069] (-1179.882) (-1184.047) (-1179.800) -- 0:00:38
      373000 -- (-1177.153) [-1178.902] (-1177.934) (-1182.120) * (-1179.340) (-1181.577) [-1178.337] (-1179.517) -- 0:00:38
      373500 -- (-1181.388) (-1180.619) (-1179.010) [-1178.867] * [-1181.782] (-1180.868) (-1179.229) (-1178.644) -- 0:00:38
      374000 -- (-1179.858) (-1181.286) [-1178.097] (-1180.870) * (-1177.637) [-1178.462] (-1179.110) (-1177.638) -- 0:00:40
      374500 -- (-1179.229) [-1177.293] (-1180.144) (-1179.668) * (-1177.669) (-1177.255) (-1179.448) [-1177.564] -- 0:00:40
      375000 -- [-1177.767] (-1178.621) (-1179.889) (-1184.019) * (-1179.338) [-1179.804] (-1180.972) (-1178.331) -- 0:00:40

      Average standard deviation of split frequencies: 0.013164

      375500 -- (-1180.475) (-1181.630) (-1177.982) [-1176.908] * (-1181.265) (-1178.305) (-1180.660) [-1180.129] -- 0:00:39
      376000 -- (-1182.808) (-1180.838) (-1178.031) [-1177.037] * (-1181.725) [-1179.170] (-1179.177) (-1181.630) -- 0:00:39
      376500 -- (-1179.942) [-1181.556] (-1177.623) (-1182.175) * (-1180.384) [-1178.639] (-1179.779) (-1183.040) -- 0:00:39
      377000 -- (-1178.888) [-1179.681] (-1180.866) (-1181.204) * [-1180.412] (-1181.087) (-1180.579) (-1181.353) -- 0:00:39
      377500 -- [-1177.480] (-1184.030) (-1179.593) (-1178.116) * (-1178.995) (-1178.231) (-1178.622) [-1177.729] -- 0:00:39
      378000 -- (-1178.018) (-1178.816) (-1181.225) [-1177.593] * (-1179.207) [-1177.963] (-1177.479) (-1178.248) -- 0:00:39
      378500 -- (-1177.809) (-1180.320) (-1178.391) [-1178.083] * (-1178.407) [-1177.969] (-1180.678) (-1179.025) -- 0:00:39
      379000 -- (-1179.558) (-1178.400) (-1180.857) [-1177.921] * (-1178.465) [-1178.221] (-1179.106) (-1179.440) -- 0:00:39
      379500 -- (-1180.313) [-1178.937] (-1180.105) (-1179.087) * (-1178.036) (-1178.249) (-1178.770) [-1181.243] -- 0:00:39
      380000 -- [-1180.616] (-1181.968) (-1179.791) (-1178.720) * (-1181.339) (-1178.190) [-1182.776] (-1180.401) -- 0:00:39

      Average standard deviation of split frequencies: 0.013158

      380500 -- (-1177.549) [-1178.770] (-1180.094) (-1178.276) * (-1179.678) (-1177.514) [-1180.879] (-1179.587) -- 0:00:39
      381000 -- (-1176.921) (-1180.742) [-1180.389] (-1178.290) * (-1180.396) [-1178.650] (-1179.145) (-1184.490) -- 0:00:38
      381500 -- (-1179.587) (-1178.677) (-1177.436) [-1178.843] * (-1182.684) (-1180.099) (-1183.240) [-1184.047] -- 0:00:38
      382000 -- (-1179.344) [-1179.888] (-1178.715) (-1179.380) * (-1181.850) (-1180.340) [-1178.045] (-1179.669) -- 0:00:38
      382500 -- [-1177.486] (-1179.191) (-1178.622) (-1177.395) * (-1179.963) (-1177.786) [-1178.418] (-1178.593) -- 0:00:38
      383000 -- (-1179.406) (-1179.086) (-1179.236) [-1179.512] * (-1183.723) [-1178.009] (-1185.440) (-1181.532) -- 0:00:38
      383500 -- [-1178.989] (-1178.790) (-1177.300) (-1180.241) * (-1178.790) (-1177.700) [-1178.605] (-1178.097) -- 0:00:38
      384000 -- (-1178.784) [-1178.303] (-1179.562) (-1178.431) * (-1178.606) (-1179.319) (-1183.138) [-1177.435] -- 0:00:38
      384500 -- (-1180.345) (-1181.210) (-1179.414) [-1178.006] * (-1180.276) (-1178.203) (-1178.894) [-1180.233] -- 0:00:38
      385000 -- (-1183.558) (-1177.707) [-1179.161] (-1178.067) * (-1182.492) (-1177.519) (-1178.519) [-1179.446] -- 0:00:38

      Average standard deviation of split frequencies: 0.013815

      385500 -- (-1179.070) (-1177.179) (-1184.589) [-1180.082] * [-1180.632] (-1177.989) (-1183.326) (-1179.496) -- 0:00:38
      386000 -- [-1179.618] (-1178.236) (-1179.808) (-1180.601) * (-1185.080) (-1178.386) (-1179.865) [-1178.856] -- 0:00:38
      386500 -- (-1179.089) (-1177.175) [-1179.138] (-1178.893) * (-1179.268) [-1179.230] (-1180.677) (-1179.039) -- 0:00:38
      387000 -- [-1177.731] (-1177.184) (-1178.070) (-1181.885) * [-1177.948] (-1179.912) (-1177.643) (-1179.257) -- 0:00:38
      387500 -- (-1180.922) (-1178.913) [-1177.871] (-1183.106) * (-1178.315) (-1178.595) (-1179.121) [-1178.183] -- 0:00:37
      388000 -- (-1178.867) [-1178.112] (-1177.371) (-1180.445) * (-1177.715) (-1179.309) (-1178.470) [-1178.738] -- 0:00:37
      388500 -- (-1179.019) [-1177.963] (-1179.670) (-1179.655) * (-1182.020) [-1178.484] (-1181.055) (-1180.643) -- 0:00:37
      389000 -- (-1180.114) (-1178.935) [-1180.091] (-1177.952) * [-1182.422] (-1178.484) (-1179.209) (-1178.521) -- 0:00:37
      389500 -- (-1179.172) (-1178.663) [-1180.294] (-1178.226) * (-1183.531) (-1180.386) [-1178.619] (-1179.440) -- 0:00:37
      390000 -- (-1180.514) (-1179.443) (-1180.077) [-1178.218] * (-1182.022) [-1178.954] (-1183.782) (-1183.009) -- 0:00:39

      Average standard deviation of split frequencies: 0.013123

      390500 -- (-1182.793) [-1180.575] (-1180.437) (-1177.300) * (-1178.728) (-1185.979) (-1182.669) [-1182.319] -- 0:00:39
      391000 -- (-1178.010) (-1179.499) (-1178.366) [-1178.218] * (-1180.659) [-1177.857] (-1180.286) (-1179.321) -- 0:00:38
      391500 -- (-1178.185) [-1179.343] (-1182.035) (-1177.701) * (-1178.288) (-1183.085) (-1181.395) [-1178.950] -- 0:00:38
      392000 -- (-1178.301) (-1178.929) [-1180.252] (-1177.898) * (-1181.493) (-1178.430) (-1182.097) [-1178.842] -- 0:00:38
      392500 -- (-1179.444) [-1178.810] (-1178.671) (-1178.265) * [-1181.692] (-1179.205) (-1180.822) (-1180.827) -- 0:00:38
      393000 -- (-1181.115) (-1177.560) [-1180.088] (-1178.155) * (-1179.697) (-1179.797) (-1180.622) [-1182.955] -- 0:00:38
      393500 -- (-1180.093) (-1178.815) [-1180.803] (-1177.651) * [-1178.456] (-1179.785) (-1179.890) (-1184.699) -- 0:00:38
      394000 -- (-1181.176) (-1179.718) (-1181.469) [-1178.104] * (-1179.713) [-1178.700] (-1181.341) (-1181.213) -- 0:00:38
      394500 -- [-1181.524] (-1179.487) (-1181.713) (-1178.468) * (-1179.372) (-1177.941) (-1181.648) [-1179.893] -- 0:00:38
      395000 -- (-1178.213) [-1180.853] (-1178.075) (-1179.221) * [-1178.313] (-1178.796) (-1178.897) (-1182.855) -- 0:00:38

      Average standard deviation of split frequencies: 0.013169

      395500 -- (-1178.804) [-1178.565] (-1177.719) (-1180.255) * (-1179.406) (-1178.298) (-1179.623) [-1178.375] -- 0:00:38
      396000 -- (-1179.043) (-1178.924) [-1177.560] (-1182.156) * [-1181.722] (-1178.296) (-1177.188) (-1178.877) -- 0:00:38
      396500 -- (-1180.793) [-1178.477] (-1180.387) (-1178.836) * (-1179.705) [-1178.043] (-1179.561) (-1180.712) -- 0:00:38
      397000 -- (-1180.844) (-1182.109) [-1179.974] (-1182.006) * [-1178.583] (-1179.451) (-1179.708) (-1179.696) -- 0:00:37
      397500 -- (-1178.408) [-1177.964] (-1178.343) (-1179.773) * (-1181.018) (-1179.158) (-1180.277) [-1179.668] -- 0:00:37
      398000 -- (-1178.538) [-1177.964] (-1181.380) (-1183.298) * (-1179.915) [-1180.149] (-1179.501) (-1178.291) -- 0:00:37
      398500 -- (-1180.355) (-1177.370) (-1180.749) [-1178.341] * (-1184.797) (-1177.585) (-1178.618) [-1179.343] -- 0:00:37
      399000 -- (-1178.011) (-1180.892) [-1181.474] (-1179.838) * (-1178.194) (-1177.718) (-1178.821) [-1177.434] -- 0:00:37
      399500 -- (-1180.641) [-1178.003] (-1182.893) (-1177.308) * (-1176.901) [-1177.960] (-1184.252) (-1178.215) -- 0:00:37
      400000 -- (-1181.025) [-1179.685] (-1178.854) (-1176.944) * (-1182.693) [-1181.158] (-1178.991) (-1176.991) -- 0:00:37

      Average standard deviation of split frequencies: 0.013457

      400500 -- [-1180.059] (-1178.528) (-1180.257) (-1178.262) * [-1182.008] (-1179.070) (-1179.518) (-1177.986) -- 0:00:37
      401000 -- (-1180.594) [-1177.276] (-1178.523) (-1180.612) * (-1177.880) [-1179.738] (-1180.211) (-1177.821) -- 0:00:37
      401500 -- (-1183.317) (-1177.277) [-1179.170] (-1179.851) * (-1180.319) (-1181.445) [-1178.229] (-1178.150) -- 0:00:37
      402000 -- (-1183.600) (-1177.827) [-1178.276] (-1178.067) * (-1180.712) (-1180.721) [-1178.443] (-1179.246) -- 0:00:37
      402500 -- (-1178.599) (-1180.777) (-1182.696) [-1178.080] * [-1180.411] (-1179.723) (-1177.914) (-1179.871) -- 0:00:37
      403000 -- (-1178.938) [-1180.778] (-1183.638) (-1184.002) * (-1179.829) [-1178.110] (-1177.912) (-1178.413) -- 0:00:37
      403500 -- [-1178.819] (-1181.016) (-1180.925) (-1186.582) * (-1179.862) [-1179.772] (-1177.346) (-1178.381) -- 0:00:36
      404000 -- (-1182.415) (-1182.761) [-1180.128] (-1179.230) * [-1179.604] (-1181.196) (-1179.382) (-1178.149) -- 0:00:36
      404500 -- (-1181.515) [-1179.723] (-1178.378) (-1179.521) * (-1180.006) (-1179.096) (-1179.748) [-1178.635] -- 0:00:36
      405000 -- [-1177.934] (-1182.284) (-1178.410) (-1179.885) * [-1178.098] (-1180.770) (-1179.387) (-1177.843) -- 0:00:36

      Average standard deviation of split frequencies: 0.014006

      405500 -- (-1183.046) (-1178.441) [-1177.677] (-1180.469) * (-1178.098) [-1184.504] (-1180.378) (-1179.197) -- 0:00:36
      406000 -- (-1179.093) [-1178.318] (-1177.387) (-1178.891) * (-1182.606) (-1180.547) (-1181.250) [-1180.224] -- 0:00:38
      406500 -- (-1179.183) (-1179.128) [-1179.249] (-1177.421) * [-1177.458] (-1180.142) (-1177.307) (-1184.906) -- 0:00:37
      407000 -- (-1179.086) [-1177.540] (-1176.966) (-1180.599) * (-1177.232) (-1181.445) [-1177.499] (-1183.676) -- 0:00:37
      407500 -- (-1178.112) (-1179.802) (-1176.966) [-1179.071] * (-1183.737) (-1181.721) (-1177.500) [-1183.845] -- 0:00:37
      408000 -- [-1178.853] (-1182.504) (-1177.854) (-1180.181) * [-1178.146] (-1177.883) (-1178.921) (-1179.306) -- 0:00:37
      408500 -- (-1179.497) (-1179.679) [-1178.182] (-1178.531) * (-1179.829) [-1179.867] (-1178.956) (-1178.507) -- 0:00:37
      409000 -- [-1178.845] (-1178.417) (-1181.121) (-1182.833) * [-1182.938] (-1178.858) (-1179.883) (-1178.712) -- 0:00:37
      409500 -- (-1181.469) (-1181.083) (-1177.614) [-1180.314] * (-1181.542) [-1178.984] (-1180.023) (-1178.495) -- 0:00:37
      410000 -- (-1180.267) [-1179.333] (-1180.354) (-1179.708) * (-1177.612) [-1177.803] (-1180.071) (-1177.414) -- 0:00:37

      Average standard deviation of split frequencies: 0.013201

      410500 -- (-1179.342) (-1178.601) [-1178.496] (-1178.813) * [-1178.476] (-1179.658) (-1177.710) (-1178.294) -- 0:00:37
      411000 -- (-1177.619) [-1177.860] (-1178.716) (-1180.436) * (-1182.820) (-1177.842) [-1178.279] (-1177.907) -- 0:00:37
      411500 -- [-1178.376] (-1177.951) (-1177.482) (-1178.911) * (-1180.063) (-1177.193) [-1177.103] (-1178.603) -- 0:00:37
      412000 -- (-1178.404) (-1179.641) [-1177.828] (-1177.696) * [-1177.701] (-1179.089) (-1178.423) (-1178.909) -- 0:00:37
      412500 -- (-1183.581) (-1179.514) [-1181.547] (-1182.019) * (-1179.357) (-1178.545) [-1179.741] (-1178.909) -- 0:00:37
      413000 -- (-1179.692) [-1179.464] (-1180.934) (-1180.880) * [-1179.161] (-1179.553) (-1178.678) (-1177.917) -- 0:00:36
      413500 -- (-1180.234) (-1179.018) (-1180.025) [-1177.361] * (-1177.974) (-1179.203) [-1178.769] (-1177.924) -- 0:00:36
      414000 -- (-1180.207) (-1179.698) (-1178.912) [-1177.406] * [-1177.782] (-1178.089) (-1182.026) (-1178.384) -- 0:00:36
      414500 -- (-1178.741) (-1178.579) [-1179.825] (-1184.947) * (-1177.911) (-1178.417) (-1178.719) [-1178.418] -- 0:00:36
      415000 -- [-1178.206] (-1179.223) (-1178.978) (-1180.522) * (-1179.204) [-1179.967] (-1178.950) (-1178.949) -- 0:00:36

      Average standard deviation of split frequencies: 0.011969

      415500 -- (-1180.363) (-1179.384) (-1179.266) [-1178.045] * (-1182.143) (-1180.056) (-1177.450) [-1179.769] -- 0:00:36
      416000 -- [-1178.580] (-1180.087) (-1178.832) (-1183.533) * (-1178.267) (-1179.672) [-1177.503] (-1182.527) -- 0:00:36
      416500 -- (-1177.920) (-1178.247) (-1180.042) [-1182.596] * (-1177.885) (-1178.649) [-1178.880] (-1178.860) -- 0:00:36
      417000 -- [-1178.128] (-1178.581) (-1180.616) (-1181.349) * (-1179.794) [-1177.665] (-1184.507) (-1179.954) -- 0:00:36
      417500 -- (-1177.728) (-1178.848) [-1181.927] (-1179.564) * [-1180.980] (-1177.667) (-1188.303) (-1179.322) -- 0:00:36
      418000 -- [-1177.689] (-1178.598) (-1180.632) (-1180.167) * [-1178.029] (-1177.616) (-1181.313) (-1179.083) -- 0:00:36
      418500 -- (-1180.939) (-1179.785) [-1180.808] (-1178.799) * (-1178.004) (-1182.377) (-1179.957) [-1178.170] -- 0:00:36
      419000 -- (-1180.949) [-1179.315] (-1180.166) (-1181.520) * (-1178.867) [-1181.200] (-1178.498) (-1177.413) -- 0:00:36
      419500 -- (-1177.765) [-1179.315] (-1177.789) (-1181.484) * (-1181.195) (-1178.965) (-1177.515) [-1177.299] -- 0:00:35
      420000 -- (-1178.006) (-1185.569) [-1177.776] (-1182.665) * (-1178.890) (-1179.512) [-1182.993] (-1179.343) -- 0:00:35

      Average standard deviation of split frequencies: 0.011556

      420500 -- (-1177.488) (-1179.779) [-1183.679] (-1178.030) * [-1179.879] (-1178.239) (-1182.008) (-1179.836) -- 0:00:35
      421000 -- (-1179.333) (-1180.166) (-1178.451) [-1177.992] * (-1177.880) [-1177.839] (-1179.968) (-1178.903) -- 0:00:35
      421500 -- [-1178.309] (-1181.764) (-1183.889) (-1178.012) * (-1179.916) (-1177.929) [-1178.069] (-1181.461) -- 0:00:35
      422000 -- (-1178.308) (-1178.679) (-1180.230) [-1179.485] * (-1184.048) (-1180.809) (-1181.536) [-1180.156] -- 0:00:36
      422500 -- (-1180.050) (-1177.521) [-1180.960] (-1181.653) * (-1180.629) (-1179.409) [-1179.925] (-1180.344) -- 0:00:36
      423000 -- [-1177.547] (-1177.960) (-1181.052) (-1185.085) * (-1179.043) (-1180.085) [-1178.541] (-1179.853) -- 0:00:36
      423500 -- (-1178.628) (-1181.249) [-1178.287] (-1185.073) * (-1180.055) (-1177.843) (-1179.483) [-1180.055] -- 0:00:36
      424000 -- (-1179.506) (-1180.248) [-1177.803] (-1180.614) * [-1180.201] (-1181.923) (-1187.278) (-1180.445) -- 0:00:36
      424500 -- (-1178.406) (-1181.207) (-1181.501) [-1180.430] * [-1177.675] (-1178.558) (-1180.582) (-1179.570) -- 0:00:36
      425000 -- (-1181.462) (-1180.095) (-1182.145) [-1178.551] * (-1177.666) (-1180.909) (-1181.679) [-1177.497] -- 0:00:36

      Average standard deviation of split frequencies: 0.011965

      425500 -- (-1177.251) [-1179.121] (-1184.964) (-1180.943) * (-1179.528) (-1180.494) (-1178.798) [-1178.646] -- 0:00:36
      426000 -- (-1178.733) (-1177.495) [-1180.020] (-1178.222) * (-1179.528) (-1178.934) (-1178.484) [-1178.903] -- 0:00:36
      426500 -- (-1183.300) [-1179.383] (-1182.371) (-1177.780) * (-1178.924) (-1179.076) (-1184.696) [-1179.691] -- 0:00:36
      427000 -- (-1181.929) (-1177.633) (-1182.014) [-1179.354] * (-1177.572) [-1177.658] (-1180.131) (-1177.739) -- 0:00:36
      427500 -- (-1181.194) (-1180.687) (-1182.099) [-1178.528] * (-1178.358) (-1181.592) (-1182.019) [-1177.834] -- 0:00:36
      428000 -- (-1181.268) (-1177.582) [-1178.318] (-1179.056) * (-1178.999) [-1182.396] (-1181.321) (-1180.953) -- 0:00:36
      428500 -- (-1180.833) (-1180.496) (-1185.887) [-1179.130] * (-1177.215) (-1178.252) (-1178.423) [-1179.458] -- 0:00:36
      429000 -- (-1179.578) [-1178.197] (-1184.098) (-1179.473) * (-1181.369) (-1181.513) [-1180.072] (-1180.004) -- 0:00:35
      429500 -- (-1178.776) [-1179.463] (-1185.464) (-1182.373) * (-1177.913) [-1177.877] (-1178.309) (-1178.250) -- 0:00:35
      430000 -- (-1181.742) (-1181.457) [-1183.453] (-1180.725) * (-1178.622) (-1177.986) (-1181.734) [-1180.219] -- 0:00:35

      Average standard deviation of split frequencies: 0.010878

      430500 -- (-1184.277) (-1177.508) (-1184.296) [-1182.626] * [-1178.954] (-1181.769) (-1180.142) (-1182.129) -- 0:00:35
      431000 -- (-1178.589) (-1179.330) (-1183.222) [-1181.609] * (-1183.814) (-1184.424) (-1177.863) [-1179.933] -- 0:00:35
      431500 -- (-1179.393) (-1179.324) [-1178.562] (-1181.181) * (-1180.640) (-1177.779) [-1178.670] (-1179.228) -- 0:00:35
      432000 -- [-1177.803] (-1178.147) (-1178.542) (-1178.631) * (-1181.043) [-1178.357] (-1179.797) (-1179.870) -- 0:00:35
      432500 -- (-1179.316) (-1180.210) (-1180.097) [-1178.630] * (-1185.304) (-1183.403) (-1177.922) [-1179.786] -- 0:00:35
      433000 -- (-1179.780) (-1178.644) (-1179.090) [-1178.381] * (-1180.134) [-1179.385] (-1178.615) (-1177.821) -- 0:00:35
      433500 -- (-1180.485) [-1180.603] (-1177.342) (-1181.053) * (-1179.281) (-1182.366) (-1177.194) [-1178.580] -- 0:00:35
      434000 -- (-1180.600) (-1181.391) [-1177.342] (-1179.661) * (-1179.305) [-1178.470] (-1181.908) (-1178.325) -- 0:00:35
      434500 -- (-1181.097) (-1180.382) [-1177.499] (-1180.584) * [-1180.707] (-1183.878) (-1181.061) (-1180.461) -- 0:00:35
      435000 -- (-1179.502) [-1182.175] (-1177.444) (-1179.636) * (-1180.290) [-1178.808] (-1185.111) (-1178.730) -- 0:00:35

      Average standard deviation of split frequencies: 0.010812

      435500 -- [-1180.371] (-1183.526) (-1177.190) (-1178.847) * (-1178.725) (-1178.141) [-1182.434] (-1178.077) -- 0:00:34
      436000 -- (-1181.280) (-1182.038) [-1179.924] (-1179.189) * [-1179.545] (-1179.036) (-1178.245) (-1177.702) -- 0:00:34
      436500 -- (-1180.082) [-1180.520] (-1177.132) (-1181.587) * (-1178.095) (-1179.462) (-1177.675) [-1177.297] -- 0:00:34
      437000 -- (-1177.369) [-1178.037] (-1179.991) (-1179.059) * [-1178.203] (-1178.155) (-1180.944) (-1178.699) -- 0:00:34
      437500 -- (-1182.026) [-1184.084] (-1180.559) (-1177.876) * (-1178.109) (-1179.529) [-1178.959] (-1179.038) -- 0:00:34
      438000 -- (-1177.375) (-1178.655) (-1178.384) [-1179.041] * (-1179.411) (-1179.874) [-1179.049] (-1183.743) -- 0:00:34
      438500 -- [-1180.412] (-1180.365) (-1178.992) (-1179.041) * (-1178.756) [-1177.542] (-1177.388) (-1178.515) -- 0:00:35
      439000 -- (-1182.119) (-1179.232) [-1178.969] (-1177.676) * (-1178.616) [-1177.090] (-1179.541) (-1177.436) -- 0:00:35
      439500 -- (-1180.626) (-1178.610) [-1180.280] (-1178.724) * (-1178.198) (-1179.787) [-1179.714] (-1178.252) -- 0:00:35
      440000 -- [-1179.633] (-1179.662) (-1183.271) (-1181.314) * (-1179.364) [-1179.223] (-1179.010) (-1178.586) -- 0:00:35

      Average standard deviation of split frequencies: 0.011366

      440500 -- (-1178.626) (-1178.949) (-1178.218) [-1178.462] * (-1177.132) (-1180.512) [-1180.015] (-1179.133) -- 0:00:35
      441000 -- (-1179.525) [-1179.577] (-1178.638) (-1177.911) * [-1177.692] (-1179.053) (-1182.765) (-1179.499) -- 0:00:35
      441500 -- [-1187.496] (-1182.876) (-1178.946) (-1178.600) * (-1177.184) [-1177.521] (-1181.903) (-1178.490) -- 0:00:35
      442000 -- (-1180.538) [-1178.390] (-1177.301) (-1181.892) * [-1176.853] (-1179.524) (-1179.580) (-1179.305) -- 0:00:35
      442500 -- [-1178.634] (-1179.010) (-1178.711) (-1180.573) * [-1177.223] (-1182.525) (-1178.365) (-1177.455) -- 0:00:35
      443000 -- (-1178.673) (-1178.310) [-1177.562] (-1180.311) * (-1179.483) (-1180.140) [-1179.503] (-1177.791) -- 0:00:35
      443500 -- (-1178.816) (-1178.466) (-1181.435) [-1178.668] * (-1177.817) (-1181.211) (-1185.418) [-1178.567] -- 0:00:35
      444000 -- (-1180.017) (-1177.506) [-1178.319] (-1181.300) * (-1178.097) [-1178.020] (-1182.098) (-1179.431) -- 0:00:35
      444500 -- [-1179.569] (-1183.302) (-1177.973) (-1182.933) * (-1178.080) (-1178.572) (-1179.771) [-1177.847] -- 0:00:34
      445000 -- [-1177.954] (-1181.555) (-1178.005) (-1183.533) * [-1179.312] (-1179.568) (-1177.101) (-1177.405) -- 0:00:34

      Average standard deviation of split frequencies: 0.010834

      445500 -- (-1177.851) (-1179.223) (-1177.988) [-1179.709] * (-1180.451) [-1178.342] (-1178.672) (-1179.506) -- 0:00:34
      446000 -- (-1178.904) (-1177.835) (-1178.765) [-1180.506] * (-1179.734) [-1180.503] (-1178.190) (-1176.939) -- 0:00:34
      446500 -- (-1177.639) [-1180.377] (-1179.695) (-1178.437) * (-1179.216) (-1179.155) [-1178.525] (-1177.911) -- 0:00:34
      447000 -- (-1179.008) (-1177.747) (-1178.487) [-1180.140] * [-1178.107] (-1179.296) (-1178.488) (-1179.862) -- 0:00:34
      447500 -- (-1179.204) (-1178.193) [-1177.997] (-1181.270) * (-1179.526) (-1178.476) [-1178.231] (-1182.885) -- 0:00:34
      448000 -- (-1179.083) (-1180.980) (-1178.211) [-1178.513] * (-1180.215) (-1178.419) [-1177.826] (-1178.146) -- 0:00:34
      448500 -- (-1180.322) [-1180.543] (-1177.393) (-1177.694) * (-1178.764) (-1178.415) (-1181.072) [-1178.937] -- 0:00:34
      449000 -- (-1179.973) (-1177.759) [-1176.818] (-1178.760) * (-1177.106) (-1179.076) [-1178.634] (-1177.721) -- 0:00:34
      449500 -- (-1178.919) (-1178.487) (-1176.870) [-1177.219] * [-1177.591] (-1182.173) (-1178.009) (-1179.347) -- 0:00:34
      450000 -- (-1182.060) (-1179.904) (-1180.709) [-1176.951] * (-1179.972) (-1178.084) (-1179.381) [-1179.387] -- 0:00:34

      Average standard deviation of split frequencies: 0.010264

      450500 -- [-1182.602] (-1181.706) (-1179.020) (-1177.284) * [-1179.052] (-1178.540) (-1178.479) (-1178.678) -- 0:00:34
      451000 -- (-1181.199) (-1178.286) (-1177.913) [-1177.597] * (-1180.801) (-1178.438) (-1179.061) [-1179.370] -- 0:00:34
      451500 -- (-1181.720) (-1181.100) [-1177.674] (-1177.068) * (-1178.061) [-1178.625] (-1181.302) (-1179.370) -- 0:00:34
      452000 -- [-1184.554] (-1181.230) (-1179.310) (-1178.285) * [-1177.396] (-1177.498) (-1182.271) (-1180.459) -- 0:00:33
      452500 -- (-1183.005) (-1182.705) (-1179.386) [-1178.426] * (-1177.562) (-1181.228) (-1180.243) [-1181.561] -- 0:00:33
      453000 -- (-1181.653) (-1177.208) (-1179.567) [-1177.739] * (-1177.542) (-1177.635) [-1179.619] (-1180.579) -- 0:00:33
      453500 -- (-1179.271) [-1177.125] (-1178.232) (-1180.084) * (-1179.674) (-1178.372) [-1178.760] (-1181.563) -- 0:00:33
      454000 -- (-1180.154) (-1177.034) [-1177.918] (-1184.250) * [-1181.151] (-1179.865) (-1182.742) (-1181.278) -- 0:00:33
      454500 -- (-1179.155) (-1177.317) [-1178.115] (-1180.458) * [-1179.373] (-1180.291) (-1181.644) (-1181.353) -- 0:00:33
      455000 -- [-1179.846] (-1178.116) (-1179.475) (-1178.904) * (-1180.739) [-1181.836] (-1180.729) (-1180.702) -- 0:00:34

      Average standard deviation of split frequencies: 0.010596

      455500 -- (-1180.651) (-1182.512) [-1179.009] (-1178.664) * (-1178.716) [-1178.187] (-1178.286) (-1181.860) -- 0:00:34
      456000 -- (-1181.446) (-1178.072) [-1181.915] (-1179.826) * [-1177.793] (-1178.103) (-1179.747) (-1178.609) -- 0:00:34
      456500 -- (-1179.299) (-1178.908) [-1181.390] (-1179.206) * (-1178.481) (-1177.868) (-1181.276) [-1177.734] -- 0:00:34
      457000 -- (-1178.411) (-1178.156) (-1181.777) [-1179.380] * (-1178.591) (-1179.692) (-1182.357) [-1179.820] -- 0:00:34
      457500 -- (-1178.190) (-1178.552) [-1178.972] (-1182.506) * (-1177.481) (-1182.585) [-1178.359] (-1178.121) -- 0:00:34
      458000 -- (-1178.788) (-1178.121) (-1177.658) [-1181.005] * (-1181.496) (-1179.826) [-1179.262] (-1179.446) -- 0:00:34
      458500 -- (-1183.680) (-1179.993) (-1177.932) [-1178.959] * [-1180.304] (-1178.256) (-1177.832) (-1181.773) -- 0:00:34
      459000 -- (-1181.885) [-1178.105] (-1178.144) (-1180.310) * [-1179.970] (-1180.427) (-1180.439) (-1180.494) -- 0:00:34
      459500 -- (-1178.076) (-1183.154) [-1177.987] (-1182.463) * (-1178.722) (-1179.911) (-1179.721) [-1181.437] -- 0:00:34
      460000 -- (-1177.593) [-1186.699] (-1179.850) (-1178.735) * (-1177.954) [-1178.895] (-1179.342) (-1181.429) -- 0:00:34

      Average standard deviation of split frequencies: 0.011448

      460500 -- (-1178.974) (-1177.283) [-1180.903] (-1177.710) * [-1178.958] (-1179.435) (-1178.597) (-1180.609) -- 0:00:33
      461000 -- [-1177.712] (-1177.372) (-1180.048) (-1179.088) * (-1180.941) [-1180.267] (-1179.561) (-1182.043) -- 0:00:33
      461500 -- (-1178.760) (-1177.789) [-1178.747] (-1178.513) * [-1180.486] (-1179.295) (-1181.119) (-1180.139) -- 0:00:33
      462000 -- [-1178.042] (-1177.517) (-1179.899) (-1178.513) * (-1178.429) [-1178.768] (-1179.352) (-1181.609) -- 0:00:33
      462500 -- (-1178.004) (-1178.276) [-1179.145] (-1179.175) * (-1179.778) (-1179.761) [-1178.797] (-1178.767) -- 0:00:33
      463000 -- (-1179.734) (-1178.792) (-1179.202) [-1177.796] * (-1179.840) [-1176.959] (-1182.478) (-1178.356) -- 0:00:33
      463500 -- [-1178.452] (-1184.828) (-1179.043) (-1180.349) * (-1184.208) (-1179.100) [-1179.083] (-1180.244) -- 0:00:33
      464000 -- (-1188.480) (-1177.824) (-1178.237) [-1178.302] * (-1181.509) [-1179.104] (-1179.874) (-1180.082) -- 0:00:33
      464500 -- (-1180.414) (-1177.597) [-1181.287] (-1180.341) * (-1178.169) (-1177.838) (-1181.066) [-1179.437] -- 0:00:33
      465000 -- (-1180.200) (-1177.746) [-1178.032] (-1180.332) * [-1178.306] (-1180.907) (-1178.772) (-1177.519) -- 0:00:33

      Average standard deviation of split frequencies: 0.010811

      465500 -- (-1180.342) (-1178.244) [-1178.444] (-1181.708) * (-1182.706) (-1178.463) (-1178.065) [-1179.118] -- 0:00:33
      466000 -- (-1179.439) (-1180.645) [-1178.488] (-1181.034) * (-1183.505) (-1178.336) [-1178.506] (-1178.552) -- 0:00:33
      466500 -- (-1178.796) (-1177.717) [-1179.095] (-1181.315) * [-1179.255] (-1178.844) (-1179.422) (-1179.036) -- 0:00:33
      467000 -- (-1178.110) [-1178.446] (-1179.463) (-1180.563) * [-1177.790] (-1179.156) (-1180.552) (-1179.074) -- 0:00:33
      467500 -- (-1178.955) (-1180.975) (-1180.505) [-1181.059] * (-1188.175) (-1183.012) (-1181.031) [-1181.293] -- 0:00:33
      468000 -- (-1178.930) (-1179.352) [-1177.677] (-1181.907) * (-1179.620) (-1180.347) [-1178.088] (-1178.550) -- 0:00:32
      468500 -- [-1178.612] (-1181.499) (-1177.977) (-1181.987) * [-1177.315] (-1178.515) (-1177.986) (-1178.276) -- 0:00:32
      469000 -- (-1181.487) (-1181.252) [-1177.299] (-1181.983) * (-1177.945) (-1179.556) (-1180.904) [-1180.650] -- 0:00:32
      469500 -- (-1177.628) [-1178.434] (-1176.815) (-1180.221) * [-1178.443] (-1178.106) (-1178.289) (-1178.474) -- 0:00:32
      470000 -- (-1177.521) (-1177.746) [-1178.502] (-1182.289) * (-1177.869) [-1180.391] (-1179.763) (-1180.830) -- 0:00:32

      Average standard deviation of split frequencies: 0.011205

      470500 -- (-1180.140) (-1183.237) (-1180.542) [-1178.459] * (-1177.720) (-1180.076) [-1178.759] (-1177.421) -- 0:00:32
      471000 -- (-1178.495) (-1178.648) (-1179.268) [-1180.599] * (-1178.726) (-1178.026) [-1178.251] (-1177.417) -- 0:00:33
      471500 -- [-1179.159] (-1177.962) (-1181.548) (-1179.306) * (-1177.696) (-1182.419) [-1181.218] (-1178.264) -- 0:00:33
      472000 -- (-1179.900) (-1179.742) [-1179.833] (-1178.251) * (-1177.815) (-1183.160) (-1179.517) [-1177.557] -- 0:00:33
      472500 -- (-1179.414) (-1182.942) (-1182.639) [-1178.966] * [-1178.691] (-1183.022) (-1177.658) (-1181.792) -- 0:00:33
      473000 -- (-1184.275) [-1180.066] (-1179.564) (-1178.350) * (-1182.701) (-1177.849) (-1178.337) [-1180.415] -- 0:00:33
      473500 -- (-1181.768) [-1180.233] (-1179.552) (-1178.292) * (-1179.328) [-1177.938] (-1178.334) (-1179.633) -- 0:00:33
      474000 -- (-1183.020) (-1178.937) [-1181.776] (-1179.025) * (-1177.903) [-1177.734] (-1178.428) (-1179.983) -- 0:00:33
      474500 -- (-1178.489) [-1181.434] (-1179.049) (-1179.055) * (-1181.302) [-1179.326] (-1178.427) (-1180.507) -- 0:00:33
      475000 -- (-1180.747) (-1180.609) (-1178.599) [-1181.168] * [-1180.796] (-1177.696) (-1178.571) (-1180.650) -- 0:00:33

      Average standard deviation of split frequencies: 0.011418

      475500 -- (-1179.252) (-1178.676) [-1178.224] (-1182.250) * (-1178.730) (-1181.922) [-1177.625] (-1179.400) -- 0:00:33
      476000 -- (-1177.202) (-1178.532) (-1178.713) [-1179.175] * (-1178.549) (-1183.892) (-1179.195) [-1179.286] -- 0:00:33
      476500 -- (-1177.153) (-1180.291) (-1179.781) [-1178.678] * (-1177.575) (-1178.851) (-1179.701) [-1179.162] -- 0:00:32
      477000 -- [-1177.968] (-1178.525) (-1180.032) (-1179.348) * (-1180.534) [-1178.089] (-1177.354) (-1182.653) -- 0:00:32
      477500 -- (-1178.973) (-1179.962) (-1180.034) [-1181.933] * (-1181.097) (-1179.731) [-1180.655] (-1182.353) -- 0:00:32
      478000 -- (-1179.256) (-1180.080) (-1183.112) [-1181.691] * (-1182.961) (-1178.735) (-1182.316) [-1179.932] -- 0:00:32
      478500 -- [-1177.961] (-1177.361) (-1178.570) (-1180.008) * (-1178.990) [-1178.666] (-1180.231) (-1180.094) -- 0:00:32
      479000 -- (-1178.550) (-1177.267) (-1179.729) [-1178.940] * (-1179.460) [-1177.066] (-1182.819) (-1179.475) -- 0:00:32
      479500 -- (-1179.817) [-1178.102] (-1181.995) (-1177.467) * (-1180.543) (-1179.455) (-1185.615) [-1178.672] -- 0:00:32
      480000 -- (-1179.673) (-1178.598) [-1181.703] (-1179.160) * (-1179.925) [-1181.211] (-1179.090) (-1177.531) -- 0:00:32

      Average standard deviation of split frequencies: 0.011830

      480500 -- [-1178.499] (-1181.429) (-1179.180) (-1178.609) * (-1177.933) (-1179.447) (-1178.642) [-1178.689] -- 0:00:32
      481000 -- (-1177.042) (-1178.462) [-1180.461] (-1179.228) * (-1181.629) (-1177.986) (-1177.815) [-1180.918] -- 0:00:32
      481500 -- (-1177.542) [-1181.039] (-1181.567) (-1178.852) * (-1178.052) (-1178.842) (-1180.207) [-1181.681] -- 0:00:32
      482000 -- [-1181.099] (-1181.801) (-1180.453) (-1177.147) * (-1177.304) [-1182.949] (-1182.605) (-1178.856) -- 0:00:32
      482500 -- (-1181.759) (-1177.335) (-1179.517) [-1179.759] * [-1177.493] (-1178.993) (-1182.899) (-1179.525) -- 0:00:32
      483000 -- [-1177.051] (-1178.089) (-1179.464) (-1179.175) * (-1177.351) (-1178.515) [-1178.512] (-1179.850) -- 0:00:32
      483500 -- (-1177.120) (-1179.275) [-1177.760] (-1178.672) * (-1177.094) (-1177.338) [-1177.544] (-1180.911) -- 0:00:32
      484000 -- (-1177.430) (-1181.786) (-1181.804) [-1181.330] * (-1178.955) [-1178.085] (-1179.607) (-1183.134) -- 0:00:31
      484500 -- (-1179.234) (-1179.508) [-1179.873] (-1177.680) * (-1181.674) (-1181.665) (-1183.977) [-1178.521] -- 0:00:31
      485000 -- (-1177.498) (-1177.713) [-1179.092] (-1181.730) * (-1182.217) (-1179.476) [-1182.057] (-1177.907) -- 0:00:31

      Average standard deviation of split frequencies: 0.011397

      485500 -- [-1178.148] (-1179.282) (-1182.387) (-1179.915) * (-1178.171) (-1178.744) (-1179.376) [-1178.488] -- 0:00:31
      486000 -- (-1178.271) [-1178.585] (-1179.197) (-1180.508) * (-1182.318) (-1183.552) [-1184.375] (-1179.950) -- 0:00:31
      486500 -- (-1185.470) [-1178.189] (-1178.675) (-1180.186) * (-1179.313) (-1178.206) (-1179.488) [-1181.058] -- 0:00:31
      487000 -- (-1181.253) [-1178.099] (-1178.424) (-1187.064) * (-1180.907) [-1177.669] (-1178.459) (-1179.962) -- 0:00:31
      487500 -- (-1179.513) (-1178.982) [-1179.022] (-1178.479) * (-1178.562) [-1181.006] (-1179.120) (-1180.466) -- 0:00:32
      488000 -- (-1178.091) (-1178.243) [-1181.579] (-1179.038) * (-1178.049) [-1180.197] (-1178.593) (-1178.941) -- 0:00:32
      488500 -- (-1178.728) (-1178.213) (-1179.711) [-1181.273] * [-1177.459] (-1181.980) (-1179.718) (-1177.433) -- 0:00:32
      489000 -- (-1181.616) [-1178.223] (-1182.273) (-1178.442) * [-1178.949] (-1181.299) (-1179.974) (-1178.914) -- 0:00:32
      489500 -- [-1178.882] (-1177.508) (-1181.228) (-1186.891) * (-1181.653) (-1185.512) [-1180.128] (-1178.129) -- 0:00:32
      490000 -- [-1178.758] (-1177.786) (-1181.646) (-1178.015) * (-1182.042) (-1180.843) (-1178.143) [-1179.003] -- 0:00:32

      Average standard deviation of split frequencies: 0.011409

      490500 -- [-1178.800] (-1177.263) (-1180.865) (-1180.244) * (-1180.823) (-1184.282) [-1176.967] (-1177.782) -- 0:00:32
      491000 -- [-1179.390] (-1178.326) (-1181.605) (-1180.067) * [-1181.160] (-1178.610) (-1178.822) (-1180.065) -- 0:00:32
      491500 -- (-1178.293) (-1183.070) [-1179.561] (-1178.926) * (-1179.785) (-1181.910) (-1178.838) [-1179.707] -- 0:00:32
      492000 -- (-1178.299) (-1181.946) [-1179.386] (-1178.173) * [-1180.174] (-1177.480) (-1177.834) (-1180.851) -- 0:00:32
      492500 -- (-1180.291) (-1181.642) [-1179.526] (-1180.760) * (-1181.569) [-1176.968] (-1178.182) (-1179.838) -- 0:00:31
      493000 -- (-1180.974) (-1182.002) [-1179.525] (-1179.597) * (-1181.766) [-1176.970] (-1178.457) (-1178.331) -- 0:00:31
      493500 -- (-1177.593) [-1181.165] (-1178.423) (-1179.528) * (-1179.547) [-1177.256] (-1177.591) (-1177.466) -- 0:00:31
      494000 -- (-1180.115) (-1180.060) [-1178.283] (-1176.899) * [-1179.700] (-1177.813) (-1179.424) (-1178.167) -- 0:00:31
      494500 -- (-1178.854) (-1181.349) [-1178.674] (-1177.390) * [-1177.905] (-1180.876) (-1179.553) (-1178.823) -- 0:00:31
      495000 -- (-1179.162) [-1182.133] (-1179.790) (-1178.828) * [-1178.472] (-1178.480) (-1178.725) (-1178.077) -- 0:00:31

      Average standard deviation of split frequencies: 0.010811

      495500 -- (-1182.823) [-1180.864] (-1178.916) (-1176.961) * (-1177.070) [-1180.021] (-1179.080) (-1178.487) -- 0:00:31
      496000 -- (-1180.933) (-1178.639) (-1180.920) [-1178.236] * (-1180.524) (-1178.753) [-1177.350] (-1178.976) -- 0:00:31
      496500 -- (-1179.264) [-1178.471] (-1177.029) (-1179.971) * (-1179.247) (-1181.518) [-1177.857] (-1181.250) -- 0:00:31
      497000 -- [-1177.809] (-1178.348) (-1177.177) (-1180.079) * (-1179.038) (-1179.404) [-1177.843] (-1180.391) -- 0:00:31
      497500 -- (-1177.709) [-1177.340] (-1180.240) (-1178.229) * (-1178.839) (-1178.066) [-1177.395] (-1180.007) -- 0:00:31
      498000 -- [-1177.105] (-1180.951) (-1178.520) (-1184.446) * (-1179.258) (-1180.724) [-1177.604] (-1179.205) -- 0:00:31
      498500 -- (-1176.887) (-1181.976) (-1181.381) [-1179.291] * [-1179.256] (-1179.491) (-1178.901) (-1181.061) -- 0:00:31
      499000 -- (-1177.551) (-1177.572) [-1180.068] (-1178.307) * (-1182.590) [-1180.181] (-1180.558) (-1182.402) -- 0:00:31
      499500 -- [-1177.561] (-1177.954) (-1179.616) (-1179.439) * (-1178.905) (-1184.097) (-1179.164) [-1179.092] -- 0:00:31
      500000 -- (-1179.885) (-1181.492) (-1179.431) [-1178.767] * [-1178.924] (-1187.020) (-1179.630) (-1179.422) -- 0:00:31

      Average standard deviation of split frequencies: 0.010651

      500500 -- (-1180.836) (-1187.490) [-1177.603] (-1178.514) * (-1180.091) (-1182.513) [-1178.312] (-1177.994) -- 0:00:30
      501000 -- (-1178.740) (-1186.959) (-1177.838) [-1179.222] * [-1179.716] (-1180.793) (-1177.486) (-1180.340) -- 0:00:30
      501500 -- [-1178.965] (-1184.563) (-1182.651) (-1179.831) * (-1179.976) (-1180.372) (-1178.222) [-1177.736] -- 0:00:30
      502000 -- (-1180.398) (-1181.777) (-1179.657) [-1179.208] * (-1178.748) (-1179.387) [-1178.632] (-1180.053) -- 0:00:30
      502500 -- (-1180.495) (-1179.934) [-1179.183] (-1178.592) * (-1178.693) (-1178.193) [-1181.007] (-1179.694) -- 0:00:30
      503000 -- [-1180.071] (-1178.137) (-1179.034) (-1184.660) * [-1178.395] (-1177.876) (-1181.147) (-1179.241) -- 0:00:30
      503500 -- (-1178.840) [-1180.192] (-1183.223) (-1177.946) * (-1177.661) (-1180.091) [-1178.967] (-1179.755) -- 0:00:30
      504000 -- (-1180.079) (-1184.021) [-1179.340] (-1185.023) * [-1177.460] (-1180.213) (-1180.937) (-1180.198) -- 0:00:31
      504500 -- [-1178.755] (-1179.080) (-1178.715) (-1185.349) * (-1177.166) (-1178.482) [-1178.754] (-1178.282) -- 0:00:31
      505000 -- [-1178.892] (-1182.191) (-1180.842) (-1186.445) * (-1178.134) (-1179.474) [-1179.185] (-1182.744) -- 0:00:31

      Average standard deviation of split frequencies: 0.011005

      505500 -- [-1180.699] (-1183.022) (-1181.509) (-1183.321) * (-1189.929) [-1182.447] (-1182.946) (-1178.119) -- 0:00:31
      506000 -- (-1179.695) [-1178.568] (-1178.909) (-1177.208) * [-1180.855] (-1180.844) (-1178.559) (-1177.941) -- 0:00:31
      506500 -- (-1185.955) [-1177.966] (-1178.092) (-1178.594) * (-1178.668) (-1179.750) (-1178.115) [-1181.523] -- 0:00:31
      507000 -- (-1186.325) [-1178.589] (-1179.418) (-1179.330) * (-1179.898) (-1180.634) (-1178.432) [-1178.941] -- 0:00:31
      507500 -- [-1184.275] (-1178.159) (-1179.173) (-1178.618) * [-1177.609] (-1182.702) (-1181.373) (-1179.024) -- 0:00:31
      508000 -- (-1177.364) [-1178.521] (-1179.709) (-1178.516) * (-1177.611) (-1181.942) (-1181.439) [-1181.273] -- 0:00:30
      508500 -- (-1179.014) [-1178.191] (-1182.016) (-1178.593) * [-1177.291] (-1183.715) (-1180.675) (-1181.552) -- 0:00:30
      509000 -- (-1179.678) (-1179.140) (-1177.768) [-1178.465] * (-1178.844) (-1181.641) [-1181.435] (-1178.071) -- 0:00:30
      509500 -- [-1178.131] (-1183.300) (-1179.513) (-1177.258) * (-1180.789) [-1180.182] (-1179.117) (-1178.013) -- 0:00:30
      510000 -- (-1180.449) (-1180.290) (-1179.068) [-1177.279] * (-1181.604) (-1180.465) (-1182.308) [-1178.471] -- 0:00:30

      Average standard deviation of split frequencies: 0.011654

      510500 -- (-1181.126) [-1180.504] (-1179.413) (-1178.712) * [-1178.814] (-1182.198) (-1179.927) (-1178.649) -- 0:00:30
      511000 -- (-1181.976) [-1179.258] (-1177.663) (-1177.665) * (-1178.403) (-1179.139) (-1180.219) [-1178.363] -- 0:00:30
      511500 -- (-1180.845) [-1178.927] (-1180.511) (-1177.318) * (-1178.277) [-1177.489] (-1178.913) (-1177.940) -- 0:00:30
      512000 -- (-1179.904) (-1184.879) [-1177.587] (-1183.332) * (-1179.585) (-1178.836) (-1180.973) [-1178.143] -- 0:00:30
      512500 -- [-1178.967] (-1179.116) (-1177.495) (-1185.593) * (-1180.852) (-1181.288) [-1181.517] (-1178.464) -- 0:00:30
      513000 -- (-1181.440) (-1178.067) (-1182.580) [-1182.801] * [-1177.266] (-1180.314) (-1179.218) (-1177.334) -- 0:00:30
      513500 -- (-1179.528) (-1178.705) (-1179.610) [-1181.242] * (-1179.775) (-1179.539) [-1177.317] (-1178.082) -- 0:00:30
      514000 -- (-1180.705) (-1180.555) (-1178.907) [-1177.134] * [-1178.952] (-1177.955) (-1178.556) (-1181.365) -- 0:00:30
      514500 -- (-1180.399) (-1178.346) [-1181.050] (-1178.227) * (-1177.294) (-1177.872) [-1179.069] (-1177.535) -- 0:00:30
      515000 -- [-1180.346] (-1178.781) (-1179.427) (-1180.812) * [-1180.389] (-1178.913) (-1181.830) (-1178.360) -- 0:00:30

      Average standard deviation of split frequencies: 0.012105

      515500 -- [-1181.924] (-1178.693) (-1179.310) (-1178.296) * [-1177.883] (-1182.487) (-1178.480) (-1178.969) -- 0:00:30
      516000 -- (-1184.366) (-1177.592) (-1182.156) [-1180.625] * (-1179.258) (-1180.246) [-1177.206] (-1178.637) -- 0:00:30
      516500 -- [-1179.909] (-1177.481) (-1178.804) (-1183.185) * (-1179.749) [-1182.076] (-1177.285) (-1181.598) -- 0:00:29
      517000 -- (-1181.838) (-1177.716) [-1184.310] (-1180.545) * (-1182.212) (-1178.573) [-1181.197] (-1183.917) -- 0:00:29
      517500 -- (-1179.512) [-1178.069] (-1182.870) (-1183.930) * [-1178.708] (-1177.880) (-1180.342) (-1180.597) -- 0:00:29
      518000 -- (-1180.114) (-1178.367) (-1179.334) [-1179.480] * (-1178.887) (-1179.514) (-1185.039) [-1184.043] -- 0:00:29
      518500 -- (-1178.783) (-1179.027) (-1181.105) [-1180.106] * (-1180.317) [-1177.431] (-1179.209) (-1179.959) -- 0:00:29
      519000 -- (-1180.016) (-1178.578) [-1180.408] (-1183.001) * (-1179.228) (-1178.128) [-1180.765] (-1179.629) -- 0:00:29
      519500 -- [-1178.738] (-1178.494) (-1182.417) (-1179.712) * (-1178.458) (-1181.403) [-1179.630] (-1181.134) -- 0:00:29
      520000 -- (-1179.792) (-1177.545) (-1180.301) [-1177.669] * (-1179.580) [-1180.450] (-1178.076) (-1180.429) -- 0:00:30

      Average standard deviation of split frequencies: 0.012053

      520500 -- (-1181.946) (-1178.529) (-1180.511) [-1180.012] * (-1182.825) (-1178.179) [-1179.374] (-1180.906) -- 0:00:30
      521000 -- (-1181.349) (-1179.862) (-1178.445) [-1180.991] * (-1178.770) (-1179.959) [-1177.972] (-1180.140) -- 0:00:30
      521500 -- (-1183.616) (-1178.156) [-1179.706] (-1179.167) * (-1180.028) (-1183.432) (-1178.146) [-1177.441] -- 0:00:30
      522000 -- [-1178.838] (-1177.690) (-1181.912) (-1178.551) * (-1177.765) (-1180.613) [-1180.298] (-1180.661) -- 0:00:30
      522500 -- (-1178.391) (-1178.268) [-1177.956] (-1180.691) * [-1178.421] (-1178.234) (-1180.017) (-1177.131) -- 0:00:30
      523000 -- (-1179.321) (-1187.728) (-1178.565) [-1177.461] * (-1178.988) [-1177.978] (-1179.096) (-1183.406) -- 0:00:30
      523500 -- (-1180.994) (-1178.115) (-1178.257) [-1177.363] * (-1183.753) (-1179.089) (-1177.488) [-1177.931] -- 0:00:30
      524000 -- (-1179.640) (-1177.569) [-1179.953] (-1177.516) * (-1178.774) (-1177.867) [-1177.905] (-1178.009) -- 0:00:29
      524500 -- (-1177.834) [-1177.833] (-1180.206) (-1177.520) * (-1178.018) (-1177.427) (-1177.287) [-1178.969] -- 0:00:29
      525000 -- (-1181.311) (-1179.664) [-1183.542] (-1177.186) * [-1177.540] (-1178.828) (-1177.526) (-1181.007) -- 0:00:29

      Average standard deviation of split frequencies: 0.011931

      525500 -- (-1178.096) [-1178.054] (-1179.994) (-1179.092) * (-1180.062) (-1177.472) [-1180.910] (-1177.804) -- 0:00:29
      526000 -- (-1183.369) [-1178.298] (-1179.559) (-1180.655) * [-1178.148] (-1177.122) (-1179.078) (-1179.655) -- 0:00:29
      526500 -- [-1177.323] (-1177.577) (-1183.671) (-1178.855) * [-1177.244] (-1177.796) (-1178.853) (-1179.307) -- 0:00:29
      527000 -- [-1177.844] (-1177.985) (-1180.228) (-1178.191) * [-1178.007] (-1177.252) (-1179.454) (-1178.352) -- 0:00:29
      527500 -- [-1180.280] (-1178.671) (-1183.568) (-1179.979) * (-1179.003) [-1177.218] (-1181.035) (-1178.133) -- 0:00:29
      528000 -- (-1179.878) (-1178.541) [-1182.345] (-1180.151) * [-1177.896] (-1177.234) (-1178.452) (-1182.034) -- 0:00:29
      528500 -- [-1183.235] (-1177.616) (-1177.348) (-1180.548) * (-1179.579) (-1180.035) (-1180.151) [-1181.997] -- 0:00:29
      529000 -- [-1180.737] (-1182.695) (-1179.636) (-1178.122) * (-1180.740) (-1180.129) [-1180.703] (-1177.293) -- 0:00:29
      529500 -- [-1178.722] (-1179.248) (-1178.344) (-1177.839) * [-1179.405] (-1180.524) (-1179.816) (-1180.400) -- 0:00:29
      530000 -- [-1183.131] (-1180.534) (-1177.089) (-1180.427) * (-1181.617) [-1177.792] (-1180.701) (-1179.459) -- 0:00:29

      Average standard deviation of split frequencies: 0.011715

      530500 -- (-1186.324) (-1180.680) [-1179.741] (-1179.112) * (-1177.769) (-1178.230) [-1182.207] (-1180.475) -- 0:00:29
      531000 -- (-1180.192) (-1179.304) [-1180.544] (-1179.089) * (-1179.745) (-1177.373) (-1179.673) [-1178.582] -- 0:00:29
      531500 -- (-1178.184) (-1179.953) (-1178.393) [-1181.201] * [-1178.673] (-1178.154) (-1181.217) (-1179.243) -- 0:00:29
      532000 -- [-1178.032] (-1178.892) (-1178.658) (-1183.177) * [-1178.431] (-1177.935) (