--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 12:36:27 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/10res/mmaA1/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1178.51 -1184.13 2 -1178.50 -1182.30 -------------------------------------- TOTAL -1178.50 -1183.58 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.905452 0.094808 0.356476 1.519429 0.867081 1465.60 1483.30 1.000 r(A<->C){all} 0.169669 0.020159 0.000136 0.461478 0.133191 192.46 225.71 1.003 r(A<->G){all} 0.166236 0.020571 0.000033 0.457779 0.128493 194.55 209.56 1.000 r(A<->T){all} 0.167918 0.019109 0.000033 0.443459 0.134105 167.09 189.00 1.001 r(C<->G){all} 0.169471 0.019703 0.000073 0.458198 0.134536 149.15 209.13 1.001 r(C<->T){all} 0.158770 0.017565 0.000156 0.430053 0.126714 175.49 181.17 1.001 r(G<->T){all} 0.167935 0.019048 0.000011 0.438642 0.133907 204.27 267.00 1.000 pi(A){all} 0.226681 0.000202 0.199648 0.255317 0.226341 1318.79 1338.82 1.000 pi(C){all} 0.305590 0.000236 0.277730 0.338775 0.305417 1373.16 1427.49 1.000 pi(G){all} 0.272672 0.000231 0.243215 0.302381 0.272589 1287.38 1316.64 1.000 pi(T){all} 0.195057 0.000181 0.168997 0.221741 0.194641 1146.54 1266.23 1.001 alpha{1,2} 0.433590 0.237180 0.000274 1.428154 0.260938 792.76 840.56 1.000 alpha{3} 0.461069 0.245521 0.000113 1.412858 0.295526 1192.78 1249.30 1.001 pinvar{all} 0.998195 0.000005 0.994021 0.999999 0.998879 1196.19 1252.25 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1124.719587 Model 2: PositiveSelection -1124.719587 Model 0: one-ratio -1124.719741 Model 7: beta -1124.719587 Model 8: beta&w>1 -1124.719587 Model 0 vs 1 3.0800000013186946E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
>C1 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >C2 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >C3 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >C4 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >C5 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >C6 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=286 C1 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA C2 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA C3 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA C4 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA C5 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA C6 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA ************************************************** C1 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA C2 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA C3 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA C4 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA C5 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA C6 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA ************************************************** C1 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF C2 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF C3 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF C4 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF C5 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF C6 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ************************************************** C1 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP C2 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP C3 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP C4 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP C5 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP C6 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP ************************************************** C1 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL C2 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL C3 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL C4 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL C5 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL C6 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL ************************************************** C1 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK C2 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK C3 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK C4 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK C5 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK C6 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK ************************************ PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 286 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 286 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8580] Library Relaxation: Multi_proc [96] Relaxation Summary: [8580]--->[8580] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.503 Mb, Max= 30.845 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA C2 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA C3 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA C4 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA C5 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA C6 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA ************************************************** C1 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA C2 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA C3 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA C4 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA C5 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA C6 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA ************************************************** C1 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF C2 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF C3 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF C4 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF C5 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF C6 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ************************************************** C1 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP C2 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP C3 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP C4 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP C5 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP C6 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP ************************************************** C1 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL C2 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL C3 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL C4 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL C5 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL C6 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL ************************************************** C1 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK C2 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK C3 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK C4 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK C5 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK C6 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK ************************************ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT C2 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT C3 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT C4 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT C5 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT C6 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT ************************************************** C1 CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT C2 CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT C3 CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT C4 CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT C5 CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT C6 CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT ************************************************** C1 GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA C2 GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA C3 GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA C4 GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA C5 GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA C6 GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA ************************************************** C1 AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT C2 AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT C3 AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT C4 AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT C5 AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT C6 AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT ************************************************** C1 GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA C2 GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA C3 GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA C4 GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA C5 GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA C6 GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA ************************************************** C1 AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG C2 AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG C3 AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG C4 AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG C5 AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG C6 AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG ************************************************** C1 CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC C2 CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC C3 CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC C4 CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC C5 CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC C6 CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC ************************************************** C1 TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA C2 TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA C3 TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA C4 TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA C5 TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA C6 TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA ************************************************** C1 GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC C2 GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC C3 GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC C4 GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC C5 GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC C6 GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC ************************************************** C1 GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG C2 GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG C3 GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG C4 GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG C5 GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG C6 GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG ************************************************** C1 CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA C2 CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA C3 CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA C4 CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA C5 CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA C6 CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA ************************************************** C1 CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG C2 CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG C3 CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG C4 CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG C5 CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG C6 CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG ************************************************** C1 GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC C2 GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC C3 GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC C4 GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC C5 GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC C6 GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC ************************************************** C1 GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA C2 GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA C3 GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA C4 GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA C5 GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA C6 GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA ************************************************** C1 CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC C2 CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC C3 CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC C4 CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC C5 CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC C6 CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC ************************************************** C1 GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG C2 GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG C3 GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG C4 GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG C5 GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG C6 GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG ************************************************** C1 GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC C2 GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC C3 GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC C4 GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC C5 GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC C6 GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC ************************************************** C1 TGACAAAA C2 TGACAAAA C3 TGACAAAA C4 TGACAAAA C5 TGACAAAA C6 TGACAAAA ******** >C1 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC TGACAAAA >C2 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC TGACAAAA >C3 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC TGACAAAA >C4 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC TGACAAAA >C5 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC TGACAAAA >C6 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC TGACAAAA >C1 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >C2 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >C3 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >C4 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >C5 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >C6 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 858 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579782910 Setting output file names to "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 453803439 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9770657971 Seed = 1797622190 Swapseed = 1579782910 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1920.245138 -- -24.965149 Chain 2 -- -1920.244845 -- -24.965149 Chain 3 -- -1920.245138 -- -24.965149 Chain 4 -- -1920.244845 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1920.245138 -- -24.965149 Chain 2 -- -1920.245028 -- -24.965149 Chain 3 -- -1920.245138 -- -24.965149 Chain 4 -- -1920.244845 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1920.245] (-1920.245) (-1920.245) (-1920.245) * [-1920.245] (-1920.245) (-1920.245) (-1920.245) 500 -- (-1198.812) [-1187.077] (-1189.474) (-1187.699) * (-1196.942) (-1197.387) (-1196.585) [-1194.232] -- 0:00:00 1000 -- (-1196.735) (-1182.914) [-1187.990] (-1192.990) * (-1184.374) [-1188.840] (-1185.463) (-1196.025) -- 0:00:00 1500 -- (-1207.905) [-1184.965] (-1187.573) (-1186.077) * (-1186.847) (-1187.418) [-1187.200] (-1191.547) -- 0:00:00 2000 -- (-1186.950) (-1183.769) [-1188.052] (-1188.207) * [-1187.980] (-1185.269) (-1180.406) (-1184.190) -- 0:00:00 2500 -- (-1189.516) (-1185.704) [-1186.349] (-1188.973) * (-1194.801) (-1186.622) [-1196.433] (-1187.595) -- 0:00:00 3000 -- [-1187.734] (-1198.755) (-1187.351) (-1187.003) * (-1191.928) (-1189.979) [-1192.262] (-1191.015) -- 0:00:00 3500 -- (-1197.212) (-1187.108) [-1190.451] (-1192.915) * (-1198.449) (-1201.411) [-1193.922] (-1186.493) -- 0:00:00 4000 -- (-1191.912) [-1183.996] (-1187.102) (-1190.502) * [-1187.838] (-1197.293) (-1186.426) (-1190.297) -- 0:04:09 4500 -- (-1187.909) (-1190.753) (-1187.282) [-1183.159] * (-1189.891) (-1192.148) (-1189.260) [-1185.401] -- 0:03:41 5000 -- (-1184.783) (-1190.949) (-1189.674) [-1188.760] * (-1188.593) [-1184.412] (-1188.670) (-1194.133) -- 0:03:19 Average standard deviation of split frequencies: 0.082703 5500 -- (-1184.062) (-1191.197) (-1187.050) [-1184.584] * (-1189.934) (-1195.798) (-1191.932) [-1184.524] -- 0:03:00 6000 -- (-1185.302) [-1188.633] (-1184.667) (-1188.028) * (-1188.249) [-1186.455] (-1187.308) (-1181.404) -- 0:02:45 6500 -- (-1193.079) [-1187.562] (-1186.329) (-1188.144) * (-1187.969) [-1187.405] (-1199.032) (-1185.596) -- 0:02:32 7000 -- [-1190.919] (-1187.235) (-1191.531) (-1187.352) * (-1190.909) (-1177.719) (-1186.464) [-1190.496] -- 0:02:21 7500 -- (-1198.665) (-1184.938) [-1185.904] (-1189.317) * [-1186.888] (-1178.276) (-1183.710) (-1188.547) -- 0:02:12 8000 -- [-1183.428] (-1187.770) (-1187.346) (-1192.537) * (-1198.060) (-1179.847) (-1187.326) [-1190.057] -- 0:02:04 8500 -- (-1185.953) [-1187.596] (-1189.253) (-1189.413) * (-1194.806) (-1178.687) [-1190.655] (-1190.911) -- 0:01:56 9000 -- [-1186.441] (-1192.925) (-1190.289) (-1194.817) * (-1194.933) (-1185.110) [-1185.742] (-1187.687) -- 0:01:50 9500 -- (-1199.673) (-1186.741) (-1185.287) [-1188.549] * (-1184.471) (-1177.318) [-1185.331] (-1190.761) -- 0:01:44 10000 -- (-1183.605) (-1191.083) (-1192.706) [-1186.096] * (-1197.160) (-1179.235) [-1188.577] (-1194.629) -- 0:01:39 Average standard deviation of split frequencies: 0.046299 10500 -- (-1198.235) (-1195.125) [-1188.196] (-1189.364) * (-1192.057) (-1178.914) (-1194.488) [-1189.248] -- 0:01:34 11000 -- (-1185.961) (-1190.614) [-1188.155] (-1188.326) * (-1188.250) (-1178.353) [-1185.409] (-1182.557) -- 0:01:29 11500 -- (-1181.301) (-1190.265) [-1184.478] (-1192.479) * (-1192.594) [-1180.516] (-1187.967) (-1178.898) -- 0:01:25 12000 -- (-1192.614) (-1189.002) (-1189.809) [-1186.033] * (-1190.764) (-1180.454) [-1186.293] (-1179.001) -- 0:01:22 12500 -- [-1194.291] (-1187.313) (-1194.948) (-1184.657) * [-1184.135] (-1178.405) (-1191.540) (-1180.478) -- 0:01:19 13000 -- (-1195.090) (-1180.867) [-1186.184] (-1186.823) * (-1186.837) (-1178.368) [-1186.496] (-1178.091) -- 0:01:15 13500 -- (-1192.338) (-1190.089) [-1184.014] (-1190.710) * [-1191.909] (-1177.945) (-1187.153) (-1179.062) -- 0:01:13 14000 -- (-1181.941) (-1188.932) [-1187.211] (-1186.911) * [-1187.013] (-1176.971) (-1195.025) (-1181.646) -- 0:01:10 14500 -- [-1194.367] (-1190.644) (-1185.474) (-1196.774) * (-1187.246) (-1177.837) [-1185.296] (-1180.752) -- 0:01:07 15000 -- [-1188.433] (-1193.611) (-1186.327) (-1185.052) * (-1192.601) [-1177.120] (-1193.538) (-1178.517) -- 0:01:05 Average standard deviation of split frequencies: 0.053033 15500 -- (-1199.538) (-1184.847) [-1186.274] (-1190.395) * (-1187.714) (-1179.413) (-1186.797) [-1182.131] -- 0:01:03 16000 -- (-1185.957) (-1191.213) (-1188.453) [-1188.486] * (-1194.590) [-1180.716] (-1190.850) (-1183.123) -- 0:01:01 16500 -- (-1189.139) (-1183.808) (-1188.026) [-1188.727] * (-1192.975) [-1180.213] (-1194.448) (-1181.118) -- 0:00:59 17000 -- [-1184.705] (-1194.099) (-1193.264) (-1191.758) * (-1190.199) [-1177.942] (-1195.642) (-1180.283) -- 0:00:57 17500 -- (-1200.219) [-1189.873] (-1186.530) (-1194.143) * (-1191.234) [-1182.518] (-1182.888) (-1181.289) -- 0:00:56 18000 -- [-1191.540] (-1191.774) (-1194.385) (-1183.210) * (-1184.832) [-1180.461] (-1182.651) (-1182.909) -- 0:00:54 18500 -- (-1181.239) [-1194.802] (-1194.558) (-1189.565) * (-1184.331) [-1180.363] (-1190.164) (-1181.918) -- 0:00:53 19000 -- [-1189.404] (-1187.367) (-1189.443) (-1184.780) * (-1181.879) (-1179.768) (-1191.165) [-1183.444] -- 0:00:51 19500 -- [-1188.428] (-1213.793) (-1187.824) (-1189.830) * (-1184.127) (-1181.130) [-1187.148] (-1179.212) -- 0:01:40 20000 -- (-1182.414) (-1189.447) [-1187.362] (-1189.219) * [-1179.443] (-1177.774) (-1187.112) (-1179.579) -- 0:01:38 Average standard deviation of split frequencies: 0.055012 20500 -- [-1183.410] (-1182.103) (-1191.199) (-1196.992) * (-1180.519) [-1178.122] (-1192.556) (-1180.685) -- 0:01:35 21000 -- (-1184.214) (-1182.151) [-1186.353] (-1198.258) * (-1177.500) (-1178.125) [-1188.026] (-1178.988) -- 0:01:33 21500 -- (-1196.167) (-1181.777) (-1200.348) [-1182.673] * (-1179.214) [-1178.412] (-1190.281) (-1186.390) -- 0:01:31 22000 -- (-1193.892) (-1180.280) [-1188.212] (-1188.919) * (-1183.030) [-1180.123] (-1187.841) (-1179.181) -- 0:01:28 22500 -- [-1184.847] (-1181.748) (-1188.551) (-1188.543) * (-1184.959) (-1178.560) [-1188.933] (-1178.734) -- 0:01:26 23000 -- [-1187.849] (-1182.168) (-1184.728) (-1179.478) * [-1181.869] (-1179.803) (-1178.892) (-1179.080) -- 0:01:24 23500 -- (-1197.793) [-1179.343] (-1196.829) (-1180.086) * [-1179.516] (-1180.748) (-1181.611) (-1179.039) -- 0:01:23 24000 -- (-1190.409) [-1177.989] (-1186.612) (-1178.268) * (-1180.140) [-1180.239] (-1181.707) (-1181.018) -- 0:01:21 24500 -- (-1179.767) [-1177.989] (-1189.948) (-1178.281) * (-1178.488) (-1184.585) [-1183.134] (-1182.691) -- 0:01:19 25000 -- (-1180.260) [-1177.143] (-1194.039) (-1177.682) * (-1179.512) (-1180.096) (-1187.821) [-1177.957] -- 0:01:18 Average standard deviation of split frequencies: 0.050939 25500 -- [-1178.084] (-1177.231) (-1193.456) (-1180.732) * (-1176.898) (-1182.643) (-1183.115) [-1178.264] -- 0:01:16 26000 -- (-1179.886) (-1177.525) [-1187.429] (-1179.619) * (-1176.940) (-1180.144) (-1182.227) [-1178.650] -- 0:01:14 26500 -- [-1179.559] (-1178.782) (-1186.683) (-1182.114) * [-1176.997] (-1180.424) (-1180.040) (-1183.107) -- 0:01:13 27000 -- (-1181.577) (-1180.770) (-1189.655) [-1177.935] * [-1177.034] (-1178.725) (-1181.872) (-1179.056) -- 0:01:12 27500 -- (-1186.413) (-1177.410) (-1190.844) [-1179.761] * [-1177.369] (-1179.763) (-1181.884) (-1179.196) -- 0:01:10 28000 -- (-1179.414) (-1182.606) (-1190.009) [-1181.989] * (-1182.504) [-1179.182] (-1179.846) (-1177.822) -- 0:01:09 28500 -- [-1179.843] (-1180.362) (-1184.058) (-1178.556) * (-1180.659) (-1179.208) (-1182.266) [-1177.837] -- 0:01:08 29000 -- (-1178.761) [-1179.971] (-1185.871) (-1178.556) * (-1180.259) [-1177.987] (-1179.185) (-1181.467) -- 0:01:06 29500 -- (-1183.273) (-1179.493) (-1185.249) [-1179.982] * [-1178.152] (-1178.458) (-1178.746) (-1177.609) -- 0:01:05 30000 -- [-1178.690] (-1181.251) (-1189.182) (-1180.043) * (-1179.596) [-1180.243] (-1178.651) (-1177.576) -- 0:01:04 Average standard deviation of split frequencies: 0.057442 30500 -- (-1177.417) (-1178.708) [-1183.539] (-1179.021) * [-1178.874] (-1179.571) (-1179.314) (-1177.519) -- 0:01:03 31000 -- (-1177.195) [-1179.005] (-1189.786) (-1178.927) * (-1180.092) (-1177.988) (-1183.479) [-1177.974] -- 0:01:02 31500 -- (-1177.358) (-1177.632) (-1191.187) [-1182.837] * (-1177.440) (-1177.226) [-1179.515] (-1177.490) -- 0:01:01 32000 -- (-1177.176) (-1179.737) (-1199.418) [-1179.124] * (-1178.258) (-1178.408) (-1184.163) [-1178.320] -- 0:01:00 32500 -- [-1176.928] (-1180.484) (-1187.989) (-1178.466) * (-1179.982) (-1180.583) (-1178.956) [-1179.647] -- 0:00:59 33000 -- (-1177.748) (-1184.086) [-1187.076] (-1177.797) * (-1180.088) (-1178.297) (-1177.932) [-1180.116] -- 0:00:58 33500 -- [-1177.531] (-1178.921) (-1188.228) (-1178.903) * (-1179.200) (-1178.171) [-1177.603] (-1182.511) -- 0:00:57 34000 -- (-1176.984) (-1178.427) (-1186.688) [-1179.317] * (-1177.548) [-1177.844] (-1178.148) (-1181.003) -- 0:00:56 34500 -- [-1177.078] (-1177.478) (-1192.672) (-1179.847) * (-1178.326) [-1177.826] (-1177.644) (-1180.706) -- 0:00:55 35000 -- (-1177.203) (-1178.767) (-1189.848) [-1177.832] * (-1178.954) (-1179.001) [-1180.668] (-1180.193) -- 0:00:55 Average standard deviation of split frequencies: 0.041248 35500 -- (-1178.690) [-1178.208] (-1186.760) (-1177.576) * [-1178.548] (-1181.447) (-1181.180) (-1182.905) -- 0:01:21 36000 -- (-1179.766) (-1180.012) (-1186.066) [-1178.392] * (-1177.778) (-1182.331) [-1177.502] (-1179.162) -- 0:01:20 36500 -- (-1178.084) (-1179.532) (-1182.346) [-1177.709] * (-1177.515) (-1181.408) (-1178.661) [-1180.417] -- 0:01:19 37000 -- (-1178.084) (-1178.808) [-1186.576] (-1177.571) * (-1180.575) (-1182.148) (-1178.427) [-1178.850] -- 0:01:18 37500 -- (-1178.674) [-1180.593] (-1196.589) (-1177.431) * (-1178.625) (-1180.215) [-1179.567] (-1180.334) -- 0:01:17 38000 -- (-1182.214) (-1181.558) [-1190.073] (-1178.016) * (-1178.595) (-1180.599) [-1178.901] (-1178.099) -- 0:01:15 38500 -- [-1180.475] (-1179.227) (-1187.467) (-1179.034) * (-1177.688) (-1183.552) [-1180.332] (-1177.526) -- 0:01:14 39000 -- (-1181.721) [-1177.467] (-1182.493) (-1177.639) * (-1179.300) (-1180.157) (-1179.509) [-1177.223] -- 0:01:13 39500 -- (-1180.586) (-1187.477) (-1189.378) [-1180.769] * (-1181.655) (-1178.495) (-1179.182) [-1178.667] -- 0:01:12 40000 -- [-1177.432] (-1179.340) (-1187.666) (-1177.716) * (-1181.652) (-1178.333) (-1180.907) [-1179.322] -- 0:01:12 Average standard deviation of split frequencies: 0.038640 40500 -- (-1177.615) (-1178.028) [-1186.508] (-1178.487) * (-1177.982) [-1178.372] (-1180.075) (-1182.353) -- 0:01:11 41000 -- (-1177.544) [-1178.819] (-1189.519) (-1180.963) * [-1178.163] (-1178.628) (-1178.356) (-1179.609) -- 0:01:10 41500 -- [-1179.380] (-1182.748) (-1196.205) (-1181.246) * (-1178.001) (-1178.394) (-1177.248) [-1179.211] -- 0:01:09 42000 -- (-1178.637) [-1178.320] (-1183.962) (-1181.143) * (-1177.623) (-1179.275) [-1178.571] (-1180.605) -- 0:01:08 42500 -- [-1183.963] (-1181.529) (-1193.796) (-1180.138) * (-1180.413) (-1179.063) (-1182.025) [-1178.389] -- 0:01:07 43000 -- (-1178.258) (-1179.312) [-1186.984] (-1178.570) * (-1185.304) (-1181.546) [-1179.122] (-1178.435) -- 0:01:06 43500 -- [-1179.272] (-1183.319) (-1205.725) (-1178.498) * (-1178.368) (-1181.633) [-1180.249] (-1177.324) -- 0:01:05 44000 -- (-1179.144) [-1179.472] (-1187.420) (-1179.469) * [-1178.554] (-1180.109) (-1182.512) (-1178.139) -- 0:01:05 44500 -- (-1183.638) (-1181.208) [-1180.881] (-1182.590) * [-1178.862] (-1179.743) (-1178.337) (-1178.762) -- 0:01:04 45000 -- (-1179.633) (-1181.365) [-1189.140] (-1177.193) * [-1179.969] (-1178.065) (-1178.056) (-1181.908) -- 0:01:03 Average standard deviation of split frequencies: 0.035355 45500 -- (-1182.488) (-1178.346) [-1184.790] (-1177.385) * (-1180.140) [-1180.033] (-1177.070) (-1177.430) -- 0:01:02 46000 -- (-1181.179) (-1178.696) (-1178.798) [-1178.446] * [-1180.039] (-1178.849) (-1179.714) (-1178.347) -- 0:01:02 46500 -- (-1183.154) [-1177.709] (-1180.244) (-1178.215) * (-1179.316) [-1178.818] (-1180.012) (-1184.858) -- 0:01:01 47000 -- [-1178.796] (-1177.806) (-1183.342) (-1177.599) * [-1178.607] (-1177.140) (-1183.527) (-1185.001) -- 0:01:00 47500 -- [-1178.571] (-1179.337) (-1183.159) (-1178.360) * (-1178.515) (-1180.648) (-1181.862) [-1182.867] -- 0:01:00 48000 -- (-1178.088) (-1181.615) (-1182.495) [-1177.991] * [-1178.819] (-1179.009) (-1181.580) (-1177.902) -- 0:00:59 48500 -- [-1178.172] (-1183.590) (-1181.654) (-1179.109) * (-1178.202) [-1179.166] (-1178.786) (-1177.969) -- 0:00:58 49000 -- (-1179.363) (-1181.767) [-1178.638] (-1178.529) * (-1178.200) (-1182.494) (-1177.883) [-1179.246] -- 0:00:58 49500 -- (-1179.420) (-1182.505) (-1178.038) [-1178.038] * (-1178.044) (-1184.172) [-1179.327] (-1178.952) -- 0:00:57 50000 -- (-1178.274) (-1181.726) [-1180.216] (-1177.981) * [-1179.903] (-1180.088) (-1179.859) (-1178.158) -- 0:00:57 Average standard deviation of split frequencies: 0.039077 50500 -- [-1179.857] (-1184.044) (-1182.295) (-1180.273) * (-1179.578) (-1178.324) [-1178.767] (-1177.234) -- 0:00:56 51000 -- [-1177.644] (-1179.848) (-1183.674) (-1179.362) * (-1179.841) (-1179.346) (-1177.807) [-1180.206] -- 0:00:55 51500 -- [-1178.014] (-1179.387) (-1181.459) (-1179.818) * (-1178.279) [-1179.216] (-1177.934) (-1179.586) -- 0:01:13 52000 -- (-1178.263) [-1177.550] (-1178.965) (-1177.229) * (-1180.150) (-1177.493) (-1178.490) [-1181.423] -- 0:01:12 52500 -- [-1178.203] (-1179.417) (-1181.563) (-1178.665) * (-1180.748) (-1181.429) (-1180.824) [-1177.770] -- 0:01:12 53000 -- (-1181.263) [-1178.649] (-1183.983) (-1179.757) * [-1179.645] (-1178.840) (-1181.225) (-1177.200) -- 0:01:11 53500 -- (-1182.473) (-1178.785) (-1179.200) [-1178.374] * [-1178.865] (-1180.127) (-1180.818) (-1177.374) -- 0:01:10 54000 -- (-1179.176) (-1179.655) (-1180.294) [-1179.021] * [-1178.873] (-1180.169) (-1180.085) (-1178.299) -- 0:01:10 54500 -- (-1177.528) [-1178.736] (-1178.228) (-1178.635) * (-1181.486) (-1180.864) (-1178.893) [-1177.918] -- 0:01:09 55000 -- (-1178.045) [-1181.299] (-1177.526) (-1179.925) * [-1178.537] (-1180.071) (-1178.200) (-1180.397) -- 0:01:08 Average standard deviation of split frequencies: 0.039985 55500 -- (-1182.802) (-1179.342) (-1177.766) [-1179.254] * (-1178.132) (-1185.572) (-1177.756) [-1179.464] -- 0:01:08 56000 -- (-1180.477) (-1178.695) (-1178.857) [-1178.492] * (-1179.030) (-1184.768) (-1178.205) [-1177.991] -- 0:01:07 56500 -- (-1179.811) [-1178.030] (-1177.998) (-1178.712) * (-1178.186) (-1178.062) (-1179.057) [-1178.549] -- 0:01:06 57000 -- [-1184.280] (-1178.618) (-1177.922) (-1180.541) * (-1179.149) (-1177.348) [-1180.657] (-1179.988) -- 0:01:06 57500 -- (-1181.499) [-1178.970] (-1178.244) (-1178.495) * (-1178.345) (-1179.767) [-1178.317] (-1181.223) -- 0:01:05 58000 -- (-1179.607) (-1181.100) [-1178.286] (-1178.739) * (-1179.644) (-1178.831) (-1177.680) [-1181.793] -- 0:01:04 58500 -- (-1180.655) (-1180.773) (-1179.905) [-1178.146] * (-1181.397) [-1180.839] (-1180.100) (-1183.849) -- 0:01:04 59000 -- (-1179.415) (-1181.373) (-1179.679) [-1178.209] * (-1181.103) [-1177.353] (-1178.334) (-1180.938) -- 0:01:03 59500 -- (-1185.559) (-1178.163) [-1177.648] (-1178.444) * (-1177.383) (-1179.243) [-1178.779] (-1178.446) -- 0:01:03 60000 -- (-1185.041) [-1178.227] (-1177.508) (-1178.418) * (-1178.073) [-1177.374] (-1177.353) (-1177.890) -- 0:01:02 Average standard deviation of split frequencies: 0.035152 60500 -- (-1188.079) (-1177.862) (-1177.341) [-1177.857] * (-1180.690) (-1181.111) (-1178.324) [-1178.822] -- 0:01:02 61000 -- [-1178.879] (-1178.708) (-1177.316) (-1178.471) * (-1182.082) (-1178.306) (-1179.085) [-1180.548] -- 0:01:01 61500 -- [-1179.044] (-1178.599) (-1181.577) (-1179.143) * (-1184.070) (-1180.043) (-1179.628) [-1181.151] -- 0:01:01 62000 -- (-1180.789) (-1181.144) [-1180.775] (-1179.530) * (-1184.070) (-1180.280) (-1179.683) [-1180.986] -- 0:01:00 62500 -- (-1183.857) (-1177.940) [-1179.333] (-1181.118) * (-1182.337) (-1179.598) [-1176.897] (-1180.380) -- 0:01:00 63000 -- [-1182.541] (-1177.878) (-1179.697) (-1180.313) * [-1182.016] (-1180.334) (-1177.133) (-1180.447) -- 0:00:59 63500 -- (-1182.082) [-1177.571] (-1180.878) (-1179.229) * [-1178.174] (-1178.652) (-1179.404) (-1178.875) -- 0:00:58 64000 -- (-1178.245) [-1177.135] (-1179.748) (-1181.059) * (-1179.993) (-1178.161) (-1180.100) [-1180.326] -- 0:00:58 64500 -- (-1177.729) (-1178.342) (-1178.815) [-1180.122] * [-1177.663] (-1177.112) (-1183.057) (-1183.367) -- 0:00:58 65000 -- [-1179.395] (-1178.766) (-1181.738) (-1180.887) * [-1177.716] (-1180.464) (-1177.740) (-1177.248) -- 0:00:57 Average standard deviation of split frequencies: 0.035063 65500 -- (-1179.244) [-1182.240] (-1179.559) (-1178.817) * [-1179.475] (-1178.414) (-1178.498) (-1180.378) -- 0:00:57 66000 -- (-1177.748) (-1182.144) [-1179.206] (-1178.016) * (-1182.856) [-1179.793] (-1178.979) (-1178.728) -- 0:00:56 66500 -- (-1177.830) (-1186.964) [-1178.749] (-1177.071) * (-1184.956) (-1180.385) [-1180.884] (-1179.455) -- 0:00:56 67000 -- (-1177.979) (-1180.561) (-1178.482) [-1177.467] * (-1180.689) [-1178.978] (-1179.245) (-1178.940) -- 0:01:09 67500 -- [-1177.143] (-1181.473) (-1179.502) (-1177.934) * (-1183.224) (-1178.227) (-1178.069) [-1183.288] -- 0:01:09 68000 -- (-1185.292) (-1178.056) (-1178.874) [-1178.835] * [-1182.716] (-1179.784) (-1186.122) (-1180.267) -- 0:01:08 68500 -- [-1180.076] (-1180.609) (-1179.385) (-1176.937) * [-1178.386] (-1178.134) (-1182.480) (-1179.048) -- 0:01:07 69000 -- (-1179.001) (-1180.690) (-1180.055) [-1178.174] * (-1179.563) (-1181.051) (-1183.656) [-1176.989] -- 0:01:07 69500 -- [-1177.663] (-1180.579) (-1178.314) (-1180.370) * (-1178.694) [-1180.226] (-1182.631) (-1180.364) -- 0:01:06 70000 -- (-1179.068) (-1178.495) [-1178.165] (-1178.745) * (-1177.410) (-1180.263) (-1184.456) [-1178.318] -- 0:01:06 Average standard deviation of split frequencies: 0.036356 70500 -- [-1179.068] (-1180.360) (-1178.415) (-1178.868) * (-1178.044) (-1178.054) [-1177.351] (-1177.939) -- 0:01:05 71000 -- (-1178.370) (-1183.770) (-1181.617) [-1177.674] * [-1178.043] (-1178.488) (-1177.294) (-1179.127) -- 0:01:05 71500 -- (-1177.818) [-1179.506] (-1181.071) (-1179.080) * (-1179.292) (-1178.983) (-1177.562) [-1180.658] -- 0:01:04 72000 -- [-1178.468] (-1179.959) (-1179.926) (-1179.076) * (-1179.348) [-1181.516] (-1180.202) (-1178.472) -- 0:01:04 72500 -- (-1177.187) [-1178.952] (-1180.081) (-1178.780) * (-1180.408) [-1178.702] (-1180.129) (-1178.013) -- 0:01:03 73000 -- [-1177.053] (-1182.171) (-1179.589) (-1178.737) * (-1178.909) (-1178.420) [-1179.126] (-1178.900) -- 0:01:03 73500 -- (-1177.876) (-1178.498) (-1183.570) [-1179.708] * (-1177.692) [-1182.865] (-1177.736) (-1178.805) -- 0:01:03 74000 -- (-1180.099) [-1179.993] (-1182.847) (-1178.537) * [-1179.583] (-1180.434) (-1178.064) (-1179.171) -- 0:01:02 74500 -- (-1179.967) [-1177.576] (-1180.850) (-1178.835) * (-1178.596) (-1178.649) (-1177.142) [-1179.175] -- 0:01:02 75000 -- (-1178.387) [-1181.101] (-1179.966) (-1179.217) * (-1178.496) (-1177.735) (-1179.523) [-1179.690] -- 0:01:01 Average standard deviation of split frequencies: 0.034115 75500 -- [-1177.670] (-1187.231) (-1178.952) (-1180.265) * [-1178.288] (-1179.180) (-1180.176) (-1178.993) -- 0:01:01 76000 -- [-1179.463] (-1181.026) (-1178.498) (-1181.192) * [-1178.426] (-1177.917) (-1178.394) (-1189.975) -- 0:01:00 76500 -- [-1179.307] (-1177.551) (-1178.723) (-1178.646) * (-1179.707) (-1178.806) [-1179.283] (-1184.608) -- 0:01:00 77000 -- [-1177.962] (-1178.929) (-1182.110) (-1179.631) * (-1180.918) (-1178.633) (-1177.991) [-1177.561] -- 0:00:59 77500 -- (-1181.976) (-1178.931) [-1177.875] (-1182.025) * (-1180.360) [-1178.873] (-1179.104) (-1178.292) -- 0:00:59 78000 -- (-1179.635) (-1180.754) [-1178.018] (-1184.000) * (-1180.508) [-1179.139] (-1179.004) (-1179.679) -- 0:00:59 78500 -- (-1181.382) (-1178.632) (-1179.507) [-1179.777] * (-1177.086) [-1180.315] (-1177.814) (-1178.742) -- 0:00:58 79000 -- (-1178.230) [-1179.536] (-1178.165) (-1178.780) * (-1177.780) [-1178.096] (-1178.520) (-1178.247) -- 0:00:58 79500 -- (-1178.175) (-1178.041) (-1180.234) [-1177.330] * (-1177.829) (-1179.800) (-1180.578) [-1177.483] -- 0:00:57 80000 -- [-1177.936] (-1177.415) (-1182.848) (-1178.725) * (-1179.773) [-1178.960] (-1180.042) (-1180.895) -- 0:00:57 Average standard deviation of split frequencies: 0.031557 80500 -- (-1179.125) (-1177.685) (-1179.781) [-1178.575] * (-1182.673) (-1181.064) (-1183.635) [-1179.120] -- 0:00:57 81000 -- (-1177.515) (-1177.779) (-1179.736) [-1178.068] * [-1177.961] (-1182.167) (-1178.208) (-1179.136) -- 0:00:56 81500 -- [-1177.327] (-1177.658) (-1179.087) (-1178.089) * (-1177.798) [-1177.929] (-1180.141) (-1179.024) -- 0:00:56 82000 -- [-1178.083] (-1179.271) (-1178.395) (-1179.155) * (-1178.540) [-1178.551] (-1181.539) (-1178.804) -- 0:00:55 82500 -- (-1178.926) [-1179.144] (-1183.068) (-1180.005) * [-1181.551] (-1178.394) (-1180.353) (-1182.143) -- 0:00:55 83000 -- [-1179.530] (-1178.303) (-1178.431) (-1179.998) * (-1180.047) [-1177.897] (-1179.697) (-1181.822) -- 0:00:55 83500 -- (-1177.827) [-1178.137] (-1180.186) (-1178.564) * (-1181.272) [-1181.168] (-1179.992) (-1180.243) -- 0:01:05 84000 -- [-1177.589] (-1178.665) (-1178.070) (-1181.276) * (-1180.191) (-1178.590) [-1177.216] (-1178.990) -- 0:01:05 84500 -- (-1179.170) [-1178.684] (-1178.125) (-1178.943) * (-1181.475) (-1179.811) (-1178.204) [-1179.229] -- 0:01:05 85000 -- [-1178.990] (-1177.823) (-1178.271) (-1180.947) * (-1179.590) (-1178.967) [-1178.362] (-1181.252) -- 0:01:04 Average standard deviation of split frequencies: 0.027158 85500 -- (-1177.382) (-1179.215) (-1178.254) [-1178.062] * [-1179.769] (-1178.328) (-1179.882) (-1182.397) -- 0:01:04 86000 -- (-1177.383) (-1177.872) [-1178.106] (-1177.392) * (-1179.848) (-1177.477) [-1178.068] (-1179.168) -- 0:01:03 86500 -- (-1179.851) (-1184.875) (-1181.167) [-1177.660] * (-1182.135) (-1178.128) (-1177.926) [-1178.603] -- 0:01:03 87000 -- (-1178.873) [-1180.737] (-1179.614) (-1177.450) * (-1178.605) [-1177.834] (-1177.076) (-1179.169) -- 0:01:02 87500 -- [-1180.743] (-1182.270) (-1185.797) (-1179.362) * (-1180.006) [-1179.660] (-1187.032) (-1180.325) -- 0:01:02 88000 -- (-1179.654) [-1178.557] (-1180.873) (-1178.627) * (-1180.661) (-1178.857) [-1182.059] (-1179.021) -- 0:01:02 88500 -- (-1178.801) [-1178.660] (-1181.046) (-1178.859) * [-1177.818] (-1182.621) (-1182.901) (-1179.026) -- 0:01:01 89000 -- (-1179.570) (-1178.279) [-1179.252] (-1178.580) * (-1179.031) (-1183.178) [-1179.352] (-1180.561) -- 0:01:01 89500 -- (-1180.513) (-1177.475) (-1181.072) [-1179.374] * (-1178.602) (-1180.565) [-1180.396] (-1179.074) -- 0:01:01 90000 -- (-1178.359) (-1178.320) (-1180.533) [-1178.987] * (-1179.049) (-1178.525) [-1181.660] (-1178.552) -- 0:01:00 Average standard deviation of split frequencies: 0.025997 90500 -- (-1180.866) (-1181.877) (-1180.794) [-1177.896] * (-1178.950) (-1179.170) (-1182.148) [-1178.148] -- 0:01:00 91000 -- [-1179.428] (-1182.254) (-1177.426) (-1177.425) * (-1180.231) (-1179.430) (-1180.894) [-1180.001] -- 0:00:59 91500 -- (-1183.790) [-1179.875] (-1179.500) (-1177.208) * (-1182.605) [-1178.170] (-1182.436) (-1179.307) -- 0:00:59 92000 -- [-1177.675] (-1179.862) (-1178.195) (-1177.178) * (-1179.696) (-1177.528) (-1183.204) [-1178.354] -- 0:00:59 92500 -- [-1178.189] (-1180.262) (-1178.896) (-1177.640) * (-1179.006) (-1177.528) [-1183.134] (-1178.658) -- 0:00:58 93000 -- (-1178.791) [-1179.875] (-1178.141) (-1178.953) * (-1178.280) (-1180.643) (-1179.373) [-1177.930] -- 0:00:58 93500 -- (-1178.441) (-1178.173) [-1177.336] (-1179.178) * (-1181.512) (-1181.417) (-1178.558) [-1178.380] -- 0:00:58 94000 -- (-1183.415) [-1180.188] (-1177.336) (-1177.555) * (-1178.133) [-1177.508] (-1178.346) (-1181.409) -- 0:00:57 94500 -- (-1179.758) [-1178.989] (-1177.868) (-1177.506) * (-1177.658) (-1179.418) (-1177.740) [-1180.652] -- 0:00:57 95000 -- (-1177.233) (-1179.653) (-1178.150) [-1182.344] * [-1177.492] (-1181.629) (-1178.325) (-1178.297) -- 0:00:57 Average standard deviation of split frequencies: 0.027137 95500 -- (-1180.113) (-1178.338) [-1180.113] (-1177.749) * (-1177.702) [-1180.201] (-1178.560) (-1177.565) -- 0:00:56 96000 -- (-1182.005) (-1178.178) (-1179.193) [-1179.312] * (-1177.884) (-1177.589) [-1178.781] (-1177.566) -- 0:00:56 96500 -- (-1179.020) [-1178.841] (-1181.884) (-1180.896) * (-1179.213) (-1180.564) (-1180.386) [-1178.291] -- 0:00:56 97000 -- (-1178.498) (-1177.595) (-1180.989) [-1178.366] * (-1178.810) (-1179.458) [-1178.514] (-1180.364) -- 0:00:55 97500 -- (-1187.977) [-1179.108] (-1178.102) (-1181.459) * (-1177.981) (-1182.584) (-1177.830) [-1177.993] -- 0:00:55 98000 -- (-1182.233) (-1182.239) (-1178.066) [-1178.169] * (-1178.715) (-1179.438) [-1179.438] (-1178.906) -- 0:00:55 98500 -- (-1181.819) (-1182.740) (-1180.341) [-1179.632] * (-1179.181) (-1180.504) (-1182.601) [-1179.825] -- 0:00:54 99000 -- [-1180.910] (-1179.638) (-1177.817) (-1183.859) * (-1180.755) (-1181.523) [-1177.566] (-1178.452) -- 0:00:54 99500 -- [-1180.577] (-1186.080) (-1177.811) (-1182.240) * (-1177.850) (-1177.391) [-1177.203] (-1178.716) -- 0:00:54 100000 -- (-1183.367) (-1185.360) (-1177.807) [-1179.719] * [-1179.660] (-1178.297) (-1177.384) (-1179.676) -- 0:01:02 Average standard deviation of split frequencies: 0.026125 100500 -- (-1183.053) (-1181.083) [-1177.428] (-1181.155) * (-1178.639) (-1178.481) (-1178.559) [-1179.578] -- 0:01:02 101000 -- (-1181.615) [-1180.434] (-1179.208) (-1182.206) * [-1179.242] (-1180.303) (-1177.161) (-1179.191) -- 0:01:02 101500 -- (-1180.096) [-1177.869] (-1177.995) (-1178.017) * [-1177.337] (-1179.676) (-1179.305) (-1179.067) -- 0:01:01 102000 -- (-1178.159) (-1178.104) [-1180.163] (-1179.431) * (-1177.133) [-1179.790] (-1178.187) (-1179.761) -- 0:01:01 102500 -- (-1178.964) (-1178.600) (-1178.300) [-1180.921] * (-1177.464) [-1178.318] (-1183.242) (-1178.784) -- 0:01:01 103000 -- (-1180.318) (-1177.744) (-1181.534) [-1178.858] * [-1178.497] (-1182.680) (-1177.889) (-1182.106) -- 0:01:00 103500 -- [-1183.642] (-1179.704) (-1181.318) (-1180.092) * [-1179.350] (-1178.348) (-1178.931) (-1178.491) -- 0:01:00 104000 -- [-1183.489] (-1178.273) (-1179.311) (-1181.254) * (-1181.368) (-1177.806) (-1179.914) [-1178.842] -- 0:01:00 104500 -- [-1183.822] (-1177.982) (-1178.585) (-1180.446) * (-1179.991) (-1179.109) (-1181.092) [-1177.995] -- 0:00:59 105000 -- (-1180.904) [-1179.592] (-1178.585) (-1180.837) * (-1176.978) [-1177.570] (-1180.141) (-1178.098) -- 0:00:59 Average standard deviation of split frequencies: 0.024354 105500 -- (-1180.392) (-1183.195) (-1180.076) [-1179.451] * (-1179.758) (-1178.628) [-1178.442] (-1177.453) -- 0:00:59 106000 -- (-1179.780) (-1178.912) (-1180.289) [-1177.274] * (-1178.384) [-1177.790] (-1179.899) (-1177.465) -- 0:00:59 106500 -- (-1181.477) (-1178.963) (-1180.193) [-1177.991] * (-1182.068) (-1178.503) [-1181.099] (-1177.716) -- 0:00:58 107000 -- (-1182.736) (-1179.069) (-1178.621) [-1178.852] * [-1178.189] (-1177.906) (-1184.370) (-1178.453) -- 0:00:58 107500 -- (-1180.664) (-1183.218) [-1178.627] (-1178.756) * (-1177.349) (-1178.225) (-1177.879) [-1178.208] -- 0:00:58 108000 -- (-1180.258) [-1177.865] (-1178.321) (-1178.835) * (-1177.465) [-1178.382] (-1177.880) (-1181.425) -- 0:00:57 108500 -- (-1179.972) (-1179.687) [-1179.311] (-1181.806) * (-1179.482) [-1178.364] (-1179.943) (-1181.947) -- 0:00:57 109000 -- (-1182.307) (-1178.273) (-1181.308) [-1179.290] * (-1177.182) [-1179.276] (-1180.892) (-1182.894) -- 0:00:57 109500 -- (-1182.130) (-1179.170) [-1180.487] (-1178.009) * [-1178.069] (-1181.164) (-1182.153) (-1180.990) -- 0:00:56 110000 -- (-1181.744) (-1178.808) (-1177.619) [-1179.314] * [-1179.073] (-1182.066) (-1181.644) (-1182.962) -- 0:00:56 Average standard deviation of split frequencies: 0.022515 110500 -- [-1178.773] (-1178.874) (-1179.066) (-1179.542) * (-1181.532) [-1182.103] (-1182.042) (-1186.059) -- 0:00:56 111000 -- (-1178.231) (-1179.539) [-1178.032] (-1181.382) * (-1179.991) (-1179.300) (-1179.541) [-1182.098] -- 0:00:56 111500 -- (-1179.276) [-1178.168] (-1179.210) (-1180.996) * (-1180.789) (-1178.966) [-1178.464] (-1182.233) -- 0:00:55 112000 -- (-1177.537) [-1178.237] (-1178.420) (-1178.051) * (-1178.431) (-1179.484) (-1180.246) [-1178.939] -- 0:00:55 112500 -- (-1177.336) (-1182.317) (-1178.994) [-1179.674] * (-1178.446) (-1177.320) (-1178.177) [-1178.366] -- 0:00:55 113000 -- (-1177.506) [-1177.841] (-1177.293) (-1179.748) * (-1179.404) (-1177.934) [-1179.453] (-1179.973) -- 0:00:54 113500 -- (-1177.496) (-1177.724) (-1177.450) [-1179.669] * (-1178.285) [-1178.315] (-1178.180) (-1182.375) -- 0:00:54 114000 -- (-1178.228) [-1177.576] (-1179.770) (-1179.270) * (-1178.521) (-1180.998) [-1177.671] (-1180.442) -- 0:00:54 114500 -- (-1179.749) [-1178.161] (-1177.172) (-1179.183) * (-1184.192) [-1177.857] (-1178.254) (-1180.018) -- 0:00:54 115000 -- (-1179.685) (-1180.332) [-1177.364] (-1178.136) * (-1180.280) (-1179.143) (-1177.600) [-1178.437] -- 0:00:53 Average standard deviation of split frequencies: 0.024169 115500 -- [-1179.453] (-1179.901) (-1179.214) (-1178.509) * (-1177.628) (-1178.580) (-1177.915) [-1179.493] -- 0:00:53 116000 -- (-1176.789) [-1179.866] (-1177.655) (-1178.358) * [-1178.201] (-1179.391) (-1177.816) (-1178.043) -- 0:01:00 116500 -- (-1177.362) (-1178.448) [-1178.213] (-1179.786) * (-1177.940) (-1178.213) [-1181.589] (-1178.757) -- 0:01:00 117000 -- (-1177.788) [-1179.868] (-1177.766) (-1179.816) * (-1178.633) (-1180.598) (-1184.695) [-1178.639] -- 0:01:00 117500 -- [-1177.532] (-1178.926) (-1177.496) (-1181.051) * [-1178.056] (-1178.212) (-1186.870) (-1179.511) -- 0:01:00 118000 -- (-1177.338) (-1180.121) [-1181.884] (-1182.028) * (-1178.840) (-1179.196) [-1178.680] (-1181.651) -- 0:00:59 118500 -- (-1177.398) (-1181.747) [-1179.846] (-1181.098) * (-1178.055) [-1179.476] (-1179.256) (-1181.665) -- 0:00:59 119000 -- (-1179.101) (-1179.878) (-1177.782) [-1180.772] * [-1177.652] (-1182.240) (-1179.442) (-1180.115) -- 0:00:59 119500 -- (-1176.999) [-1179.383] (-1178.916) (-1178.337) * (-1178.724) [-1177.661] (-1181.640) (-1179.229) -- 0:00:58 120000 -- (-1177.431) (-1181.620) (-1178.025) [-1178.647] * (-1178.770) (-1177.137) (-1181.498) [-1178.798] -- 0:00:58 Average standard deviation of split frequencies: 0.024308 120500 -- (-1176.843) (-1179.541) (-1178.264) [-1179.539] * [-1178.446] (-1178.120) (-1179.285) (-1178.564) -- 0:00:58 121000 -- (-1178.349) (-1179.418) (-1179.175) [-1180.141] * (-1179.352) [-1178.317] (-1181.249) (-1177.301) -- 0:00:58 121500 -- [-1179.474] (-1178.790) (-1179.786) (-1182.365) * (-1180.084) [-1180.158] (-1178.834) (-1177.275) -- 0:00:57 122000 -- (-1182.079) [-1177.784] (-1182.507) (-1177.300) * [-1181.440] (-1181.531) (-1181.726) (-1177.966) -- 0:00:57 122500 -- (-1180.143) [-1178.262] (-1178.783) (-1178.171) * (-1178.455) [-1178.080] (-1182.977) (-1177.428) -- 0:00:57 123000 -- (-1180.877) (-1178.388) (-1180.849) [-1177.488] * (-1178.992) (-1178.805) (-1178.206) [-1177.746] -- 0:00:57 123500 -- (-1179.198) [-1179.922] (-1181.950) (-1178.019) * [-1180.619] (-1179.192) (-1177.930) (-1182.657) -- 0:00:56 124000 -- (-1179.478) (-1180.245) [-1179.472] (-1182.642) * [-1178.964] (-1180.891) (-1178.088) (-1178.449) -- 0:00:56 124500 -- (-1178.185) (-1181.517) [-1177.760] (-1178.765) * (-1179.086) (-1180.792) [-1177.990] (-1180.363) -- 0:00:56 125000 -- (-1181.056) [-1178.927] (-1177.817) (-1179.314) * [-1178.807] (-1178.323) (-1177.767) (-1180.539) -- 0:00:56 Average standard deviation of split frequencies: 0.021463 125500 -- (-1183.586) (-1180.345) [-1178.946] (-1182.549) * [-1178.564] (-1178.925) (-1179.841) (-1178.763) -- 0:00:55 126000 -- [-1184.502] (-1184.305) (-1180.514) (-1180.507) * [-1177.989] (-1182.931) (-1178.186) (-1178.254) -- 0:00:55 126500 -- [-1180.891] (-1189.342) (-1179.695) (-1179.158) * (-1178.262) (-1177.861) (-1178.671) [-1178.353] -- 0:00:55 127000 -- [-1179.147] (-1177.577) (-1178.614) (-1179.743) * (-1179.409) [-1178.102] (-1182.064) (-1182.269) -- 0:00:54 127500 -- (-1178.972) (-1178.857) (-1178.056) [-1179.579] * (-1181.026) [-1178.718] (-1179.483) (-1180.105) -- 0:00:54 128000 -- (-1181.548) [-1177.454] (-1178.151) (-1178.700) * (-1181.344) (-1180.626) (-1178.082) [-1180.960] -- 0:00:54 128500 -- [-1179.939] (-1179.376) (-1179.563) (-1179.841) * (-1183.141) [-1180.353] (-1179.319) (-1177.416) -- 0:00:54 129000 -- [-1178.477] (-1180.918) (-1177.542) (-1182.258) * (-1179.649) (-1179.036) [-1178.550] (-1177.265) -- 0:00:54 129500 -- (-1178.915) (-1180.303) [-1177.272] (-1182.810) * [-1179.640] (-1180.534) (-1178.927) (-1177.519) -- 0:00:53 130000 -- (-1178.210) (-1182.818) [-1177.108] (-1181.603) * [-1181.912] (-1179.480) (-1177.846) (-1177.843) -- 0:00:53 Average standard deviation of split frequencies: 0.022026 130500 -- (-1178.293) (-1184.744) (-1177.970) [-1180.460] * [-1179.408] (-1179.840) (-1177.187) (-1179.196) -- 0:00:53 131000 -- (-1178.107) [-1181.265] (-1180.717) (-1179.149) * (-1180.890) (-1179.379) [-1177.298] (-1185.144) -- 0:00:53 131500 -- (-1178.840) [-1178.730] (-1180.316) (-1178.591) * [-1178.194] (-1181.020) (-1178.005) (-1189.450) -- 0:00:52 132000 -- (-1182.774) [-1178.721] (-1178.725) (-1178.840) * [-1177.337] (-1180.753) (-1177.443) (-1180.707) -- 0:00:52 132500 -- (-1179.720) [-1181.352] (-1179.557) (-1178.781) * (-1182.195) (-1178.858) (-1177.747) [-1177.505] -- 0:00:58 133000 -- [-1179.523] (-1178.341) (-1177.812) (-1178.268) * [-1179.950] (-1179.154) (-1178.235) (-1178.033) -- 0:00:58 133500 -- (-1178.206) (-1178.803) [-1179.707] (-1181.488) * (-1178.885) [-1180.800] (-1181.573) (-1178.985) -- 0:00:58 134000 -- (-1179.587) [-1178.283] (-1180.991) (-1178.479) * (-1178.918) [-1177.316] (-1179.048) (-1180.499) -- 0:00:58 134500 -- (-1178.366) (-1178.414) (-1177.775) [-1178.325] * (-1181.943) [-1178.249] (-1180.039) (-1184.035) -- 0:00:57 135000 -- (-1180.250) [-1178.614] (-1181.823) (-1181.788) * (-1180.523) (-1180.651) (-1179.994) [-1180.897] -- 0:00:57 Average standard deviation of split frequencies: 0.023652 135500 -- [-1180.328] (-1180.146) (-1183.351) (-1177.694) * (-1181.371) (-1181.388) [-1185.072] (-1179.844) -- 0:00:57 136000 -- (-1178.248) (-1180.462) (-1180.069) [-1179.272] * (-1183.051) (-1178.296) (-1178.948) [-1177.247] -- 0:00:57 136500 -- (-1178.790) (-1185.942) [-1179.922] (-1178.085) * (-1178.297) (-1180.346) (-1179.306) [-1178.045] -- 0:00:56 137000 -- (-1178.018) (-1182.152) (-1178.837) [-1179.362] * (-1178.776) [-1179.482] (-1179.642) (-1177.479) -- 0:00:56 137500 -- (-1180.839) (-1180.201) [-1177.923] (-1182.370) * [-1178.599] (-1179.346) (-1181.042) (-1178.007) -- 0:00:56 138000 -- (-1184.065) (-1178.669) [-1177.629] (-1184.843) * (-1177.547) [-1178.097] (-1179.110) (-1178.353) -- 0:00:56 138500 -- (-1184.888) [-1178.884] (-1179.629) (-1178.398) * (-1182.451) (-1178.716) [-1178.602] (-1179.787) -- 0:00:55 139000 -- (-1183.483) [-1179.949] (-1179.870) (-1178.373) * (-1179.687) (-1182.449) (-1178.717) [-1179.433] -- 0:00:55 139500 -- (-1180.406) [-1181.307] (-1179.297) (-1177.395) * (-1181.666) [-1180.203] (-1181.702) (-1181.259) -- 0:00:55 140000 -- (-1180.101) (-1178.331) (-1181.564) [-1177.750] * (-1178.666) (-1179.699) [-1180.848] (-1178.271) -- 0:00:55 Average standard deviation of split frequencies: 0.024641 140500 -- (-1180.454) [-1177.142] (-1180.226) (-1177.859) * (-1178.102) [-1180.921] (-1182.967) (-1181.106) -- 0:00:55 141000 -- (-1179.024) [-1178.166] (-1179.892) (-1178.823) * (-1178.102) [-1177.369] (-1179.540) (-1182.175) -- 0:00:54 141500 -- (-1178.312) [-1177.542] (-1180.473) (-1177.627) * (-1180.050) [-1177.838] (-1181.200) (-1177.793) -- 0:00:54 142000 -- (-1178.272) (-1177.905) [-1178.872] (-1180.684) * [-1180.194] (-1177.441) (-1179.708) (-1178.267) -- 0:00:54 142500 -- (-1181.168) [-1177.416] (-1179.281) (-1179.912) * (-1179.448) [-1177.348] (-1180.486) (-1177.390) -- 0:00:54 143000 -- (-1179.958) [-1178.160] (-1178.827) (-1177.232) * (-1181.008) (-1180.030) (-1177.543) [-1177.253] -- 0:00:53 143500 -- [-1177.697] (-1177.486) (-1179.296) (-1177.234) * (-1180.023) (-1179.234) [-1177.947] (-1177.257) -- 0:00:53 144000 -- (-1178.373) (-1177.586) (-1178.989) [-1179.903] * (-1180.226) (-1180.232) (-1178.388) [-1184.220] -- 0:00:53 144500 -- (-1177.820) (-1180.104) [-1181.000] (-1179.181) * (-1178.064) (-1178.653) [-1179.477] (-1181.790) -- 0:00:53 145000 -- [-1177.803] (-1179.327) (-1181.032) (-1184.090) * (-1179.894) (-1180.531) (-1179.136) [-1178.684] -- 0:00:53 Average standard deviation of split frequencies: 0.022781 145500 -- (-1178.109) [-1182.439] (-1181.069) (-1183.932) * (-1180.658) [-1178.152] (-1181.712) (-1179.622) -- 0:00:52 146000 -- [-1181.117] (-1177.700) (-1180.815) (-1188.735) * (-1179.483) (-1181.127) (-1181.772) [-1178.560] -- 0:00:52 146500 -- [-1180.584] (-1178.404) (-1178.638) (-1184.530) * (-1186.765) [-1178.777] (-1183.354) (-1178.183) -- 0:00:52 147000 -- [-1181.052] (-1179.394) (-1178.691) (-1179.445) * (-1178.865) [-1180.439] (-1180.004) (-1181.060) -- 0:00:52 147500 -- (-1179.431) (-1179.502) (-1178.183) [-1177.628] * (-1180.324) (-1180.877) (-1180.699) [-1181.706] -- 0:00:52 148000 -- (-1180.662) (-1177.439) (-1178.157) [-1178.349] * [-1183.316] (-1178.526) (-1177.179) (-1180.547) -- 0:00:51 148500 -- [-1180.683] (-1178.279) (-1180.084) (-1179.682) * (-1180.695) (-1179.217) [-1179.541] (-1182.438) -- 0:00:57 149000 -- (-1181.481) [-1179.521] (-1177.303) (-1177.688) * (-1180.954) [-1178.298] (-1180.071) (-1180.031) -- 0:00:57 149500 -- (-1186.833) (-1180.069) (-1177.277) [-1178.132] * [-1185.173] (-1183.708) (-1181.129) (-1180.129) -- 0:00:56 150000 -- (-1184.279) (-1178.909) [-1179.003] (-1179.540) * [-1177.820] (-1178.456) (-1181.022) (-1179.538) -- 0:00:56 Average standard deviation of split frequencies: 0.018443 150500 -- (-1180.289) (-1178.519) [-1177.915] (-1179.154) * (-1178.545) [-1179.524] (-1177.310) (-1183.158) -- 0:00:56 151000 -- (-1180.570) (-1178.535) (-1180.362) [-1179.615] * (-1179.804) [-1180.893] (-1177.547) (-1181.835) -- 0:00:56 151500 -- (-1177.815) (-1178.508) [-1181.917] (-1180.928) * (-1181.663) (-1178.450) [-1177.462] (-1178.912) -- 0:00:56 152000 -- (-1178.647) (-1181.039) (-1180.257) [-1179.153] * (-1182.798) [-1178.652] (-1178.720) (-1180.895) -- 0:00:55 152500 -- (-1177.802) (-1179.224) (-1181.952) [-1179.360] * (-1179.352) (-1177.621) (-1180.252) [-1181.748] -- 0:00:55 153000 -- [-1177.956] (-1178.478) (-1182.155) (-1180.726) * (-1177.569) (-1179.245) (-1179.338) [-1181.336] -- 0:00:55 153500 -- [-1178.117] (-1178.855) (-1178.557) (-1179.810) * (-1177.850) (-1180.595) (-1178.514) [-1178.721] -- 0:00:55 154000 -- (-1179.988) (-1177.221) [-1179.214] (-1179.194) * [-1177.973] (-1179.453) (-1180.934) (-1180.035) -- 0:00:54 154500 -- (-1182.112) (-1179.388) [-1178.110] (-1178.958) * (-1179.190) (-1180.401) [-1178.568] (-1179.051) -- 0:00:54 155000 -- [-1178.489] (-1177.939) (-1182.812) (-1177.556) * (-1179.096) (-1185.115) (-1179.989) [-1183.516] -- 0:00:54 Average standard deviation of split frequencies: 0.018449 155500 -- (-1178.494) (-1178.129) [-1178.175] (-1180.139) * (-1178.861) [-1178.918] (-1179.304) (-1178.464) -- 0:00:54 156000 -- (-1179.704) [-1179.420] (-1179.513) (-1178.535) * [-1178.741] (-1180.100) (-1178.862) (-1177.557) -- 0:00:54 156500 -- (-1178.274) (-1178.024) (-1178.797) [-1182.328] * [-1177.337] (-1180.307) (-1177.797) (-1178.191) -- 0:00:53 157000 -- [-1177.771] (-1177.722) (-1179.168) (-1180.420) * [-1178.141] (-1179.143) (-1178.986) (-1179.295) -- 0:00:53 157500 -- [-1179.297] (-1177.725) (-1177.288) (-1180.958) * [-1177.602] (-1181.098) (-1179.258) (-1182.624) -- 0:00:53 158000 -- (-1179.315) (-1179.004) [-1184.591] (-1179.398) * (-1178.870) (-1180.213) (-1180.350) [-1178.960] -- 0:00:53 158500 -- (-1178.977) (-1178.896) (-1182.837) [-1180.073] * [-1179.200] (-1177.804) (-1177.490) (-1179.437) -- 0:00:53 159000 -- (-1179.681) [-1180.798] (-1181.865) (-1178.848) * (-1180.702) [-1180.862] (-1177.713) (-1178.243) -- 0:00:52 159500 -- [-1179.732] (-1178.696) (-1177.069) (-1177.038) * [-1186.775] (-1181.125) (-1177.828) (-1178.943) -- 0:00:52 160000 -- (-1178.798) (-1179.603) (-1178.788) [-1178.362] * [-1182.688] (-1178.316) (-1179.109) (-1179.965) -- 0:00:52 Average standard deviation of split frequencies: 0.020538 160500 -- [-1178.357] (-1178.985) (-1180.449) (-1179.034) * (-1183.833) (-1179.340) (-1182.643) [-1178.075] -- 0:00:52 161000 -- (-1178.418) [-1179.845] (-1180.099) (-1178.866) * (-1177.905) [-1178.159] (-1179.571) (-1179.148) -- 0:00:52 161500 -- (-1179.199) (-1180.427) [-1179.460] (-1182.723) * [-1178.201] (-1179.685) (-1180.111) (-1178.932) -- 0:00:51 162000 -- (-1180.339) (-1180.374) [-1182.896] (-1180.314) * [-1178.562] (-1177.745) (-1182.097) (-1179.592) -- 0:00:51 162500 -- (-1179.770) [-1179.364] (-1181.384) (-1179.238) * (-1179.202) (-1180.277) [-1179.729] (-1178.428) -- 0:00:51 163000 -- (-1178.971) (-1182.738) [-1181.628] (-1184.156) * (-1183.472) [-1177.781] (-1183.050) (-1179.398) -- 0:00:51 163500 -- (-1181.518) (-1179.474) (-1179.292) [-1179.834] * (-1179.162) (-1178.211) (-1179.589) [-1180.191] -- 0:00:51 164000 -- (-1181.374) (-1180.757) (-1178.450) [-1178.268] * (-1181.814) [-1182.792] (-1177.187) (-1179.495) -- 0:00:50 164500 -- [-1178.765] (-1179.388) (-1177.702) (-1178.546) * (-1181.573) [-1178.459] (-1178.150) (-1180.829) -- 0:00:55 165000 -- (-1179.848) [-1179.809] (-1185.399) (-1179.071) * (-1183.994) [-1179.373] (-1178.412) (-1179.597) -- 0:00:55 Average standard deviation of split frequencies: 0.019281 165500 -- (-1177.419) (-1178.951) [-1177.831] (-1181.433) * [-1179.762] (-1180.903) (-1179.128) (-1179.255) -- 0:00:55 166000 -- (-1180.990) (-1180.084) [-1177.779] (-1178.416) * [-1181.525] (-1179.765) (-1178.832) (-1179.143) -- 0:00:55 166500 -- (-1181.880) [-1178.221] (-1178.180) (-1177.986) * (-1178.748) (-1177.679) (-1180.216) [-1177.164] -- 0:00:55 167000 -- (-1180.361) [-1179.734] (-1180.038) (-1178.043) * (-1179.236) (-1179.478) [-1177.775] (-1177.788) -- 0:00:54 167500 -- (-1182.739) [-1177.214] (-1178.680) (-1178.947) * (-1177.853) (-1179.223) (-1181.043) [-1178.295] -- 0:00:54 168000 -- (-1179.925) [-1177.755] (-1181.410) (-1177.811) * (-1179.262) (-1177.592) [-1179.321] (-1179.934) -- 0:00:54 168500 -- (-1177.835) (-1179.450) (-1178.307) [-1178.716] * (-1178.653) [-1180.427] (-1177.819) (-1179.048) -- 0:00:54 169000 -- (-1177.380) (-1179.744) (-1181.734) [-1178.723] * (-1179.757) [-1179.521] (-1177.890) (-1178.585) -- 0:00:54 169500 -- [-1177.708] (-1179.438) (-1177.734) (-1177.163) * (-1179.005) (-1178.610) [-1177.921] (-1180.112) -- 0:00:53 170000 -- [-1177.730] (-1180.765) (-1181.955) (-1177.386) * (-1178.329) [-1178.279] (-1177.916) (-1180.185) -- 0:00:53 Average standard deviation of split frequencies: 0.017736 170500 -- (-1177.741) (-1180.161) [-1180.473] (-1178.702) * (-1179.710) (-1178.243) (-1181.190) [-1179.844] -- 0:00:53 171000 -- (-1178.829) (-1177.363) (-1179.262) [-1179.872] * [-1180.516] (-1178.220) (-1179.680) (-1179.614) -- 0:00:53 171500 -- (-1184.382) (-1179.230) (-1181.325) [-1180.131] * [-1177.171] (-1178.371) (-1180.428) (-1178.377) -- 0:00:53 172000 -- (-1180.015) (-1177.605) (-1177.352) [-1178.756] * [-1177.184] (-1178.263) (-1181.421) (-1182.369) -- 0:00:52 172500 -- (-1179.864) (-1178.054) (-1178.758) [-1180.517] * (-1180.137) (-1178.250) (-1179.520) [-1180.552] -- 0:00:52 173000 -- (-1180.553) [-1178.646] (-1179.179) (-1182.068) * (-1180.315) [-1177.755] (-1178.951) (-1176.993) -- 0:00:52 173500 -- [-1179.941] (-1179.429) (-1179.788) (-1178.893) * [-1181.586] (-1180.964) (-1180.060) (-1177.128) -- 0:00:52 174000 -- (-1181.078) (-1178.586) [-1178.808] (-1177.229) * [-1182.323] (-1181.963) (-1180.292) (-1178.526) -- 0:00:52 174500 -- [-1180.296] (-1179.781) (-1178.133) (-1177.262) * (-1180.884) (-1180.440) (-1178.368) [-1178.536] -- 0:00:52 175000 -- (-1179.159) (-1180.326) (-1178.196) [-1178.747] * (-1181.335) [-1179.769] (-1179.056) (-1178.605) -- 0:00:51 Average standard deviation of split frequencies: 0.016916 175500 -- (-1179.211) (-1179.112) (-1178.263) [-1178.681] * (-1185.168) (-1183.083) (-1180.931) [-1177.615] -- 0:00:51 176000 -- [-1186.095] (-1177.839) (-1178.399) (-1180.789) * (-1179.787) [-1182.985] (-1177.563) (-1179.207) -- 0:00:51 176500 -- [-1178.466] (-1180.410) (-1178.555) (-1179.476) * (-1179.958) [-1180.281] (-1180.120) (-1181.352) -- 0:00:51 177000 -- [-1179.408] (-1181.250) (-1178.261) (-1179.954) * [-1176.988] (-1177.232) (-1178.133) (-1180.491) -- 0:00:51 177500 -- (-1183.965) [-1179.625] (-1179.238) (-1181.313) * (-1180.229) [-1177.516] (-1179.560) (-1178.640) -- 0:00:50 178000 -- (-1181.593) (-1181.418) [-1177.211] (-1178.754) * (-1181.084) [-1179.529] (-1179.107) (-1179.380) -- 0:00:50 178500 -- (-1183.376) (-1177.995) (-1179.924) [-1180.483] * [-1177.636] (-1178.023) (-1178.735) (-1177.490) -- 0:00:50 179000 -- (-1189.862) [-1178.970] (-1179.194) (-1180.085) * [-1177.746] (-1178.741) (-1177.647) (-1182.536) -- 0:00:50 179500 -- (-1180.897) (-1178.551) [-1178.622] (-1182.499) * (-1177.396) (-1178.258) (-1180.868) [-1177.487] -- 0:00:50 180000 -- (-1180.416) [-1178.430] (-1178.341) (-1177.748) * (-1180.262) (-1182.866) (-1177.858) [-1178.071] -- 0:00:50 Average standard deviation of split frequencies: 0.017540 180500 -- [-1181.809] (-1178.493) (-1180.503) (-1180.412) * [-1183.527] (-1182.011) (-1178.418) (-1178.334) -- 0:00:49 181000 -- (-1179.503) (-1179.646) [-1177.754] (-1179.910) * (-1181.806) (-1180.039) [-1178.843] (-1178.602) -- 0:00:54 181500 -- [-1182.734] (-1182.051) (-1179.201) (-1179.657) * [-1180.278] (-1178.453) (-1178.844) (-1183.684) -- 0:00:54 182000 -- [-1177.883] (-1180.385) (-1178.799) (-1180.840) * [-1182.251] (-1179.715) (-1179.603) (-1183.330) -- 0:00:53 182500 -- (-1177.657) (-1178.757) [-1179.853] (-1179.513) * [-1178.443] (-1180.489) (-1177.737) (-1179.149) -- 0:00:53 183000 -- (-1180.040) (-1177.449) [-1178.258] (-1177.961) * (-1179.177) [-1180.077] (-1177.927) (-1178.292) -- 0:00:53 183500 -- (-1180.152) [-1177.923] (-1181.702) (-1180.341) * (-1179.574) (-1179.752) (-1178.941) [-1179.130] -- 0:00:53 184000 -- (-1182.760) [-1177.906] (-1179.910) (-1181.378) * (-1178.632) (-1178.494) [-1179.936] (-1179.033) -- 0:00:53 184500 -- (-1186.142) [-1177.218] (-1178.517) (-1182.202) * (-1177.917) (-1178.147) (-1178.803) [-1179.083] -- 0:00:53 185000 -- (-1180.023) [-1177.720] (-1178.921) (-1178.166) * (-1182.164) (-1179.422) (-1181.196) [-1179.042] -- 0:00:52 Average standard deviation of split frequencies: 0.018304 185500 -- [-1180.117] (-1178.703) (-1179.682) (-1178.200) * (-1181.722) (-1177.479) (-1178.470) [-1178.212] -- 0:00:52 186000 -- (-1178.296) [-1177.934] (-1178.361) (-1177.992) * [-1183.588] (-1178.799) (-1178.714) (-1179.063) -- 0:00:52 186500 -- (-1178.307) (-1177.926) [-1179.999] (-1178.025) * (-1179.737) [-1179.905] (-1177.895) (-1178.883) -- 0:00:52 187000 -- (-1183.322) (-1179.342) [-1178.994] (-1177.609) * [-1179.440] (-1178.386) (-1178.846) (-1178.848) -- 0:00:52 187500 -- [-1178.876] (-1178.272) (-1178.549) (-1179.403) * (-1180.008) (-1179.777) (-1179.146) [-1177.768] -- 0:00:52 188000 -- [-1179.512] (-1178.520) (-1179.460) (-1183.907) * (-1179.057) (-1179.739) (-1178.460) [-1177.668] -- 0:00:51 188500 -- (-1178.499) (-1177.903) [-1178.595] (-1182.242) * [-1180.091] (-1178.051) (-1177.518) (-1178.563) -- 0:00:51 189000 -- [-1178.288] (-1177.567) (-1178.636) (-1178.742) * [-1179.811] (-1178.600) (-1178.127) (-1177.341) -- 0:00:51 189500 -- [-1178.527] (-1178.889) (-1178.253) (-1180.654) * [-1178.488] (-1177.914) (-1178.064) (-1178.554) -- 0:00:51 190000 -- (-1181.048) [-1180.536] (-1182.442) (-1188.046) * (-1177.244) (-1177.914) (-1177.591) [-1180.569] -- 0:00:51 Average standard deviation of split frequencies: 0.019092 190500 -- (-1179.426) [-1180.054] (-1182.750) (-1188.704) * [-1177.200] (-1179.779) (-1181.513) (-1178.038) -- 0:00:50 191000 -- (-1177.034) [-1179.055] (-1181.418) (-1182.420) * (-1179.186) (-1179.006) (-1179.946) [-1178.683] -- 0:00:50 191500 -- (-1177.034) [-1179.282] (-1181.410) (-1179.500) * [-1184.238] (-1181.922) (-1180.142) (-1179.878) -- 0:00:50 192000 -- (-1180.372) [-1178.446] (-1179.996) (-1179.181) * (-1185.977) (-1180.390) (-1178.388) [-1180.722] -- 0:00:50 192500 -- (-1179.197) (-1177.115) (-1181.430) [-1179.034] * [-1177.193] (-1185.908) (-1177.669) (-1178.828) -- 0:00:50 193000 -- (-1180.593) [-1177.502] (-1181.378) (-1179.088) * (-1178.143) (-1181.339) [-1177.874] (-1177.733) -- 0:00:50 193500 -- [-1179.534] (-1178.484) (-1181.578) (-1181.246) * (-1177.080) (-1178.995) [-1179.443] (-1181.116) -- 0:00:50 194000 -- (-1182.394) (-1177.418) (-1181.025) [-1179.759] * (-1177.103) [-1180.675] (-1180.098) (-1178.760) -- 0:00:49 194500 -- (-1180.387) [-1177.651] (-1178.451) (-1179.844) * (-1178.588) (-1179.556) [-1178.697] (-1177.482) -- 0:00:49 195000 -- (-1180.916) (-1177.865) (-1181.060) [-1178.379] * (-1177.297) (-1183.283) (-1177.545) [-1177.464] -- 0:00:49 Average standard deviation of split frequencies: 0.018439 195500 -- (-1177.350) (-1179.480) [-1180.043] (-1182.565) * (-1180.923) (-1177.767) [-1178.824] (-1177.722) -- 0:00:49 196000 -- (-1179.302) (-1177.880) (-1179.844) [-1178.814] * (-1187.350) (-1177.699) (-1179.536) [-1180.997] -- 0:00:49 196500 -- (-1177.658) [-1177.637] (-1179.850) (-1179.305) * (-1183.147) (-1179.633) [-1177.790] (-1177.387) -- 0:00:49 197000 -- (-1178.772) [-1178.019] (-1181.309) (-1184.125) * [-1180.368] (-1178.913) (-1180.592) (-1182.384) -- 0:00:48 197500 -- [-1179.409] (-1177.669) (-1180.208) (-1185.180) * (-1180.352) (-1181.080) [-1179.094] (-1177.740) -- 0:00:52 198000 -- (-1179.392) [-1179.214] (-1184.666) (-1177.665) * (-1180.289) (-1179.297) [-1180.159] (-1178.283) -- 0:00:52 198500 -- [-1178.432] (-1177.132) (-1180.685) (-1177.267) * (-1178.954) (-1179.416) (-1180.858) [-1178.352] -- 0:00:52 199000 -- (-1179.312) (-1177.131) (-1180.239) [-1178.656] * (-1179.988) (-1178.373) (-1180.956) [-1177.209] -- 0:00:52 199500 -- (-1180.057) (-1178.458) [-1177.891] (-1177.506) * [-1179.176] (-1179.718) (-1180.222) (-1179.283) -- 0:00:52 200000 -- (-1177.703) (-1177.901) (-1183.230) [-1178.734] * (-1178.740) (-1179.868) (-1179.348) [-1183.433] -- 0:00:51 Average standard deviation of split frequencies: 0.016738 200500 -- (-1178.304) (-1177.925) [-1178.802] (-1185.547) * [-1180.723] (-1180.430) (-1179.269) (-1180.278) -- 0:00:51 201000 -- (-1179.448) [-1179.484] (-1182.266) (-1179.509) * [-1180.455] (-1181.280) (-1179.618) (-1179.165) -- 0:00:51 201500 -- [-1179.724] (-1179.672) (-1179.124) (-1178.651) * [-1180.602] (-1179.777) (-1179.317) (-1178.561) -- 0:00:51 202000 -- (-1179.146) (-1179.524) (-1179.047) [-1179.213] * (-1185.780) (-1181.971) [-1181.339] (-1178.324) -- 0:00:51 202500 -- (-1178.095) [-1178.834] (-1180.421) (-1178.194) * (-1179.256) (-1179.085) [-1183.352] (-1179.408) -- 0:00:51 203000 -- (-1180.711) (-1177.609) [-1179.672] (-1178.939) * [-1179.463] (-1179.344) (-1181.953) (-1181.520) -- 0:00:51 203500 -- [-1181.394] (-1181.048) (-1180.471) (-1178.353) * (-1179.889) (-1179.923) [-1180.318] (-1180.771) -- 0:00:50 204000 -- (-1181.386) (-1179.040) (-1182.174) [-1178.410] * (-1179.202) [-1178.899] (-1179.222) (-1182.239) -- 0:00:50 204500 -- (-1177.729) (-1177.355) [-1179.244] (-1179.173) * (-1182.667) (-1181.617) [-1181.019] (-1185.611) -- 0:00:50 205000 -- [-1179.098] (-1177.095) (-1177.861) (-1181.458) * (-1182.138) [-1179.549] (-1179.573) (-1183.336) -- 0:00:50 Average standard deviation of split frequencies: 0.015898 205500 -- (-1178.375) [-1179.098] (-1181.797) (-1178.620) * [-1178.836] (-1177.249) (-1185.325) (-1178.726) -- 0:00:50 206000 -- (-1177.060) (-1179.911) [-1177.724] (-1181.484) * [-1178.515] (-1179.583) (-1186.902) (-1179.098) -- 0:00:50 206500 -- [-1178.498] (-1178.769) (-1177.804) (-1177.575) * (-1180.510) [-1178.126] (-1179.545) (-1179.091) -- 0:00:49 207000 -- (-1177.984) (-1177.527) [-1177.506] (-1179.962) * (-1180.314) (-1178.687) [-1178.658] (-1182.184) -- 0:00:49 207500 -- [-1180.024] (-1179.116) (-1177.990) (-1177.828) * (-1179.240) (-1177.745) (-1179.571) [-1179.517] -- 0:00:49 208000 -- (-1187.255) (-1185.630) [-1178.404] (-1178.022) * (-1179.931) (-1177.551) [-1177.423] (-1178.798) -- 0:00:49 208500 -- (-1181.232) (-1184.404) [-1181.376] (-1186.302) * [-1178.722] (-1177.552) (-1177.445) (-1185.689) -- 0:00:49 209000 -- (-1181.551) (-1181.085) (-1181.360) [-1181.346] * (-1177.874) (-1177.133) [-1183.001] (-1178.333) -- 0:00:49 209500 -- (-1180.292) [-1179.465] (-1181.338) (-1181.823) * (-1180.678) (-1178.782) [-1179.278] (-1177.603) -- 0:00:49 210000 -- (-1180.943) (-1178.523) (-1180.098) [-1181.973] * (-1179.351) (-1181.291) [-1180.053] (-1177.016) -- 0:00:48 Average standard deviation of split frequencies: 0.015291 210500 -- (-1180.954) [-1179.460] (-1178.461) (-1182.570) * (-1182.149) (-1180.149) [-1177.288] (-1179.379) -- 0:00:48 211000 -- (-1178.697) (-1180.967) (-1188.386) [-1179.704] * (-1180.014) (-1181.446) [-1177.453] (-1180.363) -- 0:00:48 211500 -- (-1178.796) (-1183.108) (-1179.783) [-1179.573] * (-1179.931) (-1182.184) [-1177.456] (-1179.139) -- 0:00:48 212000 -- (-1178.658) [-1180.840] (-1180.428) (-1178.012) * (-1189.593) (-1182.008) (-1178.310) [-1180.428] -- 0:00:48 212500 -- (-1178.441) (-1179.113) (-1179.314) [-1179.107] * [-1177.582] (-1180.019) (-1180.591) (-1180.217) -- 0:00:48 213000 -- (-1178.698) (-1181.167) [-1178.207] (-1185.617) * (-1179.532) [-1179.171] (-1179.642) (-1179.555) -- 0:00:51 213500 -- [-1178.643] (-1184.321) (-1179.799) (-1180.491) * (-1179.541) (-1179.938) [-1179.443] (-1178.888) -- 0:00:51 214000 -- (-1179.613) (-1177.853) [-1179.492] (-1180.276) * (-1180.971) (-1177.432) [-1178.264] (-1179.382) -- 0:00:51 214500 -- (-1179.868) [-1177.237] (-1177.697) (-1180.425) * [-1179.161] (-1177.921) (-1178.827) (-1177.783) -- 0:00:51 215000 -- (-1178.845) [-1178.214] (-1182.620) (-1178.990) * (-1178.654) (-1180.405) [-1178.653] (-1178.345) -- 0:00:51 Average standard deviation of split frequencies: 0.016441 215500 -- [-1181.338] (-1178.890) (-1184.363) (-1179.329) * (-1177.508) [-1181.279] (-1180.507) (-1179.508) -- 0:00:50 216000 -- (-1183.208) (-1180.624) (-1180.401) [-1177.722] * (-1177.491) [-1180.425] (-1178.174) (-1179.363) -- 0:00:50 216500 -- [-1179.775] (-1179.622) (-1178.406) (-1179.797) * (-1178.008) (-1179.234) [-1177.881] (-1184.954) -- 0:00:50 217000 -- (-1179.822) (-1181.361) [-1179.786] (-1181.071) * (-1179.642) (-1180.335) [-1178.586] (-1181.918) -- 0:00:50 217500 -- (-1178.195) (-1181.360) [-1178.617] (-1181.074) * [-1178.013] (-1179.366) (-1178.459) (-1178.596) -- 0:00:50 218000 -- [-1177.495] (-1177.806) (-1177.596) (-1179.161) * [-1177.049] (-1178.298) (-1178.656) (-1178.578) -- 0:00:50 218500 -- [-1179.235] (-1178.320) (-1178.686) (-1178.747) * (-1180.059) [-1179.018] (-1178.497) (-1184.016) -- 0:00:50 219000 -- (-1179.401) (-1178.082) (-1179.793) [-1178.383] * (-1178.870) (-1180.041) (-1178.815) [-1180.581] -- 0:00:49 219500 -- (-1182.155) (-1180.898) (-1179.511) [-1179.534] * (-1178.133) (-1180.199) [-1177.639] (-1181.086) -- 0:00:49 220000 -- (-1180.597) [-1183.905] (-1180.137) (-1178.998) * (-1180.973) (-1179.104) [-1177.639] (-1177.271) -- 0:00:49 Average standard deviation of split frequencies: 0.014812 220500 -- (-1179.925) (-1177.441) [-1178.599] (-1179.223) * (-1184.116) (-1177.984) (-1181.605) [-1177.598] -- 0:00:49 221000 -- (-1186.624) [-1179.471] (-1179.595) (-1184.832) * (-1180.374) [-1178.802] (-1177.545) (-1178.887) -- 0:00:49 221500 -- (-1182.892) [-1177.254] (-1182.319) (-1180.323) * (-1178.287) (-1177.623) [-1177.039] (-1179.387) -- 0:00:49 222000 -- [-1180.717] (-1181.584) (-1183.464) (-1183.010) * (-1178.448) (-1178.454) [-1178.035] (-1179.594) -- 0:00:49 222500 -- [-1182.461] (-1181.420) (-1178.983) (-1184.338) * (-1178.920) (-1177.739) (-1177.711) [-1178.295] -- 0:00:48 223000 -- [-1178.153] (-1178.744) (-1179.201) (-1180.474) * (-1178.045) (-1177.302) [-1178.996] (-1179.604) -- 0:00:48 223500 -- (-1181.556) (-1180.132) (-1178.285) [-1178.525] * (-1178.262) (-1177.417) (-1179.206) [-1179.467] -- 0:00:48 224000 -- (-1178.905) [-1179.417] (-1182.861) (-1178.494) * [-1181.925] (-1179.981) (-1178.906) (-1185.766) -- 0:00:48 224500 -- (-1182.114) [-1177.345] (-1178.280) (-1178.282) * (-1180.282) (-1177.709) [-1180.712] (-1181.411) -- 0:00:48 225000 -- (-1178.651) (-1177.827) [-1180.488] (-1178.785) * (-1179.830) (-1180.060) (-1179.733) [-1183.560] -- 0:00:48 Average standard deviation of split frequencies: 0.013374 225500 -- [-1182.614] (-1177.774) (-1181.297) (-1177.466) * (-1177.581) [-1177.028] (-1177.934) (-1180.935) -- 0:00:48 226000 -- (-1182.403) (-1180.720) (-1181.774) [-1177.845] * [-1181.913] (-1177.758) (-1177.899) (-1179.865) -- 0:00:47 226500 -- (-1178.906) (-1178.448) [-1178.403] (-1178.311) * [-1179.370] (-1179.772) (-1179.696) (-1179.213) -- 0:00:47 227000 -- (-1179.347) (-1177.471) [-1178.669] (-1180.009) * (-1178.407) (-1180.592) (-1178.626) [-1177.190] -- 0:00:47 227500 -- (-1178.342) [-1179.546] (-1178.955) (-1177.298) * (-1184.326) (-1179.430) (-1178.125) [-1177.494] -- 0:00:47 228000 -- (-1178.488) [-1177.832] (-1179.126) (-1177.300) * (-1180.460) (-1181.432) (-1178.868) [-1177.948] -- 0:00:47 228500 -- [-1179.869] (-1179.965) (-1177.744) (-1177.300) * (-1183.510) [-1178.721] (-1179.924) (-1177.949) -- 0:00:47 229000 -- (-1182.396) (-1182.761) [-1180.330] (-1178.040) * [-1180.821] (-1177.614) (-1178.562) (-1177.993) -- 0:00:47 229500 -- (-1178.862) [-1179.767] (-1184.617) (-1183.333) * [-1178.262] (-1178.631) (-1179.948) (-1178.611) -- 0:00:50 230000 -- (-1179.602) (-1179.267) (-1181.947) [-1179.219] * (-1178.611) (-1178.002) (-1183.083) [-1178.569] -- 0:00:50 Average standard deviation of split frequencies: 0.011354 230500 -- (-1182.294) (-1181.544) [-1183.140] (-1180.295) * (-1181.163) (-1183.028) [-1181.395] (-1177.932) -- 0:00:50 231000 -- [-1178.588] (-1181.023) (-1179.684) (-1178.719) * (-1179.998) (-1179.128) [-1181.701] (-1178.039) -- 0:00:49 231500 -- (-1179.377) (-1183.187) [-1179.003] (-1182.645) * [-1179.770] (-1179.290) (-1177.348) (-1185.172) -- 0:00:49 232000 -- [-1177.437] (-1180.128) (-1178.823) (-1178.462) * (-1177.325) (-1180.257) [-1178.216] (-1185.857) -- 0:00:49 232500 -- (-1183.078) [-1178.777] (-1178.165) (-1178.948) * (-1177.416) (-1184.557) (-1180.158) [-1179.864] -- 0:00:49 233000 -- (-1179.753) [-1178.645] (-1178.019) (-1178.574) * (-1181.035) (-1178.255) [-1178.718] (-1182.154) -- 0:00:49 233500 -- (-1178.689) (-1182.101) (-1178.775) [-1179.770] * (-1182.596) (-1178.836) (-1179.446) [-1177.279] -- 0:00:49 234000 -- (-1181.240) (-1182.449) [-1178.341] (-1179.046) * [-1182.072] (-1178.964) (-1178.653) (-1177.166) -- 0:00:49 234500 -- (-1182.840) (-1178.379) [-1178.180] (-1179.099) * (-1181.669) (-1179.341) (-1177.752) [-1179.354] -- 0:00:48 235000 -- (-1178.267) [-1179.196] (-1179.998) (-1177.784) * (-1178.845) (-1178.318) (-1178.435) [-1177.725] -- 0:00:48 Average standard deviation of split frequencies: 0.013206 235500 -- (-1181.009) (-1177.283) (-1178.734) [-1178.660] * (-1177.686) (-1180.823) [-1179.222] (-1179.613) -- 0:00:48 236000 -- (-1178.395) (-1177.642) [-1178.046] (-1177.440) * [-1181.508] (-1178.486) (-1181.369) (-1179.067) -- 0:00:48 236500 -- (-1179.214) (-1180.849) [-1178.899] (-1178.255) * (-1182.860) [-1179.018] (-1182.412) (-1179.697) -- 0:00:48 237000 -- (-1182.855) (-1178.654) [-1178.601] (-1177.225) * (-1178.057) (-1182.080) (-1179.313) [-1177.609] -- 0:00:48 237500 -- [-1181.301] (-1178.874) (-1178.252) (-1177.420) * (-1179.271) [-1179.825] (-1180.413) (-1177.658) -- 0:00:48 238000 -- (-1183.921) [-1177.978] (-1177.833) (-1177.002) * (-1180.557) [-1179.195] (-1180.903) (-1180.403) -- 0:00:48 238500 -- [-1181.928] (-1177.694) (-1179.977) (-1177.319) * (-1178.293) (-1178.400) (-1177.552) [-1179.265] -- 0:00:47 239000 -- (-1181.476) (-1177.705) [-1179.701] (-1177.860) * (-1180.113) (-1184.284) (-1180.808) [-1180.378] -- 0:00:47 239500 -- [-1180.080] (-1181.006) (-1178.553) (-1178.890) * [-1179.801] (-1178.183) (-1182.329) (-1179.025) -- 0:00:47 240000 -- (-1179.379) (-1181.249) (-1181.119) [-1177.506] * (-1178.860) (-1177.690) [-1178.009] (-1183.810) -- 0:00:47 Average standard deviation of split frequencies: 0.012213 240500 -- (-1179.487) [-1179.850] (-1181.296) (-1177.311) * [-1181.006] (-1177.815) (-1178.544) (-1182.439) -- 0:00:47 241000 -- (-1178.482) [-1178.500] (-1179.174) (-1179.631) * (-1178.940) (-1181.549) [-1179.074] (-1180.293) -- 0:00:47 241500 -- (-1178.517) [-1178.012] (-1180.550) (-1180.710) * (-1181.219) [-1179.040] (-1177.540) (-1179.492) -- 0:00:47 242000 -- (-1178.129) [-1177.872] (-1179.728) (-1180.599) * (-1177.367) (-1177.758) (-1178.329) [-1177.901] -- 0:00:46 242500 -- (-1179.753) (-1177.849) [-1177.350] (-1182.523) * (-1180.776) (-1177.206) (-1178.756) [-1178.083] -- 0:00:46 243000 -- (-1180.261) [-1177.269] (-1177.724) (-1179.576) * (-1177.925) [-1178.415] (-1180.747) (-1177.499) -- 0:00:46 243500 -- (-1178.915) (-1178.226) (-1181.410) [-1178.653] * (-1179.421) [-1178.625] (-1184.015) (-1178.031) -- 0:00:46 244000 -- (-1178.273) (-1179.076) (-1187.953) [-1178.021] * (-1179.480) (-1179.253) (-1179.979) [-1177.978] -- 0:00:46 244500 -- (-1178.966) (-1180.268) (-1184.689) [-1179.241] * [-1179.401] (-1178.730) (-1182.839) (-1177.667) -- 0:00:46 245000 -- (-1180.410) (-1179.161) [-1179.904] (-1177.888) * (-1179.599) (-1180.347) [-1179.232] (-1177.626) -- 0:00:46 Average standard deviation of split frequencies: 0.013307 245500 -- [-1178.565] (-1178.217) (-1178.073) (-1180.034) * (-1177.305) (-1177.797) [-1177.320] (-1178.299) -- 0:00:46 246000 -- (-1184.352) [-1178.219] (-1178.358) (-1179.075) * [-1177.717] (-1178.310) (-1178.357) (-1178.003) -- 0:00:49 246500 -- (-1180.618) (-1178.115) [-1178.269] (-1178.248) * (-1179.971) (-1186.581) [-1177.970] (-1178.417) -- 0:00:48 247000 -- [-1178.720] (-1180.747) (-1178.776) (-1181.942) * (-1183.136) (-1179.094) [-1178.169] (-1180.231) -- 0:00:48 247500 -- (-1178.683) (-1178.677) [-1177.321] (-1180.632) * (-1179.900) (-1182.023) [-1179.222] (-1181.579) -- 0:00:48 248000 -- (-1179.237) (-1177.335) [-1177.361] (-1180.867) * (-1181.354) [-1186.126] (-1176.989) (-1178.094) -- 0:00:48 248500 -- (-1178.910) [-1178.419] (-1177.360) (-1177.536) * [-1181.541] (-1179.418) (-1181.006) (-1177.580) -- 0:00:48 249000 -- (-1181.335) (-1180.837) [-1177.602] (-1178.556) * [-1181.535] (-1177.089) (-1182.467) (-1179.332) -- 0:00:48 249500 -- (-1179.412) (-1177.303) (-1177.217) [-1180.307] * [-1181.161] (-1177.487) (-1181.658) (-1178.740) -- 0:00:48 250000 -- (-1179.245) (-1180.351) [-1179.128] (-1181.742) * [-1180.963] (-1187.064) (-1177.558) (-1179.188) -- 0:00:48 Average standard deviation of split frequencies: 0.011947 250500 -- [-1179.731] (-1177.720) (-1185.750) (-1182.205) * [-1181.187] (-1180.072) (-1179.066) (-1178.225) -- 0:00:47 251000 -- [-1180.788] (-1181.228) (-1178.765) (-1180.438) * [-1179.386] (-1181.584) (-1177.785) (-1179.098) -- 0:00:47 251500 -- [-1180.866] (-1179.281) (-1178.790) (-1181.718) * (-1178.523) (-1182.335) [-1177.780] (-1179.647) -- 0:00:47 252000 -- (-1180.450) (-1178.613) (-1177.779) [-1177.199] * (-1177.626) (-1179.830) (-1177.719) [-1180.618] -- 0:00:47 252500 -- (-1181.139) (-1180.955) [-1177.758] (-1178.838) * (-1177.812) (-1181.306) (-1179.026) [-1177.075] -- 0:00:47 253000 -- (-1185.455) (-1177.341) [-1177.409] (-1177.820) * [-1177.597] (-1180.516) (-1180.953) (-1178.135) -- 0:00:47 253500 -- (-1177.702) (-1177.426) [-1177.022] (-1177.780) * (-1178.940) [-1179.462] (-1178.055) (-1180.470) -- 0:00:47 254000 -- [-1178.397] (-1179.511) (-1177.038) (-1178.668) * (-1178.135) (-1179.780) (-1180.924) [-1181.679] -- 0:00:46 254500 -- (-1177.734) (-1181.715) (-1177.009) [-1179.432] * [-1177.569] (-1177.835) (-1179.775) (-1180.547) -- 0:00:46 255000 -- (-1178.369) [-1181.805] (-1177.227) (-1179.149) * (-1179.439) (-1181.030) [-1177.424] (-1177.187) -- 0:00:46 Average standard deviation of split frequencies: 0.012023 255500 -- (-1184.732) [-1179.993] (-1178.596) (-1177.347) * [-1181.852] (-1179.363) (-1177.656) (-1179.260) -- 0:00:46 256000 -- [-1177.699] (-1178.926) (-1177.267) (-1180.568) * (-1183.050) (-1178.586) (-1177.910) [-1180.168] -- 0:00:46 256500 -- (-1178.154) (-1180.646) (-1179.230) [-1178.791] * [-1181.341] (-1177.627) (-1177.693) (-1177.549) -- 0:00:46 257000 -- [-1179.575] (-1182.154) (-1179.642) (-1178.281) * (-1178.985) (-1177.621) (-1179.217) [-1178.557] -- 0:00:46 257500 -- (-1178.906) [-1179.676] (-1179.440) (-1182.124) * (-1178.422) [-1178.850] (-1177.562) (-1183.954) -- 0:00:46 258000 -- (-1180.374) (-1181.197) [-1177.251] (-1179.880) * [-1178.712] (-1183.076) (-1177.674) (-1183.197) -- 0:00:46 258500 -- (-1179.305) (-1177.434) (-1177.278) [-1178.689] * (-1179.515) [-1182.603] (-1179.742) (-1182.177) -- 0:00:45 259000 -- (-1180.725) (-1177.981) [-1177.493] (-1179.710) * [-1178.928] (-1178.669) (-1180.257) (-1181.314) -- 0:00:45 259500 -- (-1179.655) [-1179.348] (-1183.412) (-1180.450) * (-1178.943) (-1179.428) (-1179.491) [-1180.328] -- 0:00:45 260000 -- (-1177.984) (-1179.558) [-1177.419] (-1180.151) * [-1179.780] (-1180.651) (-1177.852) (-1179.408) -- 0:00:45 Average standard deviation of split frequencies: 0.011915 260500 -- (-1181.006) [-1180.047] (-1181.469) (-1181.347) * (-1179.172) (-1180.775) [-1178.921] (-1179.558) -- 0:00:45 261000 -- [-1180.086] (-1179.950) (-1184.904) (-1185.600) * (-1177.857) (-1181.181) [-1178.002] (-1179.559) -- 0:00:45 261500 -- [-1178.514] (-1181.537) (-1178.852) (-1180.111) * [-1177.638] (-1178.791) (-1178.935) (-1177.796) -- 0:00:45 262000 -- [-1180.769] (-1180.122) (-1179.547) (-1179.907) * (-1178.411) [-1177.821] (-1181.583) (-1179.508) -- 0:00:47 262500 -- [-1178.221] (-1179.700) (-1178.911) (-1184.034) * (-1178.621) [-1177.703] (-1182.222) (-1179.604) -- 0:00:47 263000 -- (-1177.542) [-1177.409] (-1182.875) (-1180.920) * (-1178.374) (-1181.459) [-1180.554] (-1178.625) -- 0:00:47 263500 -- (-1181.318) (-1178.617) [-1177.571] (-1179.369) * [-1176.976] (-1182.136) (-1178.345) (-1178.598) -- 0:00:47 264000 -- (-1180.913) (-1176.957) [-1179.621] (-1184.780) * (-1177.728) (-1178.778) [-1178.688] (-1180.805) -- 0:00:47 264500 -- (-1180.405) (-1178.768) [-1179.877] (-1178.059) * [-1176.890] (-1178.973) (-1178.711) (-1179.740) -- 0:00:47 265000 -- (-1180.033) [-1179.677] (-1177.442) (-1178.655) * (-1177.455) [-1180.269] (-1180.727) (-1180.069) -- 0:00:47 Average standard deviation of split frequencies: 0.011676 265500 -- (-1185.259) (-1177.633) [-1178.196] (-1178.874) * [-1180.294] (-1181.559) (-1179.172) (-1178.268) -- 0:00:47 266000 -- [-1181.517] (-1177.719) (-1178.148) (-1178.648) * (-1178.445) (-1178.578) (-1178.146) [-1178.708] -- 0:00:46 266500 -- (-1181.927) [-1177.506] (-1179.369) (-1179.333) * (-1179.760) (-1177.991) (-1178.573) [-1179.344] -- 0:00:46 267000 -- (-1179.338) [-1181.844] (-1181.537) (-1180.995) * (-1179.059) (-1182.019) (-1178.654) [-1178.003] -- 0:00:46 267500 -- (-1178.877) (-1181.293) (-1181.333) [-1179.113] * (-1178.806) (-1179.313) (-1181.546) [-1178.675] -- 0:00:46 268000 -- (-1178.925) [-1180.219] (-1179.051) (-1179.079) * (-1184.172) (-1179.912) (-1179.613) [-1180.026] -- 0:00:46 268500 -- (-1177.916) (-1177.771) (-1181.332) [-1180.669] * (-1180.887) (-1185.189) [-1181.533] (-1179.760) -- 0:00:46 269000 -- (-1178.277) (-1179.473) (-1178.921) [-1182.734] * (-1183.260) (-1180.713) [-1178.140] (-1178.445) -- 0:00:46 269500 -- (-1178.046) (-1180.478) (-1179.503) [-1179.902] * (-1177.785) [-1178.889] (-1178.514) (-1177.874) -- 0:00:46 270000 -- (-1178.971) (-1179.498) [-1177.709] (-1180.805) * (-1178.884) [-1178.307] (-1180.807) (-1180.507) -- 0:00:45 Average standard deviation of split frequencies: 0.012704 270500 -- [-1178.082] (-1178.887) (-1180.725) (-1179.130) * [-1178.732] (-1181.312) (-1182.362) (-1181.149) -- 0:00:45 271000 -- (-1179.399) (-1178.457) [-1178.727] (-1179.806) * (-1179.561) [-1178.232] (-1181.643) (-1182.795) -- 0:00:45 271500 -- (-1177.080) [-1178.894] (-1178.800) (-1178.733) * (-1184.094) (-1178.387) (-1179.126) [-1181.037] -- 0:00:45 272000 -- [-1178.357] (-1180.539) (-1182.573) (-1179.937) * (-1182.306) (-1183.460) (-1179.777) [-1179.478] -- 0:00:45 272500 -- (-1178.087) (-1183.376) [-1180.509] (-1180.997) * (-1179.418) (-1185.500) (-1179.634) [-1182.061] -- 0:00:45 273000 -- [-1178.684] (-1183.863) (-1179.889) (-1182.686) * [-1178.796] (-1179.308) (-1178.334) (-1181.551) -- 0:00:45 273500 -- (-1178.431) (-1182.909) [-1179.752] (-1180.442) * (-1185.624) (-1178.554) (-1181.091) [-1178.818] -- 0:00:45 274000 -- (-1182.378) (-1182.977) (-1179.371) [-1179.096] * (-1177.782) (-1182.889) [-1188.097] (-1179.096) -- 0:00:45 274500 -- [-1181.976] (-1178.350) (-1181.512) (-1180.288) * (-1179.329) (-1178.991) [-1178.453] (-1179.270) -- 0:00:44 275000 -- (-1180.002) (-1178.063) [-1180.447] (-1179.668) * (-1179.835) [-1179.533] (-1177.842) (-1186.234) -- 0:00:44 Average standard deviation of split frequencies: 0.013344 275500 -- [-1183.366] (-1177.614) (-1181.358) (-1178.144) * (-1178.724) [-1178.850] (-1178.580) (-1178.612) -- 0:00:44 276000 -- (-1179.468) [-1177.304] (-1178.189) (-1178.527) * (-1181.568) [-1180.493] (-1180.010) (-1179.079) -- 0:00:44 276500 -- [-1181.653] (-1181.508) (-1178.891) (-1178.169) * (-1180.956) [-1179.718] (-1181.171) (-1180.585) -- 0:00:44 277000 -- (-1177.920) [-1178.590] (-1178.859) (-1180.784) * (-1179.207) (-1178.581) (-1179.775) [-1178.016] -- 0:00:44 277500 -- (-1181.630) [-1178.323] (-1179.030) (-1179.234) * (-1178.740) (-1178.560) (-1179.757) [-1177.990] -- 0:00:44 278000 -- [-1179.254] (-1177.773) (-1181.582) (-1177.852) * (-1179.012) (-1181.254) (-1181.525) [-1177.806] -- 0:00:46 278500 -- (-1179.694) [-1177.599] (-1177.735) (-1178.632) * (-1179.962) (-1177.952) [-1181.619] (-1178.134) -- 0:00:46 279000 -- [-1180.050] (-1180.096) (-1179.417) (-1178.724) * (-1178.770) [-1179.687] (-1178.256) (-1179.650) -- 0:00:46 279500 -- (-1179.529) [-1177.633] (-1181.171) (-1182.807) * (-1179.757) (-1177.906) [-1178.731] (-1178.969) -- 0:00:46 280000 -- (-1179.105) (-1179.054) (-1180.226) [-1181.500] * (-1179.784) (-1177.784) [-1180.028] (-1178.564) -- 0:00:46 Average standard deviation of split frequencies: 0.013122 280500 -- (-1178.239) (-1178.655) [-1178.282] (-1183.776) * (-1180.011) [-1180.964] (-1179.077) (-1177.472) -- 0:00:46 281000 -- [-1178.975] (-1182.555) (-1178.508) (-1179.011) * (-1178.866) [-1181.347] (-1178.836) (-1180.428) -- 0:00:46 281500 -- (-1178.073) (-1182.397) (-1179.076) [-1178.801] * (-1180.520) [-1177.907] (-1186.281) (-1180.155) -- 0:00:45 282000 -- [-1178.073] (-1185.976) (-1179.076) (-1177.973) * (-1177.890) [-1179.477] (-1178.575) (-1179.765) -- 0:00:45 282500 -- (-1179.453) (-1183.688) (-1179.401) [-1177.748] * (-1179.928) [-1180.275] (-1178.405) (-1179.004) -- 0:00:45 283000 -- (-1180.048) (-1180.570) (-1179.244) [-1178.168] * (-1181.131) (-1179.796) [-1177.452] (-1180.540) -- 0:00:45 283500 -- (-1179.268) (-1179.456) [-1179.814] (-1178.709) * (-1181.411) [-1181.454] (-1179.219) (-1186.402) -- 0:00:45 284000 -- (-1176.938) (-1179.260) [-1179.515] (-1178.369) * (-1180.258) (-1179.757) [-1180.817] (-1181.611) -- 0:00:45 284500 -- (-1181.586) [-1179.078] (-1181.973) (-1178.327) * [-1181.571] (-1178.301) (-1179.567) (-1178.680) -- 0:00:45 285000 -- (-1177.741) (-1181.230) (-1177.681) [-1178.249] * (-1179.563) [-1177.054] (-1179.536) (-1180.215) -- 0:00:45 Average standard deviation of split frequencies: 0.013392 285500 -- (-1178.070) [-1181.752] (-1178.739) (-1178.376) * (-1181.493) [-1177.347] (-1183.567) (-1179.373) -- 0:00:45 286000 -- (-1178.674) [-1178.724] (-1177.952) (-1179.965) * (-1179.473) [-1177.868] (-1179.662) (-1178.354) -- 0:00:44 286500 -- (-1183.075) (-1178.136) (-1181.709) [-1178.523] * [-1180.532] (-1178.524) (-1181.457) (-1179.242) -- 0:00:44 287000 -- (-1180.827) (-1178.108) [-1178.445] (-1182.421) * (-1181.897) [-1181.496] (-1180.270) (-1177.989) -- 0:00:44 287500 -- (-1181.549) [-1178.805] (-1179.891) (-1183.453) * [-1178.467] (-1178.587) (-1180.200) (-1179.406) -- 0:00:44 288000 -- (-1183.275) (-1177.158) (-1179.444) [-1178.673] * (-1180.875) (-1180.727) [-1179.886] (-1177.163) -- 0:00:44 288500 -- [-1180.704] (-1180.608) (-1179.499) (-1179.637) * (-1181.603) (-1182.384) [-1180.837] (-1177.665) -- 0:00:44 289000 -- [-1180.087] (-1181.704) (-1178.908) (-1180.900) * [-1180.297] (-1180.245) (-1178.401) (-1178.120) -- 0:00:44 289500 -- (-1179.891) (-1180.725) [-1182.608] (-1181.875) * [-1177.675] (-1182.022) (-1184.199) (-1177.241) -- 0:00:44 290000 -- (-1180.264) [-1183.580] (-1180.222) (-1182.955) * (-1177.602) [-1180.487] (-1177.215) (-1179.307) -- 0:00:44 Average standard deviation of split frequencies: 0.012164 290500 -- [-1178.234] (-1183.143) (-1177.026) (-1178.119) * (-1179.072) (-1178.122) [-1177.949] (-1181.868) -- 0:00:43 291000 -- (-1178.571) [-1179.802] (-1177.653) (-1179.663) * (-1182.653) (-1181.390) (-1180.728) [-1180.079] -- 0:00:43 291500 -- (-1180.340) (-1180.995) [-1177.578] (-1180.592) * [-1178.003] (-1180.700) (-1179.045) (-1178.826) -- 0:00:43 292000 -- (-1181.491) (-1181.807) [-1178.560] (-1179.228) * (-1178.633) [-1183.621] (-1181.361) (-1180.041) -- 0:00:43 292500 -- (-1179.486) [-1181.188] (-1179.618) (-1180.766) * (-1180.804) (-1179.618) (-1179.519) [-1179.430] -- 0:00:43 293000 -- (-1184.786) (-1178.832) (-1182.790) [-1180.255] * [-1178.480] (-1178.978) (-1179.673) (-1179.443) -- 0:00:43 293500 -- (-1183.177) [-1178.058] (-1182.574) (-1178.536) * (-1177.455) (-1178.391) (-1178.954) [-1180.464] -- 0:00:43 294000 -- [-1179.862] (-1177.084) (-1180.699) (-1181.547) * (-1181.137) [-1180.985] (-1180.950) (-1179.041) -- 0:00:43 294500 -- (-1179.226) (-1177.179) (-1178.852) [-1179.315] * (-1180.190) [-1181.367] (-1178.573) (-1181.749) -- 0:00:45 295000 -- [-1182.306] (-1177.515) (-1180.754) (-1179.859) * (-1187.799) (-1178.536) (-1181.206) [-1186.239] -- 0:00:45 Average standard deviation of split frequencies: 0.011845 295500 -- [-1181.174] (-1177.955) (-1180.188) (-1179.581) * (-1178.817) [-1178.545] (-1177.773) (-1180.990) -- 0:00:45 296000 -- [-1184.126] (-1179.727) (-1178.790) (-1182.521) * (-1178.655) (-1177.589) [-1179.103] (-1178.582) -- 0:00:45 296500 -- (-1180.916) [-1179.592] (-1177.948) (-1179.000) * [-1178.029] (-1179.840) (-1181.005) (-1183.405) -- 0:00:45 297000 -- (-1180.005) (-1181.950) (-1182.256) [-1179.104] * (-1178.029) [-1182.234] (-1180.054) (-1182.237) -- 0:00:44 297500 -- (-1178.679) (-1182.164) [-1179.434] (-1178.518) * (-1177.612) [-1180.678] (-1181.280) (-1179.026) -- 0:00:44 298000 -- (-1178.811) (-1179.732) [-1178.492] (-1179.703) * [-1178.408] (-1179.053) (-1178.262) (-1178.935) -- 0:00:44 298500 -- (-1178.360) (-1180.544) [-1182.978] (-1179.687) * (-1177.274) (-1177.785) (-1181.059) [-1178.854] -- 0:00:44 299000 -- (-1179.921) (-1178.589) [-1177.560] (-1182.265) * [-1179.899] (-1181.393) (-1180.524) (-1180.558) -- 0:00:44 299500 -- [-1179.195] (-1178.638) (-1181.811) (-1179.356) * (-1178.382) (-1181.757) [-1178.360] (-1180.264) -- 0:00:44 300000 -- (-1177.670) (-1181.751) [-1179.085] (-1178.502) * (-1178.831) (-1184.278) (-1177.325) [-1179.943] -- 0:00:44 Average standard deviation of split frequencies: 0.012739 300500 -- [-1177.824] (-1178.386) (-1178.625) (-1180.149) * [-1177.113] (-1182.307) (-1177.542) (-1180.929) -- 0:00:44 301000 -- (-1177.792) [-1178.157] (-1180.852) (-1178.911) * (-1177.546) (-1180.227) [-1182.920] (-1180.011) -- 0:00:44 301500 -- [-1179.222] (-1179.024) (-1182.595) (-1180.316) * [-1177.487] (-1178.545) (-1183.454) (-1179.481) -- 0:00:44 302000 -- [-1179.682] (-1177.541) (-1178.045) (-1178.006) * (-1177.418) [-1177.502] (-1181.822) (-1177.992) -- 0:00:43 302500 -- [-1183.459] (-1177.153) (-1178.783) (-1177.789) * (-1177.436) (-1177.503) (-1178.422) [-1179.331] -- 0:00:43 303000 -- (-1179.292) (-1179.478) (-1177.984) [-1178.547] * (-1177.274) (-1183.598) (-1179.199) [-1177.661] -- 0:00:43 303500 -- (-1178.684) (-1182.482) (-1177.341) [-1178.992] * (-1177.510) (-1176.929) [-1182.215] (-1180.169) -- 0:00:43 304000 -- (-1177.848) (-1178.107) [-1177.208] (-1178.486) * (-1179.915) (-1178.554) (-1180.478) [-1182.169] -- 0:00:43 304500 -- (-1178.786) [-1178.168] (-1182.085) (-1180.399) * (-1177.973) [-1177.577] (-1181.881) (-1182.055) -- 0:00:43 305000 -- (-1179.659) (-1177.972) [-1178.652] (-1181.577) * (-1177.635) (-1179.458) (-1180.945) [-1179.529] -- 0:00:43 Average standard deviation of split frequencies: 0.012998 305500 -- (-1183.310) (-1179.148) [-1180.284] (-1180.016) * (-1178.996) [-1177.945] (-1180.985) (-1179.190) -- 0:00:43 306000 -- [-1181.497] (-1180.913) (-1182.085) (-1180.328) * (-1180.020) (-1179.383) [-1182.038] (-1177.641) -- 0:00:43 306500 -- (-1178.139) (-1179.062) [-1182.129] (-1179.622) * (-1182.097) (-1178.626) (-1178.615) [-1177.787] -- 0:00:42 307000 -- (-1178.375) [-1178.539] (-1180.299) (-1177.909) * (-1182.342) (-1178.853) (-1180.201) [-1179.349] -- 0:00:42 307500 -- [-1179.103] (-1177.182) (-1177.134) (-1178.575) * (-1180.724) (-1177.548) (-1181.051) [-1178.688] -- 0:00:42 308000 -- (-1178.076) (-1176.935) [-1184.301] (-1181.578) * (-1187.752) (-1179.145) (-1180.152) [-1178.998] -- 0:00:42 308500 -- [-1177.496] (-1177.022) (-1181.276) (-1179.175) * (-1184.463) [-1178.305] (-1180.283) (-1178.387) -- 0:00:42 309000 -- [-1178.984] (-1181.196) (-1178.663) (-1182.473) * [-1179.095] (-1179.470) (-1188.397) (-1178.641) -- 0:00:42 309500 -- (-1180.683) (-1177.949) (-1180.377) [-1178.434] * (-1179.287) [-1181.820] (-1180.864) (-1178.065) -- 0:00:42 310000 -- (-1182.571) (-1177.659) (-1177.851) [-1179.895] * (-1178.443) (-1183.976) [-1183.610] (-1178.376) -- 0:00:42 Average standard deviation of split frequencies: 0.013182 310500 -- (-1184.386) [-1177.276] (-1178.187) (-1180.325) * (-1177.467) [-1178.352] (-1181.660) (-1179.276) -- 0:00:44 311000 -- (-1178.292) [-1177.008] (-1178.850) (-1180.588) * [-1178.859] (-1177.572) (-1180.213) (-1179.047) -- 0:00:44 311500 -- (-1177.531) [-1178.260] (-1178.645) (-1178.897) * (-1177.491) [-1177.155] (-1178.113) (-1179.383) -- 0:00:44 312000 -- [-1178.374] (-1181.562) (-1182.424) (-1182.433) * (-1180.816) (-1183.550) [-1178.085] (-1180.622) -- 0:00:44 312500 -- (-1177.596) (-1179.518) (-1178.931) [-1179.041] * [-1180.606] (-1180.164) (-1181.153) (-1181.912) -- 0:00:44 313000 -- (-1177.426) (-1180.049) [-1184.854] (-1179.660) * [-1179.406] (-1179.862) (-1180.525) (-1178.479) -- 0:00:43 313500 -- (-1177.534) [-1179.418] (-1178.077) (-1178.386) * [-1181.338] (-1177.759) (-1177.574) (-1180.403) -- 0:00:43 314000 -- [-1178.239] (-1180.079) (-1178.360) (-1179.051) * (-1180.232) (-1179.520) (-1180.859) [-1178.670] -- 0:00:43 314500 -- (-1179.241) [-1179.907] (-1178.511) (-1183.512) * (-1178.907) (-1179.434) [-1181.384] (-1178.564) -- 0:00:43 315000 -- [-1178.648] (-1178.286) (-1180.407) (-1180.805) * (-1178.816) (-1180.804) (-1178.663) [-1177.233] -- 0:00:43 Average standard deviation of split frequencies: 0.012494 315500 -- (-1181.291) [-1179.615] (-1178.550) (-1181.769) * (-1177.911) (-1179.843) (-1179.897) [-1177.373] -- 0:00:43 316000 -- (-1181.020) (-1178.603) [-1185.160] (-1179.309) * (-1177.599) (-1177.558) [-1178.323] (-1177.331) -- 0:00:43 316500 -- (-1179.392) (-1179.133) (-1180.328) [-1177.584] * [-1179.214] (-1178.211) (-1179.119) (-1182.115) -- 0:00:43 317000 -- (-1182.509) (-1179.832) (-1180.728) [-1177.584] * (-1184.084) (-1177.481) (-1177.565) [-1180.019] -- 0:00:43 317500 -- (-1183.077) (-1185.208) [-1177.933] (-1177.944) * [-1185.234] (-1178.923) (-1180.438) (-1181.606) -- 0:00:42 318000 -- (-1184.249) (-1184.944) (-1182.870) [-1177.358] * (-1177.788) (-1178.723) [-1180.801] (-1178.763) -- 0:00:42 318500 -- (-1183.132) [-1182.241] (-1178.123) (-1179.224) * (-1177.619) [-1179.590] (-1180.532) (-1179.375) -- 0:00:42 319000 -- (-1180.993) (-1181.942) [-1178.126] (-1178.788) * (-1178.597) (-1181.311) (-1179.193) [-1177.240] -- 0:00:42 319500 -- (-1183.053) [-1181.225] (-1178.815) (-1181.589) * (-1180.181) (-1179.120) (-1179.997) [-1177.463] -- 0:00:42 320000 -- (-1183.459) [-1177.408] (-1177.478) (-1181.972) * [-1178.145] (-1185.347) (-1181.707) (-1180.555) -- 0:00:42 Average standard deviation of split frequencies: 0.013323 320500 -- (-1180.998) (-1181.459) [-1181.193] (-1181.648) * [-1179.307] (-1181.490) (-1180.377) (-1179.834) -- 0:00:42 321000 -- (-1179.741) (-1181.268) (-1181.649) [-1177.241] * (-1179.861) [-1181.050] (-1179.090) (-1179.219) -- 0:00:42 321500 -- [-1181.724] (-1179.958) (-1180.783) (-1177.893) * [-1179.229] (-1179.902) (-1181.872) (-1178.643) -- 0:00:42 322000 -- (-1182.286) [-1179.380] (-1179.860) (-1179.993) * (-1179.171) (-1179.243) [-1178.547] (-1181.613) -- 0:00:42 322500 -- (-1181.449) (-1180.269) [-1180.570] (-1179.516) * (-1182.791) [-1178.336] (-1180.489) (-1179.812) -- 0:00:42 323000 -- (-1184.566) [-1177.931] (-1178.644) (-1180.384) * (-1179.221) (-1181.172) [-1180.649] (-1179.204) -- 0:00:41 323500 -- (-1183.562) (-1177.854) [-1181.225] (-1179.773) * (-1182.403) [-1180.251] (-1177.836) (-1180.173) -- 0:00:41 324000 -- (-1181.312) (-1180.620) [-1182.532] (-1179.832) * (-1180.758) (-1181.590) (-1182.245) [-1177.960] -- 0:00:41 324500 -- (-1178.146) (-1178.553) [-1180.453] (-1177.536) * [-1181.390] (-1182.821) (-1180.607) (-1178.981) -- 0:00:41 325000 -- (-1178.546) (-1181.275) (-1181.417) [-1177.112] * (-1179.105) [-1181.476] (-1179.472) (-1180.325) -- 0:00:41 Average standard deviation of split frequencies: 0.013195 325500 -- (-1178.322) (-1181.235) (-1179.516) [-1179.581] * [-1179.116] (-1179.614) (-1178.663) (-1178.073) -- 0:00:41 326000 -- (-1179.040) (-1178.291) (-1181.299) [-1177.523] * (-1181.306) (-1179.710) [-1179.373] (-1177.491) -- 0:00:41 326500 -- (-1181.542) (-1179.965) [-1181.104] (-1178.008) * (-1180.185) (-1178.117) [-1177.842] (-1178.219) -- 0:00:41 327000 -- (-1178.296) (-1178.476) (-1181.520) [-1178.005] * [-1177.997] (-1177.438) (-1177.172) (-1178.588) -- 0:00:43 327500 -- [-1178.943] (-1177.331) (-1178.029) (-1177.841) * (-1178.690) [-1180.903] (-1177.576) (-1178.552) -- 0:00:43 328000 -- (-1179.087) (-1182.920) (-1178.630) [-1178.668] * (-1179.789) [-1179.261] (-1178.233) (-1180.565) -- 0:00:43 328500 -- (-1177.625) (-1179.655) [-1178.249] (-1179.775) * (-1178.321) (-1179.428) (-1177.610) [-1178.753] -- 0:00:42 329000 -- (-1180.304) (-1177.771) [-1178.551] (-1179.587) * (-1178.278) (-1178.187) [-1178.856] (-1177.734) -- 0:00:42 329500 -- (-1180.473) (-1177.930) (-1181.797) [-1178.822] * (-1177.468) (-1179.775) [-1182.564] (-1182.267) -- 0:00:42 330000 -- (-1180.229) [-1178.936] (-1179.763) (-1183.249) * (-1180.740) (-1177.481) [-1179.494] (-1183.348) -- 0:00:42 Average standard deviation of split frequencies: 0.012652 330500 -- (-1178.545) [-1178.531] (-1180.765) (-1184.012) * (-1183.170) [-1177.406] (-1179.586) (-1181.204) -- 0:00:42 331000 -- (-1182.764) (-1180.666) (-1182.312) [-1178.449] * (-1180.878) [-1177.793] (-1180.207) (-1181.661) -- 0:00:42 331500 -- (-1181.422) [-1179.680] (-1179.711) (-1178.009) * [-1178.975] (-1179.744) (-1179.841) (-1180.093) -- 0:00:42 332000 -- (-1179.265) (-1177.261) [-1179.122] (-1178.028) * [-1179.020] (-1179.748) (-1178.941) (-1177.793) -- 0:00:42 332500 -- (-1181.979) [-1177.132] (-1183.011) (-1178.816) * (-1182.166) (-1181.677) (-1179.236) [-1178.141] -- 0:00:42 333000 -- (-1179.816) (-1177.881) [-1178.581] (-1178.764) * (-1179.358) (-1178.353) [-1179.201] (-1178.104) -- 0:00:42 333500 -- [-1179.399] (-1178.658) (-1180.806) (-1182.005) * (-1180.272) (-1180.920) (-1181.810) [-1177.602] -- 0:00:41 334000 -- [-1180.474] (-1178.537) (-1180.279) (-1177.808) * (-1181.888) (-1182.193) [-1179.011] (-1179.316) -- 0:00:41 334500 -- (-1179.001) [-1179.654] (-1179.012) (-1180.770) * [-1183.944] (-1177.789) (-1182.054) (-1182.484) -- 0:00:41 335000 -- (-1182.711) [-1178.758] (-1179.086) (-1179.550) * (-1181.850) (-1179.510) (-1179.148) [-1178.770] -- 0:00:41 Average standard deviation of split frequencies: 0.012715 335500 -- (-1180.940) (-1178.147) (-1179.382) [-1178.813] * [-1178.432] (-1181.242) (-1180.872) (-1181.582) -- 0:00:41 336000 -- (-1184.997) [-1179.659] (-1179.385) (-1179.184) * (-1182.299) (-1180.993) (-1182.940) [-1180.584] -- 0:00:41 336500 -- [-1183.542] (-1179.315) (-1178.803) (-1180.386) * (-1184.749) (-1181.053) (-1181.087) [-1181.596] -- 0:00:41 337000 -- (-1179.001) (-1179.586) (-1179.024) [-1178.232] * (-1178.394) (-1177.753) [-1181.780] (-1179.208) -- 0:00:41 337500 -- (-1179.291) (-1177.776) (-1180.416) [-1178.127] * (-1181.451) [-1182.814] (-1180.262) (-1179.855) -- 0:00:41 338000 -- (-1182.445) (-1177.519) (-1179.193) [-1182.420] * [-1182.460] (-1183.358) (-1179.719) (-1178.504) -- 0:00:41 338500 -- (-1179.174) (-1179.048) (-1179.150) [-1179.217] * (-1184.940) (-1180.627) (-1177.987) [-1181.394] -- 0:00:41 339000 -- (-1179.872) [-1179.589] (-1179.166) (-1178.435) * (-1179.676) [-1179.809] (-1178.967) (-1182.166) -- 0:00:40 339500 -- (-1182.274) [-1177.609] (-1177.930) (-1177.841) * (-1177.142) (-1179.632) [-1182.109] (-1179.629) -- 0:00:40 340000 -- (-1180.160) (-1180.081) (-1178.905) [-1179.506] * [-1183.973] (-1181.722) (-1184.105) (-1179.434) -- 0:00:40 Average standard deviation of split frequencies: 0.012540 340500 -- (-1179.060) [-1181.149] (-1179.080) (-1180.019) * (-1182.051) (-1181.281) (-1181.487) [-1177.671] -- 0:00:40 341000 -- (-1179.671) (-1179.800) (-1180.331) [-1178.215] * (-1179.370) [-1178.143] (-1179.056) (-1178.025) -- 0:00:40 341500 -- (-1179.153) (-1179.097) [-1178.891] (-1179.313) * (-1179.363) [-1179.601] (-1178.526) (-1177.378) -- 0:00:40 342000 -- (-1178.224) (-1177.883) [-1178.864] (-1180.104) * (-1180.333) (-1179.785) [-1177.433] (-1178.075) -- 0:00:40 342500 -- (-1178.102) [-1185.640] (-1179.379) (-1178.504) * (-1183.909) (-1182.287) (-1177.963) [-1178.829] -- 0:00:40 343000 -- (-1177.348) (-1179.051) (-1178.740) [-1178.768] * (-1179.397) (-1183.217) [-1177.194] (-1179.421) -- 0:00:42 343500 -- [-1177.132] (-1178.614) (-1178.654) (-1178.753) * (-1179.826) (-1181.291) [-1178.961] (-1186.515) -- 0:00:42 344000 -- (-1179.548) (-1179.534) [-1180.635] (-1179.556) * [-1179.129] (-1182.089) (-1179.221) (-1183.541) -- 0:00:41 344500 -- (-1179.471) (-1179.424) [-1180.632] (-1177.587) * (-1180.602) (-1177.492) [-1180.540] (-1178.776) -- 0:00:41 345000 -- (-1177.932) [-1178.749] (-1179.343) (-1178.846) * (-1180.251) (-1177.276) [-1179.494] (-1178.085) -- 0:00:41 Average standard deviation of split frequencies: 0.013199 345500 -- [-1177.783] (-1178.611) (-1178.848) (-1177.669) * (-1180.845) [-1177.450] (-1179.033) (-1177.588) -- 0:00:41 346000 -- (-1178.040) (-1179.714) [-1178.365] (-1177.317) * (-1178.435) (-1179.146) (-1178.375) [-1181.448] -- 0:00:41 346500 -- (-1179.122) (-1184.151) (-1178.198) [-1177.310] * [-1177.992] (-1177.732) (-1181.747) (-1181.247) -- 0:00:41 347000 -- (-1178.950) [-1179.247] (-1179.572) (-1177.446) * [-1179.979] (-1179.627) (-1178.371) (-1182.526) -- 0:00:41 347500 -- (-1178.869) (-1177.628) (-1183.417) [-1179.552] * (-1179.206) (-1177.414) [-1178.216] (-1177.960) -- 0:00:41 348000 -- (-1181.566) (-1178.157) (-1181.681) [-1180.972] * (-1179.599) (-1177.434) (-1178.483) [-1178.195] -- 0:00:41 348500 -- (-1180.243) [-1179.755] (-1179.899) (-1178.917) * (-1184.916) [-1181.780] (-1181.939) (-1179.350) -- 0:00:41 349000 -- (-1177.868) (-1182.171) (-1177.768) [-1177.543] * [-1179.990] (-1178.574) (-1178.380) (-1179.210) -- 0:00:41 349500 -- [-1178.077] (-1182.687) (-1177.939) (-1182.239) * (-1178.632) [-1180.575] (-1179.905) (-1178.891) -- 0:00:40 350000 -- (-1177.871) (-1182.124) [-1177.619] (-1181.309) * (-1178.501) (-1180.719) [-1179.310] (-1180.381) -- 0:00:40 Average standard deviation of split frequencies: 0.012731 350500 -- (-1177.967) (-1179.859) [-1177.972] (-1182.175) * (-1179.904) [-1179.741] (-1179.790) (-1179.789) -- 0:00:40 351000 -- (-1178.635) [-1179.747] (-1179.520) (-1182.862) * (-1179.893) (-1181.639) [-1177.999] (-1178.325) -- 0:00:40 351500 -- [-1177.611] (-1177.492) (-1181.530) (-1179.517) * [-1180.239] (-1182.033) (-1177.360) (-1178.698) -- 0:00:40 352000 -- (-1178.734) [-1177.420] (-1177.729) (-1178.907) * [-1179.575] (-1180.392) (-1179.830) (-1178.597) -- 0:00:40 352500 -- (-1179.388) (-1177.700) (-1177.094) [-1180.595] * (-1179.774) (-1177.777) (-1179.355) [-1179.120] -- 0:00:40 353000 -- [-1190.994] (-1182.402) (-1176.993) (-1179.719) * (-1178.752) (-1178.366) (-1182.142) [-1180.197] -- 0:00:40 353500 -- (-1183.249) (-1181.366) (-1178.162) [-1177.937] * (-1179.057) (-1179.254) (-1186.134) [-1180.072] -- 0:00:40 354000 -- (-1182.275) (-1177.972) (-1178.289) [-1180.550] * (-1179.028) [-1179.546] (-1181.573) (-1178.191) -- 0:00:40 354500 -- [-1179.627] (-1177.744) (-1180.471) (-1177.694) * (-1178.986) (-1180.970) [-1180.318] (-1179.859) -- 0:00:40 355000 -- (-1178.207) (-1177.757) [-1177.392] (-1177.351) * [-1179.417] (-1181.402) (-1179.028) (-1178.231) -- 0:00:39 Average standard deviation of split frequencies: 0.013904 355500 -- (-1178.062) (-1179.961) (-1179.021) [-1181.663] * (-1180.265) (-1182.918) (-1179.082) [-1177.517] -- 0:00:39 356000 -- (-1177.772) (-1178.430) [-1177.717] (-1178.886) * (-1177.877) (-1187.546) [-1179.649] (-1178.154) -- 0:00:39 356500 -- (-1178.220) (-1178.506) (-1181.453) [-1182.029] * [-1178.077] (-1182.429) (-1179.555) (-1179.269) -- 0:00:39 357000 -- (-1180.616) (-1185.949) [-1180.127] (-1180.133) * (-1177.236) [-1177.431] (-1180.723) (-1179.582) -- 0:00:39 357500 -- (-1180.701) (-1180.591) (-1178.651) [-1179.162] * (-1181.181) [-1178.317] (-1178.205) (-1178.669) -- 0:00:41 358000 -- (-1180.835) [-1178.667] (-1183.317) (-1181.349) * (-1179.802) [-1176.960] (-1180.491) (-1178.696) -- 0:00:41 358500 -- (-1184.763) [-1178.208] (-1178.733) (-1180.185) * [-1179.501] (-1179.615) (-1180.207) (-1182.483) -- 0:00:41 359000 -- (-1179.371) (-1179.328) [-1178.121] (-1177.896) * (-1182.558) (-1182.322) [-1178.422] (-1179.374) -- 0:00:41 359500 -- (-1183.529) [-1177.850] (-1178.012) (-1178.486) * [-1180.043] (-1179.098) (-1181.949) (-1179.769) -- 0:00:40 360000 -- (-1177.045) (-1181.750) [-1179.985] (-1178.430) * (-1178.983) [-1179.920] (-1178.873) (-1181.190) -- 0:00:40 Average standard deviation of split frequencies: 0.013397 360500 -- (-1177.682) (-1182.766) [-1179.660] (-1182.652) * [-1178.150] (-1181.209) (-1178.690) (-1179.943) -- 0:00:40 361000 -- [-1179.750] (-1179.247) (-1182.030) (-1178.871) * (-1183.547) [-1180.290] (-1179.808) (-1178.949) -- 0:00:40 361500 -- (-1184.559) (-1181.585) [-1179.425] (-1180.814) * [-1184.427] (-1179.991) (-1180.670) (-1182.023) -- 0:00:40 362000 -- [-1179.241] (-1181.295) (-1179.650) (-1178.295) * (-1181.828) (-1180.179) (-1184.121) [-1182.114] -- 0:00:40 362500 -- [-1179.058] (-1178.200) (-1178.382) (-1179.429) * [-1180.046] (-1179.262) (-1179.013) (-1182.912) -- 0:00:40 363000 -- [-1177.880] (-1179.146) (-1181.829) (-1179.068) * [-1180.256] (-1178.441) (-1177.556) (-1181.513) -- 0:00:40 363500 -- [-1177.730] (-1178.138) (-1179.319) (-1178.173) * (-1179.100) [-1177.626] (-1177.873) (-1186.446) -- 0:00:40 364000 -- [-1179.123] (-1181.172) (-1182.011) (-1180.330) * (-1179.424) (-1178.111) [-1178.417] (-1181.238) -- 0:00:40 364500 -- (-1180.837) (-1178.906) [-1181.103] (-1179.414) * [-1179.022] (-1183.444) (-1179.860) (-1181.925) -- 0:00:40 365000 -- (-1181.145) [-1177.974] (-1179.310) (-1179.040) * [-1178.554] (-1182.180) (-1178.878) (-1179.158) -- 0:00:40 Average standard deviation of split frequencies: 0.013604 365500 -- (-1183.129) [-1177.746] (-1180.678) (-1178.123) * (-1181.447) [-1177.408] (-1181.403) (-1177.701) -- 0:00:39 366000 -- (-1179.451) (-1177.634) [-1179.970] (-1181.650) * [-1179.185] (-1178.549) (-1183.641) (-1179.371) -- 0:00:39 366500 -- [-1181.554] (-1183.338) (-1179.295) (-1180.562) * (-1177.518) (-1178.467) (-1181.147) [-1177.293] -- 0:00:39 367000 -- (-1178.203) [-1180.677] (-1182.042) (-1181.320) * [-1178.243] (-1179.289) (-1179.526) (-1176.902) -- 0:00:39 367500 -- (-1178.867) (-1181.556) [-1180.373] (-1180.100) * (-1179.825) (-1180.587) [-1178.407] (-1179.673) -- 0:00:39 368000 -- [-1180.388] (-1178.992) (-1180.277) (-1181.485) * (-1178.179) (-1180.859) [-1180.273] (-1177.698) -- 0:00:39 368500 -- [-1177.836] (-1179.705) (-1181.608) (-1187.539) * [-1177.871] (-1178.227) (-1178.618) (-1177.059) -- 0:00:39 369000 -- (-1178.779) [-1179.605] (-1183.947) (-1186.221) * (-1178.431) (-1177.885) (-1178.118) [-1181.004] -- 0:00:39 369500 -- (-1179.789) (-1178.298) [-1182.155] (-1181.919) * [-1180.152] (-1180.521) (-1180.195) (-1178.351) -- 0:00:39 370000 -- (-1178.976) (-1179.323) [-1179.489] (-1182.470) * (-1179.530) (-1179.377) (-1178.120) [-1177.574] -- 0:00:39 Average standard deviation of split frequencies: 0.013433 370500 -- [-1177.807] (-1182.904) (-1178.061) (-1182.041) * (-1177.471) [-1180.305] (-1178.147) (-1179.580) -- 0:00:39 371000 -- (-1181.594) [-1178.159] (-1179.218) (-1185.034) * [-1181.313] (-1179.883) (-1180.736) (-1178.801) -- 0:00:38 371500 -- (-1179.426) [-1179.389] (-1177.143) (-1184.784) * (-1179.033) (-1179.676) (-1177.894) [-1178.785] -- 0:00:38 372000 -- (-1178.285) (-1177.856) [-1178.203] (-1177.013) * [-1177.623] (-1181.140) (-1182.016) (-1178.032) -- 0:00:38 372500 -- [-1177.532] (-1177.898) (-1178.450) (-1177.478) * [-1180.069] (-1179.882) (-1184.047) (-1179.800) -- 0:00:38 373000 -- (-1177.153) [-1178.902] (-1177.934) (-1182.120) * (-1179.340) (-1181.577) [-1178.337] (-1179.517) -- 0:00:38 373500 -- (-1181.388) (-1180.619) (-1179.010) [-1178.867] * [-1181.782] (-1180.868) (-1179.229) (-1178.644) -- 0:00:38 374000 -- (-1179.858) (-1181.286) [-1178.097] (-1180.870) * (-1177.637) [-1178.462] (-1179.110) (-1177.638) -- 0:00:40 374500 -- (-1179.229) [-1177.293] (-1180.144) (-1179.668) * (-1177.669) (-1177.255) (-1179.448) [-1177.564] -- 0:00:40 375000 -- [-1177.767] (-1178.621) (-1179.889) (-1184.019) * (-1179.338) [-1179.804] (-1180.972) (-1178.331) -- 0:00:40 Average standard deviation of split frequencies: 0.013164 375500 -- (-1180.475) (-1181.630) (-1177.982) [-1176.908] * (-1181.265) (-1178.305) (-1180.660) [-1180.129] -- 0:00:39 376000 -- (-1182.808) (-1180.838) (-1178.031) [-1177.037] * (-1181.725) [-1179.170] (-1179.177) (-1181.630) -- 0:00:39 376500 -- (-1179.942) [-1181.556] (-1177.623) (-1182.175) * (-1180.384) [-1178.639] (-1179.779) (-1183.040) -- 0:00:39 377000 -- (-1178.888) [-1179.681] (-1180.866) (-1181.204) * [-1180.412] (-1181.087) (-1180.579) (-1181.353) -- 0:00:39 377500 -- [-1177.480] (-1184.030) (-1179.593) (-1178.116) * (-1178.995) (-1178.231) (-1178.622) [-1177.729] -- 0:00:39 378000 -- (-1178.018) (-1178.816) (-1181.225) [-1177.593] * (-1179.207) [-1177.963] (-1177.479) (-1178.248) -- 0:00:39 378500 -- (-1177.809) (-1180.320) (-1178.391) [-1178.083] * (-1178.407) [-1177.969] (-1180.678) (-1179.025) -- 0:00:39 379000 -- (-1179.558) (-1178.400) (-1180.857) [-1177.921] * (-1178.465) [-1178.221] (-1179.106) (-1179.440) -- 0:00:39 379500 -- (-1180.313) [-1178.937] (-1180.105) (-1179.087) * (-1178.036) (-1178.249) (-1178.770) [-1181.243] -- 0:00:39 380000 -- [-1180.616] (-1181.968) (-1179.791) (-1178.720) * (-1181.339) (-1178.190) [-1182.776] (-1180.401) -- 0:00:39 Average standard deviation of split frequencies: 0.013158 380500 -- (-1177.549) [-1178.770] (-1180.094) (-1178.276) * (-1179.678) (-1177.514) [-1180.879] (-1179.587) -- 0:00:39 381000 -- (-1176.921) (-1180.742) [-1180.389] (-1178.290) * (-1180.396) [-1178.650] (-1179.145) (-1184.490) -- 0:00:38 381500 -- (-1179.587) (-1178.677) (-1177.436) [-1178.843] * (-1182.684) (-1180.099) (-1183.240) [-1184.047] -- 0:00:38 382000 -- (-1179.344) [-1179.888] (-1178.715) (-1179.380) * (-1181.850) (-1180.340) [-1178.045] (-1179.669) -- 0:00:38 382500 -- [-1177.486] (-1179.191) (-1178.622) (-1177.395) * (-1179.963) (-1177.786) [-1178.418] (-1178.593) -- 0:00:38 383000 -- (-1179.406) (-1179.086) (-1179.236) [-1179.512] * (-1183.723) [-1178.009] (-1185.440) (-1181.532) -- 0:00:38 383500 -- [-1178.989] (-1178.790) (-1177.300) (-1180.241) * (-1178.790) (-1177.700) [-1178.605] (-1178.097) -- 0:00:38 384000 -- (-1178.784) [-1178.303] (-1179.562) (-1178.431) * (-1178.606) (-1179.319) (-1183.138) [-1177.435] -- 0:00:38 384500 -- (-1180.345) (-1181.210) (-1179.414) [-1178.006] * (-1180.276) (-1178.203) (-1178.894) [-1180.233] -- 0:00:38 385000 -- (-1183.558) (-1177.707) [-1179.161] (-1178.067) * (-1182.492) (-1177.519) (-1178.519) [-1179.446] -- 0:00:38 Average standard deviation of split frequencies: 0.013815 385500 -- (-1179.070) (-1177.179) (-1184.589) [-1180.082] * [-1180.632] (-1177.989) (-1183.326) (-1179.496) -- 0:00:38 386000 -- [-1179.618] (-1178.236) (-1179.808) (-1180.601) * (-1185.080) (-1178.386) (-1179.865) [-1178.856] -- 0:00:38 386500 -- (-1179.089) (-1177.175) [-1179.138] (-1178.893) * (-1179.268) [-1179.230] (-1180.677) (-1179.039) -- 0:00:38 387000 -- [-1177.731] (-1177.184) (-1178.070) (-1181.885) * [-1177.948] (-1179.912) (-1177.643) (-1179.257) -- 0:00:38 387500 -- (-1180.922) (-1178.913) [-1177.871] (-1183.106) * (-1178.315) (-1178.595) (-1179.121) [-1178.183] -- 0:00:37 388000 -- (-1178.867) [-1178.112] (-1177.371) (-1180.445) * (-1177.715) (-1179.309) (-1178.470) [-1178.738] -- 0:00:37 388500 -- (-1179.019) [-1177.963] (-1179.670) (-1179.655) * (-1182.020) [-1178.484] (-1181.055) (-1180.643) -- 0:00:37 389000 -- (-1180.114) (-1178.935) [-1180.091] (-1177.952) * [-1182.422] (-1178.484) (-1179.209) (-1178.521) -- 0:00:37 389500 -- (-1179.172) (-1178.663) [-1180.294] (-1178.226) * (-1183.531) (-1180.386) [-1178.619] (-1179.440) -- 0:00:37 390000 -- (-1180.514) (-1179.443) (-1180.077) [-1178.218] * (-1182.022) [-1178.954] (-1183.782) (-1183.009) -- 0:00:39 Average standard deviation of split frequencies: 0.013123 390500 -- (-1182.793) [-1180.575] (-1180.437) (-1177.300) * (-1178.728) (-1185.979) (-1182.669) [-1182.319] -- 0:00:39 391000 -- (-1178.010) (-1179.499) (-1178.366) [-1178.218] * (-1180.659) [-1177.857] (-1180.286) (-1179.321) -- 0:00:38 391500 -- (-1178.185) [-1179.343] (-1182.035) (-1177.701) * (-1178.288) (-1183.085) (-1181.395) [-1178.950] -- 0:00:38 392000 -- (-1178.301) (-1178.929) [-1180.252] (-1177.898) * (-1181.493) (-1178.430) (-1182.097) [-1178.842] -- 0:00:38 392500 -- (-1179.444) [-1178.810] (-1178.671) (-1178.265) * [-1181.692] (-1179.205) (-1180.822) (-1180.827) -- 0:00:38 393000 -- (-1181.115) (-1177.560) [-1180.088] (-1178.155) * (-1179.697) (-1179.797) (-1180.622) [-1182.955] -- 0:00:38 393500 -- (-1180.093) (-1178.815) [-1180.803] (-1177.651) * [-1178.456] (-1179.785) (-1179.890) (-1184.699) -- 0:00:38 394000 -- (-1181.176) (-1179.718) (-1181.469) [-1178.104] * (-1179.713) [-1178.700] (-1181.341) (-1181.213) -- 0:00:38 394500 -- [-1181.524] (-1179.487) (-1181.713) (-1178.468) * (-1179.372) (-1177.941) (-1181.648) [-1179.893] -- 0:00:38 395000 -- (-1178.213) [-1180.853] (-1178.075) (-1179.221) * [-1178.313] (-1178.796) (-1178.897) (-1182.855) -- 0:00:38 Average standard deviation of split frequencies: 0.013169 395500 -- (-1178.804) [-1178.565] (-1177.719) (-1180.255) * (-1179.406) (-1178.298) (-1179.623) [-1178.375] -- 0:00:38 396000 -- (-1179.043) (-1178.924) [-1177.560] (-1182.156) * [-1181.722] (-1178.296) (-1177.188) (-1178.877) -- 0:00:38 396500 -- (-1180.793) [-1178.477] (-1180.387) (-1178.836) * (-1179.705) [-1178.043] (-1179.561) (-1180.712) -- 0:00:38 397000 -- (-1180.844) (-1182.109) [-1179.974] (-1182.006) * [-1178.583] (-1179.451) (-1179.708) (-1179.696) -- 0:00:37 397500 -- (-1178.408) [-1177.964] (-1178.343) (-1179.773) * (-1181.018) (-1179.158) (-1180.277) [-1179.668] -- 0:00:37 398000 -- (-1178.538) [-1177.964] (-1181.380) (-1183.298) * (-1179.915) [-1180.149] (-1179.501) (-1178.291) -- 0:00:37 398500 -- (-1180.355) (-1177.370) (-1180.749) [-1178.341] * (-1184.797) (-1177.585) (-1178.618) [-1179.343] -- 0:00:37 399000 -- (-1178.011) (-1180.892) [-1181.474] (-1179.838) * (-1178.194) (-1177.718) (-1178.821) [-1177.434] -- 0:00:37 399500 -- (-1180.641) [-1178.003] (-1182.893) (-1177.308) * (-1176.901) [-1177.960] (-1184.252) (-1178.215) -- 0:00:37 400000 -- (-1181.025) [-1179.685] (-1178.854) (-1176.944) * (-1182.693) [-1181.158] (-1178.991) (-1176.991) -- 0:00:37 Average standard deviation of split frequencies: 0.013457 400500 -- [-1180.059] (-1178.528) (-1180.257) (-1178.262) * [-1182.008] (-1179.070) (-1179.518) (-1177.986) -- 0:00:37 401000 -- (-1180.594) [-1177.276] (-1178.523) (-1180.612) * (-1177.880) [-1179.738] (-1180.211) (-1177.821) -- 0:00:37 401500 -- (-1183.317) (-1177.277) [-1179.170] (-1179.851) * (-1180.319) (-1181.445) [-1178.229] (-1178.150) -- 0:00:37 402000 -- (-1183.600) (-1177.827) [-1178.276] (-1178.067) * (-1180.712) (-1180.721) [-1178.443] (-1179.246) -- 0:00:37 402500 -- (-1178.599) (-1180.777) (-1182.696) [-1178.080] * [-1180.411] (-1179.723) (-1177.914) (-1179.871) -- 0:00:37 403000 -- (-1178.938) [-1180.778] (-1183.638) (-1184.002) * (-1179.829) [-1178.110] (-1177.912) (-1178.413) -- 0:00:37 403500 -- [-1178.819] (-1181.016) (-1180.925) (-1186.582) * (-1179.862) [-1179.772] (-1177.346) (-1178.381) -- 0:00:36 404000 -- (-1182.415) (-1182.761) [-1180.128] (-1179.230) * [-1179.604] (-1181.196) (-1179.382) (-1178.149) -- 0:00:36 404500 -- (-1181.515) [-1179.723] (-1178.378) (-1179.521) * (-1180.006) (-1179.096) (-1179.748) [-1178.635] -- 0:00:36 405000 -- [-1177.934] (-1182.284) (-1178.410) (-1179.885) * [-1178.098] (-1180.770) (-1179.387) (-1177.843) -- 0:00:36 Average standard deviation of split frequencies: 0.014006 405500 -- (-1183.046) (-1178.441) [-1177.677] (-1180.469) * (-1178.098) [-1184.504] (-1180.378) (-1179.197) -- 0:00:36 406000 -- (-1179.093) [-1178.318] (-1177.387) (-1178.891) * (-1182.606) (-1180.547) (-1181.250) [-1180.224] -- 0:00:38 406500 -- (-1179.183) (-1179.128) [-1179.249] (-1177.421) * [-1177.458] (-1180.142) (-1177.307) (-1184.906) -- 0:00:37 407000 -- (-1179.086) [-1177.540] (-1176.966) (-1180.599) * (-1177.232) (-1181.445) [-1177.499] (-1183.676) -- 0:00:37 407500 -- (-1178.112) (-1179.802) (-1176.966) [-1179.071] * (-1183.737) (-1181.721) (-1177.500) [-1183.845] -- 0:00:37 408000 -- [-1178.853] (-1182.504) (-1177.854) (-1180.181) * [-1178.146] (-1177.883) (-1178.921) (-1179.306) -- 0:00:37 408500 -- (-1179.497) (-1179.679) [-1178.182] (-1178.531) * (-1179.829) [-1179.867] (-1178.956) (-1178.507) -- 0:00:37 409000 -- [-1178.845] (-1178.417) (-1181.121) (-1182.833) * [-1182.938] (-1178.858) (-1179.883) (-1178.712) -- 0:00:37 409500 -- (-1181.469) (-1181.083) (-1177.614) [-1180.314] * (-1181.542) [-1178.984] (-1180.023) (-1178.495) -- 0:00:37 410000 -- (-1180.267) [-1179.333] (-1180.354) (-1179.708) * (-1177.612) [-1177.803] (-1180.071) (-1177.414) -- 0:00:37 Average standard deviation of split frequencies: 0.013201 410500 -- (-1179.342) (-1178.601) [-1178.496] (-1178.813) * [-1178.476] (-1179.658) (-1177.710) (-1178.294) -- 0:00:37 411000 -- (-1177.619) [-1177.860] (-1178.716) (-1180.436) * (-1182.820) (-1177.842) [-1178.279] (-1177.907) -- 0:00:37 411500 -- [-1178.376] (-1177.951) (-1177.482) (-1178.911) * (-1180.063) (-1177.193) [-1177.103] (-1178.603) -- 0:00:37 412000 -- (-1178.404) (-1179.641) [-1177.828] (-1177.696) * [-1177.701] (-1179.089) (-1178.423) (-1178.909) -- 0:00:37 412500 -- (-1183.581) (-1179.514) [-1181.547] (-1182.019) * (-1179.357) (-1178.545) [-1179.741] (-1178.909) -- 0:00:37 413000 -- (-1179.692) [-1179.464] (-1180.934) (-1180.880) * [-1179.161] (-1179.553) (-1178.678) (-1177.917) -- 0:00:36 413500 -- (-1180.234) (-1179.018) (-1180.025) [-1177.361] * (-1177.974) (-1179.203) [-1178.769] (-1177.924) -- 0:00:36 414000 -- (-1180.207) (-1179.698) (-1178.912) [-1177.406] * [-1177.782] (-1178.089) (-1182.026) (-1178.384) -- 0:00:36 414500 -- (-1178.741) (-1178.579) [-1179.825] (-1184.947) * (-1177.911) (-1178.417) (-1178.719) [-1178.418] -- 0:00:36 415000 -- [-1178.206] (-1179.223) (-1178.978) (-1180.522) * (-1179.204) [-1179.967] (-1178.950) (-1178.949) -- 0:00:36 Average standard deviation of split frequencies: 0.011969 415500 -- (-1180.363) (-1179.384) (-1179.266) [-1178.045] * (-1182.143) (-1180.056) (-1177.450) [-1179.769] -- 0:00:36 416000 -- [-1178.580] (-1180.087) (-1178.832) (-1183.533) * (-1178.267) (-1179.672) [-1177.503] (-1182.527) -- 0:00:36 416500 -- (-1177.920) (-1178.247) (-1180.042) [-1182.596] * (-1177.885) (-1178.649) [-1178.880] (-1178.860) -- 0:00:36 417000 -- [-1178.128] (-1178.581) (-1180.616) (-1181.349) * (-1179.794) [-1177.665] (-1184.507) (-1179.954) -- 0:00:36 417500 -- (-1177.728) (-1178.848) [-1181.927] (-1179.564) * [-1180.980] (-1177.667) (-1188.303) (-1179.322) -- 0:00:36 418000 -- [-1177.689] (-1178.598) (-1180.632) (-1180.167) * [-1178.029] (-1177.616) (-1181.313) (-1179.083) -- 0:00:36 418500 -- (-1180.939) (-1179.785) [-1180.808] (-1178.799) * (-1178.004) (-1182.377) (-1179.957) [-1178.170] -- 0:00:36 419000 -- (-1180.949) [-1179.315] (-1180.166) (-1181.520) * (-1178.867) [-1181.200] (-1178.498) (-1177.413) -- 0:00:36 419500 -- (-1177.765) [-1179.315] (-1177.789) (-1181.484) * (-1181.195) (-1178.965) (-1177.515) [-1177.299] -- 0:00:35 420000 -- (-1178.006) (-1185.569) [-1177.776] (-1182.665) * (-1178.890) (-1179.512) [-1182.993] (-1179.343) -- 0:00:35 Average standard deviation of split frequencies: 0.011556 420500 -- (-1177.488) (-1179.779) [-1183.679] (-1178.030) * [-1179.879] (-1178.239) (-1182.008) (-1179.836) -- 0:00:35 421000 -- (-1179.333) (-1180.166) (-1178.451) [-1177.992] * (-1177.880) [-1177.839] (-1179.968) (-1178.903) -- 0:00:35 421500 -- [-1178.309] (-1181.764) (-1183.889) (-1178.012) * (-1179.916) (-1177.929) [-1178.069] (-1181.461) -- 0:00:35 422000 -- (-1178.308) (-1178.679) (-1180.230) [-1179.485] * (-1184.048) (-1180.809) (-1181.536) [-1180.156] -- 0:00:36 422500 -- (-1180.050) (-1177.521) [-1180.960] (-1181.653) * (-1180.629) (-1179.409) [-1179.925] (-1180.344) -- 0:00:36 423000 -- [-1177.547] (-1177.960) (-1181.052) (-1185.085) * (-1179.043) (-1180.085) [-1178.541] (-1179.853) -- 0:00:36 423500 -- (-1178.628) (-1181.249) [-1178.287] (-1185.073) * (-1180.055) (-1177.843) (-1179.483) [-1180.055] -- 0:00:36 424000 -- (-1179.506) (-1180.248) [-1177.803] (-1180.614) * [-1180.201] (-1181.923) (-1187.278) (-1180.445) -- 0:00:36 424500 -- (-1178.406) (-1181.207) (-1181.501) [-1180.430] * [-1177.675] (-1178.558) (-1180.582) (-1179.570) -- 0:00:36 425000 -- (-1181.462) (-1180.095) (-1182.145) [-1178.551] * (-1177.666) (-1180.909) (-1181.679) [-1177.497] -- 0:00:36 Average standard deviation of split frequencies: 0.011965 425500 -- (-1177.251) [-1179.121] (-1184.964) (-1180.943) * (-1179.528) (-1180.494) (-1178.798) [-1178.646] -- 0:00:36 426000 -- (-1178.733) (-1177.495) [-1180.020] (-1178.222) * (-1179.528) (-1178.934) (-1178.484) [-1178.903] -- 0:00:36 426500 -- (-1183.300) [-1179.383] (-1182.371) (-1177.780) * (-1178.924) (-1179.076) (-1184.696) [-1179.691] -- 0:00:36 427000 -- (-1181.929) (-1177.633) (-1182.014) [-1179.354] * (-1177.572) [-1177.658] (-1180.131) (-1177.739) -- 0:00:36 427500 -- (-1181.194) (-1180.687) (-1182.099) [-1178.528] * (-1178.358) (-1181.592) (-1182.019) [-1177.834] -- 0:00:36 428000 -- (-1181.268) (-1177.582) [-1178.318] (-1179.056) * (-1178.999) [-1182.396] (-1181.321) (-1180.953) -- 0:00:36 428500 -- (-1180.833) (-1180.496) (-1185.887) [-1179.130] * (-1177.215) (-1178.252) (-1178.423) [-1179.458] -- 0:00:36 429000 -- (-1179.578) [-1178.197] (-1184.098) (-1179.473) * (-1181.369) (-1181.513) [-1180.072] (-1180.004) -- 0:00:35 429500 -- (-1178.776) [-1179.463] (-1185.464) (-1182.373) * (-1177.913) [-1177.877] (-1178.309) (-1178.250) -- 0:00:35 430000 -- (-1181.742) (-1181.457) [-1183.453] (-1180.725) * (-1178.622) (-1177.986) (-1181.734) [-1180.219] -- 0:00:35 Average standard deviation of split frequencies: 0.010878 430500 -- (-1184.277) (-1177.508) (-1184.296) [-1182.626] * [-1178.954] (-1181.769) (-1180.142) (-1182.129) -- 0:00:35 431000 -- (-1178.589) (-1179.330) (-1183.222) [-1181.609] * (-1183.814) (-1184.424) (-1177.863) [-1179.933] -- 0:00:35 431500 -- (-1179.393) (-1179.324) [-1178.562] (-1181.181) * (-1180.640) (-1177.779) [-1178.670] (-1179.228) -- 0:00:35 432000 -- [-1177.803] (-1178.147) (-1178.542) (-1178.631) * (-1181.043) [-1178.357] (-1179.797) (-1179.870) -- 0:00:35 432500 -- (-1179.316) (-1180.210) (-1180.097) [-1178.630] * (-1185.304) (-1183.403) (-1177.922) [-1179.786] -- 0:00:35 433000 -- (-1179.780) (-1178.644) (-1179.090) [-1178.381] * (-1180.134) [-1179.385] (-1178.615) (-1177.821) -- 0:00:35 433500 -- (-1180.485) [-1180.603] (-1177.342) (-1181.053) * (-1179.281) (-1182.366) (-1177.194) [-1178.580] -- 0:00:35 434000 -- (-1180.600) (-1181.391) [-1177.342] (-1179.661) * (-1179.305) [-1178.470] (-1181.908) (-1178.325) -- 0:00:35 434500 -- (-1181.097) (-1180.382) [-1177.499] (-1180.584) * [-1180.707] (-1183.878) (-1181.061) (-1180.461) -- 0:00:35 435000 -- (-1179.502) [-1182.175] (-1177.444) (-1179.636) * (-1180.290) [-1178.808] (-1185.111) (-1178.730) -- 0:00:35 Average standard deviation of split frequencies: 0.010812 435500 -- [-1180.371] (-1183.526) (-1177.190) (-1178.847) * (-1178.725) (-1178.141) [-1182.434] (-1178.077) -- 0:00:34 436000 -- (-1181.280) (-1182.038) [-1179.924] (-1179.189) * [-1179.545] (-1179.036) (-1178.245) (-1177.702) -- 0:00:34 436500 -- (-1180.082) [-1180.520] (-1177.132) (-1181.587) * (-1178.095) (-1179.462) (-1177.675) [-1177.297] -- 0:00:34 437000 -- (-1177.369) [-1178.037] (-1179.991) (-1179.059) * [-1178.203] (-1178.155) (-1180.944) (-1178.699) -- 0:00:34 437500 -- (-1182.026) [-1184.084] (-1180.559) (-1177.876) * (-1178.109) (-1179.529) [-1178.959] (-1179.038) -- 0:00:34 438000 -- (-1177.375) (-1178.655) (-1178.384) [-1179.041] * (-1179.411) (-1179.874) [-1179.049] (-1183.743) -- 0:00:34 438500 -- [-1180.412] (-1180.365) (-1178.992) (-1179.041) * (-1178.756) [-1177.542] (-1177.388) (-1178.515) -- 0:00:35 439000 -- (-1182.119) (-1179.232) [-1178.969] (-1177.676) * (-1178.616) [-1177.090] (-1179.541) (-1177.436) -- 0:00:35 439500 -- (-1180.626) (-1178.610) [-1180.280] (-1178.724) * (-1178.198) (-1179.787) [-1179.714] (-1178.252) -- 0:00:35 440000 -- [-1179.633] (-1179.662) (-1183.271) (-1181.314) * (-1179.364) [-1179.223] (-1179.010) (-1178.586) -- 0:00:35 Average standard deviation of split frequencies: 0.011366 440500 -- (-1178.626) (-1178.949) (-1178.218) [-1178.462] * (-1177.132) (-1180.512) [-1180.015] (-1179.133) -- 0:00:35 441000 -- (-1179.525) [-1179.577] (-1178.638) (-1177.911) * [-1177.692] (-1179.053) (-1182.765) (-1179.499) -- 0:00:35 441500 -- [-1187.496] (-1182.876) (-1178.946) (-1178.600) * (-1177.184) [-1177.521] (-1181.903) (-1178.490) -- 0:00:35 442000 -- (-1180.538) [-1178.390] (-1177.301) (-1181.892) * [-1176.853] (-1179.524) (-1179.580) (-1179.305) -- 0:00:35 442500 -- [-1178.634] (-1179.010) (-1178.711) (-1180.573) * [-1177.223] (-1182.525) (-1178.365) (-1177.455) -- 0:00:35 443000 -- (-1178.673) (-1178.310) [-1177.562] (-1180.311) * (-1179.483) (-1180.140) [-1179.503] (-1177.791) -- 0:00:35 443500 -- (-1178.816) (-1178.466) (-1181.435) [-1178.668] * (-1177.817) (-1181.211) (-1185.418) [-1178.567] -- 0:00:35 444000 -- (-1180.017) (-1177.506) [-1178.319] (-1181.300) * (-1178.097) [-1178.020] (-1182.098) (-1179.431) -- 0:00:35 444500 -- [-1179.569] (-1183.302) (-1177.973) (-1182.933) * (-1178.080) (-1178.572) (-1179.771) [-1177.847] -- 0:00:34 445000 -- [-1177.954] (-1181.555) (-1178.005) (-1183.533) * [-1179.312] (-1179.568) (-1177.101) (-1177.405) -- 0:00:34 Average standard deviation of split frequencies: 0.010834 445500 -- (-1177.851) (-1179.223) (-1177.988) [-1179.709] * (-1180.451) [-1178.342] (-1178.672) (-1179.506) -- 0:00:34 446000 -- (-1178.904) (-1177.835) (-1178.765) [-1180.506] * (-1179.734) [-1180.503] (-1178.190) (-1176.939) -- 0:00:34 446500 -- (-1177.639) [-1180.377] (-1179.695) (-1178.437) * (-1179.216) (-1179.155) [-1178.525] (-1177.911) -- 0:00:34 447000 -- (-1179.008) (-1177.747) (-1178.487) [-1180.140] * [-1178.107] (-1179.296) (-1178.488) (-1179.862) -- 0:00:34 447500 -- (-1179.204) (-1178.193) [-1177.997] (-1181.270) * (-1179.526) (-1178.476) [-1178.231] (-1182.885) -- 0:00:34 448000 -- (-1179.083) (-1180.980) (-1178.211) [-1178.513] * (-1180.215) (-1178.419) [-1177.826] (-1178.146) -- 0:00:34 448500 -- (-1180.322) [-1180.543] (-1177.393) (-1177.694) * (-1178.764) (-1178.415) (-1181.072) [-1178.937] -- 0:00:34 449000 -- (-1179.973) (-1177.759) [-1176.818] (-1178.760) * (-1177.106) (-1179.076) [-1178.634] (-1177.721) -- 0:00:34 449500 -- (-1178.919) (-1178.487) (-1176.870) [-1177.219] * [-1177.591] (-1182.173) (-1178.009) (-1179.347) -- 0:00:34 450000 -- (-1182.060) (-1179.904) (-1180.709) [-1176.951] * (-1179.972) (-1178.084) (-1179.381) [-1179.387] -- 0:00:34 Average standard deviation of split frequencies: 0.010264 450500 -- [-1182.602] (-1181.706) (-1179.020) (-1177.284) * [-1179.052] (-1178.540) (-1178.479) (-1178.678) -- 0:00:34 451000 -- (-1181.199) (-1178.286) (-1177.913) [-1177.597] * (-1180.801) (-1178.438) (-1179.061) [-1179.370] -- 0:00:34 451500 -- (-1181.720) (-1181.100) [-1177.674] (-1177.068) * (-1178.061) [-1178.625] (-1181.302) (-1179.370) -- 0:00:34 452000 -- [-1184.554] (-1181.230) (-1179.310) (-1178.285) * [-1177.396] (-1177.498) (-1182.271) (-1180.459) -- 0:00:33 452500 -- (-1183.005) (-1182.705) (-1179.386) [-1178.426] * (-1177.562) (-1181.228) (-1180.243) [-1181.561] -- 0:00:33 453000 -- (-1181.653) (-1177.208) (-1179.567) [-1177.739] * (-1177.542) (-1177.635) [-1179.619] (-1180.579) -- 0:00:33 453500 -- (-1179.271) [-1177.125] (-1178.232) (-1180.084) * (-1179.674) (-1178.372) [-1178.760] (-1181.563) -- 0:00:33 454000 -- (-1180.154) (-1177.034) [-1177.918] (-1184.250) * [-1181.151] (-1179.865) (-1182.742) (-1181.278) -- 0:00:33 454500 -- (-1179.155) (-1177.317) [-1178.115] (-1180.458) * [-1179.373] (-1180.291) (-1181.644) (-1181.353) -- 0:00:33 455000 -- [-1179.846] (-1178.116) (-1179.475) (-1178.904) * (-1180.739) [-1181.836] (-1180.729) (-1180.702) -- 0:00:34 Average standard deviation of split frequencies: 0.010596 455500 -- (-1180.651) (-1182.512) [-1179.009] (-1178.664) * (-1178.716) [-1178.187] (-1178.286) (-1181.860) -- 0:00:34 456000 -- (-1181.446) (-1178.072) [-1181.915] (-1179.826) * [-1177.793] (-1178.103) (-1179.747) (-1178.609) -- 0:00:34 456500 -- (-1179.299) (-1178.908) [-1181.390] (-1179.206) * (-1178.481) (-1177.868) (-1181.276) [-1177.734] -- 0:00:34 457000 -- (-1178.411) (-1178.156) (-1181.777) [-1179.380] * (-1178.591) (-1179.692) (-1182.357) [-1179.820] -- 0:00:34 457500 -- (-1178.190) (-1178.552) [-1178.972] (-1182.506) * (-1177.481) (-1182.585) [-1178.359] (-1178.121) -- 0:00:34 458000 -- (-1178.788) (-1178.121) (-1177.658) [-1181.005] * (-1181.496) (-1179.826) [-1179.262] (-1179.446) -- 0:00:34 458500 -- (-1183.680) (-1179.993) (-1177.932) [-1178.959] * [-1180.304] (-1178.256) (-1177.832) (-1181.773) -- 0:00:34 459000 -- (-1181.885) [-1178.105] (-1178.144) (-1180.310) * [-1179.970] (-1180.427) (-1180.439) (-1180.494) -- 0:00:34 459500 -- (-1178.076) (-1183.154) [-1177.987] (-1182.463) * (-1178.722) (-1179.911) (-1179.721) [-1181.437] -- 0:00:34 460000 -- (-1177.593) [-1186.699] (-1179.850) (-1178.735) * (-1177.954) [-1178.895] (-1179.342) (-1181.429) -- 0:00:34 Average standard deviation of split frequencies: 0.011448 460500 -- (-1178.974) (-1177.283) [-1180.903] (-1177.710) * [-1178.958] (-1179.435) (-1178.597) (-1180.609) -- 0:00:33 461000 -- [-1177.712] (-1177.372) (-1180.048) (-1179.088) * (-1180.941) [-1180.267] (-1179.561) (-1182.043) -- 0:00:33 461500 -- (-1178.760) (-1177.789) [-1178.747] (-1178.513) * [-1180.486] (-1179.295) (-1181.119) (-1180.139) -- 0:00:33 462000 -- [-1178.042] (-1177.517) (-1179.899) (-1178.513) * (-1178.429) [-1178.768] (-1179.352) (-1181.609) -- 0:00:33 462500 -- (-1178.004) (-1178.276) [-1179.145] (-1179.175) * (-1179.778) (-1179.761) [-1178.797] (-1178.767) -- 0:00:33 463000 -- (-1179.734) (-1178.792) (-1179.202) [-1177.796] * (-1179.840) [-1176.959] (-1182.478) (-1178.356) -- 0:00:33 463500 -- [-1178.452] (-1184.828) (-1179.043) (-1180.349) * (-1184.208) (-1179.100) [-1179.083] (-1180.244) -- 0:00:33 464000 -- (-1188.480) (-1177.824) (-1178.237) [-1178.302] * (-1181.509) [-1179.104] (-1179.874) (-1180.082) -- 0:00:33 464500 -- (-1180.414) (-1177.597) [-1181.287] (-1180.341) * (-1178.169) (-1177.838) (-1181.066) [-1179.437] -- 0:00:33 465000 -- (-1180.200) (-1177.746) [-1178.032] (-1180.332) * [-1178.306] (-1180.907) (-1178.772) (-1177.519) -- 0:00:33 Average standard deviation of split frequencies: 0.010811 465500 -- (-1180.342) (-1178.244) [-1178.444] (-1181.708) * (-1182.706) (-1178.463) (-1178.065) [-1179.118] -- 0:00:33 466000 -- (-1179.439) (-1180.645) [-1178.488] (-1181.034) * (-1183.505) (-1178.336) [-1178.506] (-1178.552) -- 0:00:33 466500 -- (-1178.796) (-1177.717) [-1179.095] (-1181.315) * [-1179.255] (-1178.844) (-1179.422) (-1179.036) -- 0:00:33 467000 -- (-1178.110) [-1178.446] (-1179.463) (-1180.563) * [-1177.790] (-1179.156) (-1180.552) (-1179.074) -- 0:00:33 467500 -- (-1178.955) (-1180.975) (-1180.505) [-1181.059] * (-1188.175) (-1183.012) (-1181.031) [-1181.293] -- 0:00:33 468000 -- (-1178.930) (-1179.352) [-1177.677] (-1181.907) * (-1179.620) (-1180.347) [-1178.088] (-1178.550) -- 0:00:32 468500 -- [-1178.612] (-1181.499) (-1177.977) (-1181.987) * [-1177.315] (-1178.515) (-1177.986) (-1178.276) -- 0:00:32 469000 -- (-1181.487) (-1181.252) [-1177.299] (-1181.983) * (-1177.945) (-1179.556) (-1180.904) [-1180.650] -- 0:00:32 469500 -- (-1177.628) [-1178.434] (-1176.815) (-1180.221) * [-1178.443] (-1178.106) (-1178.289) (-1178.474) -- 0:00:32 470000 -- (-1177.521) (-1177.746) [-1178.502] (-1182.289) * (-1177.869) [-1180.391] (-1179.763) (-1180.830) -- 0:00:32 Average standard deviation of split frequencies: 0.011205 470500 -- (-1180.140) (-1183.237) (-1180.542) [-1178.459] * (-1177.720) (-1180.076) [-1178.759] (-1177.421) -- 0:00:32 471000 -- (-1178.495) (-1178.648) (-1179.268) [-1180.599] * (-1178.726) (-1178.026) [-1178.251] (-1177.417) -- 0:00:33 471500 -- [-1179.159] (-1177.962) (-1181.548) (-1179.306) * (-1177.696) (-1182.419) [-1181.218] (-1178.264) -- 0:00:33 472000 -- (-1179.900) (-1179.742) [-1179.833] (-1178.251) * (-1177.815) (-1183.160) (-1179.517) [-1177.557] -- 0:00:33 472500 -- (-1179.414) (-1182.942) (-1182.639) [-1178.966] * [-1178.691] (-1183.022) (-1177.658) (-1181.792) -- 0:00:33 473000 -- (-1184.275) [-1180.066] (-1179.564) (-1178.350) * (-1182.701) (-1177.849) (-1178.337) [-1180.415] -- 0:00:33 473500 -- (-1181.768) [-1180.233] (-1179.552) (-1178.292) * (-1179.328) [-1177.938] (-1178.334) (-1179.633) -- 0:00:33 474000 -- (-1183.020) (-1178.937) [-1181.776] (-1179.025) * (-1177.903) [-1177.734] (-1178.428) (-1179.983) -- 0:00:33 474500 -- (-1178.489) [-1181.434] (-1179.049) (-1179.055) * (-1181.302) [-1179.326] (-1178.427) (-1180.507) -- 0:00:33 475000 -- (-1180.747) (-1180.609) (-1178.599) [-1181.168] * [-1180.796] (-1177.696) (-1178.571) (-1180.650) -- 0:00:33 Average standard deviation of split frequencies: 0.011418 475500 -- (-1179.252) (-1178.676) [-1178.224] (-1182.250) * (-1178.730) (-1181.922) [-1177.625] (-1179.400) -- 0:00:33 476000 -- (-1177.202) (-1178.532) (-1178.713) [-1179.175] * (-1178.549) (-1183.892) (-1179.195) [-1179.286] -- 0:00:33 476500 -- (-1177.153) (-1180.291) (-1179.781) [-1178.678] * (-1177.575) (-1178.851) (-1179.701) [-1179.162] -- 0:00:32 477000 -- [-1177.968] (-1178.525) (-1180.032) (-1179.348) * (-1180.534) [-1178.089] (-1177.354) (-1182.653) -- 0:00:32 477500 -- (-1178.973) (-1179.962) (-1180.034) [-1181.933] * (-1181.097) (-1179.731) [-1180.655] (-1182.353) -- 0:00:32 478000 -- (-1179.256) (-1180.080) (-1183.112) [-1181.691] * (-1182.961) (-1178.735) (-1182.316) [-1179.932] -- 0:00:32 478500 -- [-1177.961] (-1177.361) (-1178.570) (-1180.008) * (-1178.990) [-1178.666] (-1180.231) (-1180.094) -- 0:00:32 479000 -- (-1178.550) (-1177.267) (-1179.729) [-1178.940] * (-1179.460) [-1177.066] (-1182.819) (-1179.475) -- 0:00:32 479500 -- (-1179.817) [-1178.102] (-1181.995) (-1177.467) * (-1180.543) (-1179.455) (-1185.615) [-1178.672] -- 0:00:32 480000 -- (-1179.673) (-1178.598) [-1181.703] (-1179.160) * (-1179.925) [-1181.211] (-1179.090) (-1177.531) -- 0:00:32 Average standard deviation of split frequencies: 0.011830 480500 -- [-1178.499] (-1181.429) (-1179.180) (-1178.609) * (-1177.933) (-1179.447) (-1178.642) [-1178.689] -- 0:00:32 481000 -- (-1177.042) (-1178.462) [-1180.461] (-1179.228) * (-1181.629) (-1177.986) (-1177.815) [-1180.918] -- 0:00:32 481500 -- (-1177.542) [-1181.039] (-1181.567) (-1178.852) * (-1178.052) (-1178.842) (-1180.207) [-1181.681] -- 0:00:32 482000 -- [-1181.099] (-1181.801) (-1180.453) (-1177.147) * (-1177.304) [-1182.949] (-1182.605) (-1178.856) -- 0:00:32 482500 -- (-1181.759) (-1177.335) (-1179.517) [-1179.759] * [-1177.493] (-1178.993) (-1182.899) (-1179.525) -- 0:00:32 483000 -- [-1177.051] (-1178.089) (-1179.464) (-1179.175) * (-1177.351) (-1178.515) [-1178.512] (-1179.850) -- 0:00:32 483500 -- (-1177.120) (-1179.275) [-1177.760] (-1178.672) * (-1177.094) (-1177.338) [-1177.544] (-1180.911) -- 0:00:32 484000 -- (-1177.430) (-1181.786) (-1181.804) [-1181.330] * (-1178.955) [-1178.085] (-1179.607) (-1183.134) -- 0:00:31 484500 -- (-1179.234) (-1179.508) [-1179.873] (-1177.680) * (-1181.674) (-1181.665) (-1183.977) [-1178.521] -- 0:00:31 485000 -- (-1177.498) (-1177.713) [-1179.092] (-1181.730) * (-1182.217) (-1179.476) [-1182.057] (-1177.907) -- 0:00:31 Average standard deviation of split frequencies: 0.011397 485500 -- [-1178.148] (-1179.282) (-1182.387) (-1179.915) * (-1178.171) (-1178.744) (-1179.376) [-1178.488] -- 0:00:31 486000 -- (-1178.271) [-1178.585] (-1179.197) (-1180.508) * (-1182.318) (-1183.552) [-1184.375] (-1179.950) -- 0:00:31 486500 -- (-1185.470) [-1178.189] (-1178.675) (-1180.186) * (-1179.313) (-1178.206) (-1179.488) [-1181.058] -- 0:00:31 487000 -- (-1181.253) [-1178.099] (-1178.424) (-1187.064) * (-1180.907) [-1177.669] (-1178.459) (-1179.962) -- 0:00:31 487500 -- (-1179.513) (-1178.982) [-1179.022] (-1178.479) * (-1178.562) [-1181.006] (-1179.120) (-1180.466) -- 0:00:32 488000 -- (-1178.091) (-1178.243) [-1181.579] (-1179.038) * (-1178.049) [-1180.197] (-1178.593) (-1178.941) -- 0:00:32 488500 -- (-1178.728) (-1178.213) (-1179.711) [-1181.273] * [-1177.459] (-1181.980) (-1179.718) (-1177.433) -- 0:00:32 489000 -- (-1181.616) [-1178.223] (-1182.273) (-1178.442) * [-1178.949] (-1181.299) (-1179.974) (-1178.914) -- 0:00:32 489500 -- [-1178.882] (-1177.508) (-1181.228) (-1186.891) * (-1181.653) (-1185.512) [-1180.128] (-1178.129) -- 0:00:32 490000 -- [-1178.758] (-1177.786) (-1181.646) (-1178.015) * (-1182.042) (-1180.843) (-1178.143) [-1179.003] -- 0:00:32 Average standard deviation of split frequencies: 0.011409 490500 -- [-1178.800] (-1177.263) (-1180.865) (-1180.244) * (-1180.823) (-1184.282) [-1176.967] (-1177.782) -- 0:00:32 491000 -- [-1179.390] (-1178.326) (-1181.605) (-1180.067) * [-1181.160] (-1178.610) (-1178.822) (-1180.065) -- 0:00:32 491500 -- (-1178.293) (-1183.070) [-1179.561] (-1178.926) * (-1179.785) (-1181.910) (-1178.838) [-1179.707] -- 0:00:32 492000 -- (-1178.299) (-1181.946) [-1179.386] (-1178.173) * [-1180.174] (-1177.480) (-1177.834) (-1180.851) -- 0:00:32 492500 -- (-1180.291) (-1181.642) [-1179.526] (-1180.760) * (-1181.569) [-1176.968] (-1178.182) (-1179.838) -- 0:00:31 493000 -- (-1180.974) (-1182.002) [-1179.525] (-1179.597) * (-1181.766) [-1176.970] (-1178.457) (-1178.331) -- 0:00:31 493500 -- (-1177.593) [-1181.165] (-1178.423) (-1179.528) * (-1179.547) [-1177.256] (-1177.591) (-1177.466) -- 0:00:31 494000 -- (-1180.115) (-1180.060) [-1178.283] (-1176.899) * [-1179.700] (-1177.813) (-1179.424) (-1178.167) -- 0:00:31 494500 -- (-1178.854) (-1181.349) [-1178.674] (-1177.390) * [-1177.905] (-1180.876) (-1179.553) (-1178.823) -- 0:00:31 495000 -- (-1179.162) [-1182.133] (-1179.790) (-1178.828) * [-1178.472] (-1178.480) (-1178.725) (-1178.077) -- 0:00:31 Average standard deviation of split frequencies: 0.010811 495500 -- (-1182.823) [-1180.864] (-1178.916) (-1176.961) * (-1177.070) [-1180.021] (-1179.080) (-1178.487) -- 0:00:31 496000 -- (-1180.933) (-1178.639) (-1180.920) [-1178.236] * (-1180.524) (-1178.753) [-1177.350] (-1178.976) -- 0:00:31 496500 -- (-1179.264) [-1178.471] (-1177.029) (-1179.971) * (-1179.247) (-1181.518) [-1177.857] (-1181.250) -- 0:00:31 497000 -- [-1177.809] (-1178.348) (-1177.177) (-1180.079) * (-1179.038) (-1179.404) [-1177.843] (-1180.391) -- 0:00:31 497500 -- (-1177.709) [-1177.340] (-1180.240) (-1178.229) * (-1178.839) (-1178.066) [-1177.395] (-1180.007) -- 0:00:31 498000 -- [-1177.105] (-1180.951) (-1178.520) (-1184.446) * (-1179.258) (-1180.724) [-1177.604] (-1179.205) -- 0:00:31 498500 -- (-1176.887) (-1181.976) (-1181.381) [-1179.291] * [-1179.256] (-1179.491) (-1178.901) (-1181.061) -- 0:00:31 499000 -- (-1177.551) (-1177.572) [-1180.068] (-1178.307) * (-1182.590) [-1180.181] (-1180.558) (-1182.402) -- 0:00:31 499500 -- [-1177.561] (-1177.954) (-1179.616) (-1179.439) * (-1178.905) (-1184.097) (-1179.164) [-1179.092] -- 0:00:31 500000 -- (-1179.885) (-1181.492) (-1179.431) [-1178.767] * [-1178.924] (-1187.020) (-1179.630) (-1179.422) -- 0:00:31 Average standard deviation of split frequencies: 0.010651 500500 -- (-1180.836) (-1187.490) [-1177.603] (-1178.514) * (-1180.091) (-1182.513) [-1178.312] (-1177.994) -- 0:00:30 501000 -- (-1178.740) (-1186.959) (-1177.838) [-1179.222] * [-1179.716] (-1180.793) (-1177.486) (-1180.340) -- 0:00:30 501500 -- [-1178.965] (-1184.563) (-1182.651) (-1179.831) * (-1179.976) (-1180.372) (-1178.222) [-1177.736] -- 0:00:30 502000 -- (-1180.398) (-1181.777) (-1179.657) [-1179.208] * (-1178.748) (-1179.387) [-1178.632] (-1180.053) -- 0:00:30 502500 -- (-1180.495) (-1179.934) [-1179.183] (-1178.592) * (-1178.693) (-1178.193) [-1181.007] (-1179.694) -- 0:00:30 503000 -- [-1180.071] (-1178.137) (-1179.034) (-1184.660) * [-1178.395] (-1177.876) (-1181.147) (-1179.241) -- 0:00:30 503500 -- (-1178.840) [-1180.192] (-1183.223) (-1177.946) * (-1177.661) (-1180.091) [-1178.967] (-1179.755) -- 0:00:30 504000 -- (-1180.079) (-1184.021) [-1179.340] (-1185.023) * [-1177.460] (-1180.213) (-1180.937) (-1180.198) -- 0:00:31 504500 -- [-1178.755] (-1179.080) (-1178.715) (-1185.349) * (-1177.166) (-1178.482) [-1178.754] (-1178.282) -- 0:00:31 505000 -- [-1178.892] (-1182.191) (-1180.842) (-1186.445) * (-1178.134) (-1179.474) [-1179.185] (-1182.744) -- 0:00:31 Average standard deviation of split frequencies: 0.011005 505500 -- [-1180.699] (-1183.022) (-1181.509) (-1183.321) * (-1189.929) [-1182.447] (-1182.946) (-1178.119) -- 0:00:31 506000 -- (-1179.695) [-1178.568] (-1178.909) (-1177.208) * [-1180.855] (-1180.844) (-1178.559) (-1177.941) -- 0:00:31 506500 -- (-1185.955) [-1177.966] (-1178.092) (-1178.594) * (-1178.668) (-1179.750) (-1178.115) [-1181.523] -- 0:00:31 507000 -- (-1186.325) [-1178.589] (-1179.418) (-1179.330) * (-1179.898) (-1180.634) (-1178.432) [-1178.941] -- 0:00:31 507500 -- [-1184.275] (-1178.159) (-1179.173) (-1178.618) * [-1177.609] (-1182.702) (-1181.373) (-1179.024) -- 0:00:31 508000 -- (-1177.364) [-1178.521] (-1179.709) (-1178.516) * (-1177.611) (-1181.942) (-1181.439) [-1181.273] -- 0:00:30 508500 -- (-1179.014) [-1178.191] (-1182.016) (-1178.593) * [-1177.291] (-1183.715) (-1180.675) (-1181.552) -- 0:00:30 509000 -- (-1179.678) (-1179.140) (-1177.768) [-1178.465] * (-1178.844) (-1181.641) [-1181.435] (-1178.071) -- 0:00:30 509500 -- [-1178.131] (-1183.300) (-1179.513) (-1177.258) * (-1180.789) [-1180.182] (-1179.117) (-1178.013) -- 0:00:30 510000 -- (-1180.449) (-1180.290) (-1179.068) [-1177.279] * (-1181.604) (-1180.465) (-1182.308) [-1178.471] -- 0:00:30 Average standard deviation of split frequencies: 0.011654 510500 -- (-1181.126) [-1180.504] (-1179.413) (-1178.712) * [-1178.814] (-1182.198) (-1179.927) (-1178.649) -- 0:00:30 511000 -- (-1181.976) [-1179.258] (-1177.663) (-1177.665) * (-1178.403) (-1179.139) (-1180.219) [-1178.363] -- 0:00:30 511500 -- (-1180.845) [-1178.927] (-1180.511) (-1177.318) * (-1178.277) [-1177.489] (-1178.913) (-1177.940) -- 0:00:30 512000 -- (-1179.904) (-1184.879) [-1177.587] (-1183.332) * (-1179.585) (-1178.836) (-1180.973) [-1178.143] -- 0:00:30 512500 -- [-1178.967] (-1179.116) (-1177.495) (-1185.593) * (-1180.852) (-1181.288) [-1181.517] (-1178.464) -- 0:00:30 513000 -- (-1181.440) (-1178.067) (-1182.580) [-1182.801] * [-1177.266] (-1180.314) (-1179.218) (-1177.334) -- 0:00:30 513500 -- (-1179.528) (-1178.705) (-1179.610) [-1181.242] * (-1179.775) (-1179.539) [-1177.317] (-1178.082) -- 0:00:30 514000 -- (-1180.705) (-1180.555) (-1178.907) [-1177.134] * [-1178.952] (-1177.955) (-1178.556) (-1181.365) -- 0:00:30 514500 -- (-1180.399) (-1178.346) [-1181.050] (-1178.227) * (-1177.294) (-1177.872) [-1179.069] (-1177.535) -- 0:00:30 515000 -- [-1180.346] (-1178.781) (-1179.427) (-1180.812) * [-1180.389] (-1178.913) (-1181.830) (-1178.360) -- 0:00:30 Average standard deviation of split frequencies: 0.012105 515500 -- [-1181.924] (-1178.693) (-1179.310) (-1178.296) * [-1177.883] (-1182.487) (-1178.480) (-1178.969) -- 0:00:30 516000 -- (-1184.366) (-1177.592) (-1182.156) [-1180.625] * (-1179.258) (-1180.246) [-1177.206] (-1178.637) -- 0:00:30 516500 -- [-1179.909] (-1177.481) (-1178.804) (-1183.185) * (-1179.749) [-1182.076] (-1177.285) (-1181.598) -- 0:00:29 517000 -- (-1181.838) (-1177.716) [-1184.310] (-1180.545) * (-1182.212) (-1178.573) [-1181.197] (-1183.917) -- 0:00:29 517500 -- (-1179.512) [-1178.069] (-1182.870) (-1183.930) * [-1178.708] (-1177.880) (-1180.342) (-1180.597) -- 0:00:29 518000 -- (-1180.114) (-1178.367) (-1179.334) [-1179.480] * (-1178.887) (-1179.514) (-1185.039) [-1184.043] -- 0:00:29 518500 -- (-1178.783) (-1179.027) (-1181.105) [-1180.106] * (-1180.317) [-1177.431] (-1179.209) (-1179.959) -- 0:00:29 519000 -- (-1180.016) (-1178.578) [-1180.408] (-1183.001) * (-1179.228) (-1178.128) [-1180.765] (-1179.629) -- 0:00:29 519500 -- [-1178.738] (-1178.494) (-1182.417) (-1179.712) * (-1178.458) (-1181.403) [-1179.630] (-1181.134) -- 0:00:29 520000 -- (-1179.792) (-1177.545) (-1180.301) [-1177.669] * (-1179.580) [-1180.450] (-1178.076) (-1180.429) -- 0:00:30 Average standard deviation of split frequencies: 0.012053 520500 -- (-1181.946) (-1178.529) (-1180.511) [-1180.012] * (-1182.825) (-1178.179) [-1179.374] (-1180.906) -- 0:00:30 521000 -- (-1181.349) (-1179.862) (-1178.445) [-1180.991] * (-1178.770) (-1179.959) [-1177.972] (-1180.140) -- 0:00:30 521500 -- (-1183.616) (-1178.156) [-1179.706] (-1179.167) * (-1180.028) (-1183.432) (-1178.146) [-1177.441] -- 0:00:30 522000 -- [-1178.838] (-1177.690) (-1181.912) (-1178.551) * (-1177.765) (-1180.613) [-1180.298] (-1180.661) -- 0:00:30 522500 -- (-1178.391) (-1178.268) [-1177.956] (-1180.691) * [-1178.421] (-1178.234) (-1180.017) (-1177.131) -- 0:00:30 523000 -- (-1179.321) (-1187.728) (-1178.565) [-1177.461] * (-1178.988) [-1177.978] (-1179.096) (-1183.406) -- 0:00:30 523500 -- (-1180.994) (-1178.115) (-1178.257) [-1177.363] * (-1183.753) (-1179.089) (-1177.488) [-1177.931] -- 0:00:30 524000 -- (-1179.640) (-1177.569) [-1179.953] (-1177.516) * (-1178.774) (-1177.867) [-1177.905] (-1178.009) -- 0:00:29 524500 -- (-1177.834) [-1177.833] (-1180.206) (-1177.520) * (-1178.018) (-1177.427) (-1177.287) [-1178.969] -- 0:00:29 525000 -- (-1181.311) (-1179.664) [-1183.542] (-1177.186) * [-1177.540] (-1178.828) (-1177.526) (-1181.007) -- 0:00:29 Average standard deviation of split frequencies: 0.011931 525500 -- (-1178.096) [-1178.054] (-1179.994) (-1179.092) * (-1180.062) (-1177.472) [-1180.910] (-1177.804) -- 0:00:29 526000 -- (-1183.369) [-1178.298] (-1179.559) (-1180.655) * [-1178.148] (-1177.122) (-1179.078) (-1179.655) -- 0:00:29 526500 -- [-1177.323] (-1177.577) (-1183.671) (-1178.855) * [-1177.244] (-1177.796) (-1178.853) (-1179.307) -- 0:00:29 527000 -- [-1177.844] (-1177.985) (-1180.228) (-1178.191) * [-1178.007] (-1177.252) (-1179.454) (-1178.352) -- 0:00:29 527500 -- [-1180.280] (-1178.671) (-1183.568) (-1179.979) * (-1179.003) [-1177.218] (-1181.035) (-1178.133) -- 0:00:29 528000 -- (-1179.878) (-1178.541) [-1182.345] (-1180.151) * [-1177.896] (-1177.234) (-1178.452) (-1182.034) -- 0:00:29 528500 -- [-1183.235] (-1177.616) (-1177.348) (-1180.548) * (-1179.579) (-1180.035) (-1180.151) [-1181.997] -- 0:00:29 529000 -- [-1180.737] (-1182.695) (-1179.636) (-1178.122) * (-1180.740) (-1180.129) [-1180.703] (-1177.293) -- 0:00:29 529500 -- [-1178.722] (-1179.248) (-1178.344) (-1177.839) * [-1179.405] (-1180.524) (-1179.816) (-1180.400) -- 0:00:29 530000 -- [-1183.131] (-1180.534) (-1177.089) (-1180.427) * (-1181.617) [-1177.792] (-1180.701) (-1179.459) -- 0:00:29 Average standard deviation of split frequencies: 0.011715 530500 -- (-1186.324) (-1180.680) [-1179.741] (-1179.112) * (-1177.769) (-1178.230) [-1182.207] (-1180.475) -- 0:00:29 531000 -- (-1180.192) (-1179.304) [-1180.544] (-1179.089) * (-1179.745) (-1177.373) (-1179.673) [-1178.582] -- 0:00:29 531500 -- (-1178.184) (-1179.953) (-1178.393) [-1181.201] * [-1178.673] (-1178.154) (-1181.217) (-1179.243) -- 0:00:29 532000 -- [-1178.032] (-1178.892) (-1178.658) (-1183.177) * [-1178.431] (-1177.935) (-1184.965) (-1182.785) -- 0:00:29 532500 -- (-1179.102) (-1177.861) (-1181.224) [-1180.896] * (-1178.932) (-1178.134) [-1179.596] (-1181.904) -- 0:00:28 533000 -- (-1178.971) (-1180.374) [-1179.939] (-1178.792) * (-1179.238) (-1178.299) (-1178.208) [-1179.548] -- 0:00:28 533500 -- (-1179.811) (-1181.362) [-1178.784] (-1178.379) * (-1179.276) (-1177.296) [-1177.700] (-1177.696) -- 0:00:28 534000 -- (-1178.822) (-1184.479) [-1178.331] (-1179.662) * [-1179.500] (-1178.865) (-1178.289) (-1180.084) -- 0:00:28 534500 -- [-1178.709] (-1180.177) (-1178.996) (-1181.353) * (-1183.000) [-1180.233] (-1181.162) (-1184.627) -- 0:00:28 535000 -- (-1178.951) [-1179.329] (-1178.386) (-1179.985) * (-1178.585) (-1180.107) (-1182.638) [-1182.169] -- 0:00:28 Average standard deviation of split frequencies: 0.011268 535500 -- [-1183.600] (-1181.911) (-1179.458) (-1181.688) * (-1178.592) [-1180.894] (-1179.210) (-1181.373) -- 0:00:28 536000 -- (-1178.877) (-1180.667) (-1179.730) [-1178.233] * (-1179.356) [-1178.581] (-1179.021) (-1177.540) -- 0:00:28 536500 -- (-1179.135) [-1178.217] (-1178.306) (-1179.703) * (-1177.187) (-1178.560) [-1178.959] (-1179.189) -- 0:00:29 537000 -- (-1177.346) (-1177.554) [-1178.025] (-1181.881) * [-1178.003] (-1184.123) (-1183.161) (-1178.113) -- 0:00:29 537500 -- (-1182.079) [-1177.532] (-1178.569) (-1179.566) * (-1179.391) [-1180.119] (-1178.587) (-1183.065) -- 0:00:29 538000 -- (-1182.428) [-1179.118] (-1178.855) (-1180.664) * [-1178.569] (-1178.410) (-1178.848) (-1179.677) -- 0:00:29 538500 -- (-1179.134) (-1177.898) (-1179.115) [-1178.787] * [-1178.122] (-1179.725) (-1178.369) (-1177.426) -- 0:00:29 539000 -- (-1181.069) [-1178.227] (-1182.191) (-1178.754) * (-1178.804) (-1179.860) (-1179.976) [-1177.591] -- 0:00:29 539500 -- [-1178.811] (-1180.189) (-1179.392) (-1180.916) * [-1178.824] (-1181.777) (-1177.462) (-1180.699) -- 0:00:29 540000 -- [-1177.687] (-1179.201) (-1182.721) (-1180.473) * (-1180.261) (-1184.475) (-1177.250) [-1180.340] -- 0:00:28 Average standard deviation of split frequencies: 0.011934 540500 -- (-1179.034) (-1177.590) [-1179.694] (-1178.463) * (-1182.340) (-1180.574) [-1177.692] (-1180.264) -- 0:00:28 541000 -- [-1177.356] (-1177.865) (-1180.354) (-1181.026) * [-1177.882] (-1181.012) (-1177.843) (-1182.260) -- 0:00:28 541500 -- (-1177.351) [-1178.985] (-1179.436) (-1179.672) * (-1179.481) (-1180.732) (-1178.349) [-1179.144] -- 0:00:28 542000 -- (-1177.343) [-1182.214] (-1179.318) (-1178.709) * [-1177.395] (-1181.433) (-1180.166) (-1178.651) -- 0:00:28 542500 -- (-1177.284) [-1183.557] (-1179.965) (-1178.961) * (-1178.632) (-1178.847) [-1179.951] (-1179.723) -- 0:00:28 543000 -- (-1180.372) [-1183.900] (-1181.045) (-1180.855) * [-1177.572] (-1177.983) (-1180.059) (-1186.804) -- 0:00:28 543500 -- [-1178.201] (-1177.941) (-1178.616) (-1180.178) * (-1179.073) [-1179.954] (-1182.008) (-1184.491) -- 0:00:28 544000 -- (-1177.423) (-1177.928) [-1179.918] (-1178.393) * [-1178.588] (-1178.778) (-1179.780) (-1179.850) -- 0:00:28 544500 -- (-1178.073) (-1178.158) (-1178.349) [-1177.647] * (-1178.831) (-1177.604) (-1179.984) [-1179.641] -- 0:00:28 545000 -- (-1181.010) (-1178.397) (-1178.477) [-1179.400] * [-1178.617] (-1178.777) (-1178.465) (-1178.661) -- 0:00:28 Average standard deviation of split frequencies: 0.012290 545500 -- [-1178.440] (-1177.307) (-1177.725) (-1179.276) * (-1177.226) (-1178.576) (-1177.905) [-1184.154] -- 0:00:28 546000 -- (-1178.331) (-1178.409) (-1178.660) [-1177.769] * [-1177.959] (-1180.257) (-1177.579) (-1177.831) -- 0:00:28 546500 -- (-1178.353) (-1180.197) (-1179.260) [-1178.438] * (-1179.561) (-1181.816) [-1178.700] (-1178.125) -- 0:00:28 547000 -- (-1178.842) (-1178.341) [-1180.143] (-1179.548) * (-1180.108) [-1179.849] (-1179.820) (-1178.592) -- 0:00:28 547500 -- (-1178.128) (-1181.970) [-1181.210] (-1179.181) * (-1179.021) (-1180.822) [-1178.739] (-1180.618) -- 0:00:28 548000 -- (-1178.077) (-1178.453) [-1178.685] (-1180.073) * (-1182.635) [-1181.357] (-1177.920) (-1180.915) -- 0:00:28 548500 -- (-1179.565) [-1182.060] (-1179.415) (-1180.582) * (-1180.222) [-1180.509] (-1178.934) (-1179.321) -- 0:00:27 549000 -- (-1184.597) (-1179.243) [-1179.475] (-1178.719) * [-1178.798] (-1182.240) (-1177.339) (-1179.321) -- 0:00:27 549500 -- (-1182.866) (-1181.004) [-1177.629] (-1177.060) * (-1178.956) (-1178.816) [-1177.339] (-1178.080) -- 0:00:27 550000 -- (-1177.921) [-1178.152] (-1179.960) (-1177.756) * (-1181.635) [-1183.694] (-1177.993) (-1177.751) -- 0:00:27 Average standard deviation of split frequencies: 0.012199 550500 -- (-1177.931) (-1184.589) (-1177.841) [-1177.907] * [-1178.551] (-1181.900) (-1178.000) (-1177.198) -- 0:00:27 551000 -- (-1185.507) (-1177.759) [-1177.841] (-1178.874) * [-1177.873] (-1179.060) (-1178.898) (-1177.908) -- 0:00:27 551500 -- (-1181.371) [-1177.870] (-1177.590) (-1177.663) * (-1179.229) [-1180.148] (-1178.340) (-1178.562) -- 0:00:27 552000 -- (-1181.579) (-1179.542) [-1177.748] (-1182.748) * (-1180.147) (-1181.776) [-1179.666] (-1177.427) -- 0:00:27 552500 -- (-1180.521) [-1179.156] (-1178.147) (-1180.157) * (-1177.781) [-1179.715] (-1181.040) (-1180.507) -- 0:00:27 553000 -- (-1180.138) (-1177.472) (-1178.604) [-1179.412] * (-1177.335) (-1184.368) [-1180.159] (-1178.660) -- 0:00:28 553500 -- [-1179.761] (-1178.459) (-1178.802) (-1179.511) * (-1178.985) (-1179.263) [-1180.273] (-1179.986) -- 0:00:28 554000 -- [-1179.635] (-1179.703) (-1179.264) (-1181.275) * (-1179.103) (-1179.864) [-1182.348] (-1180.068) -- 0:00:28 554500 -- (-1178.560) (-1178.222) (-1178.181) [-1179.173] * (-1180.266) [-1179.605] (-1177.539) (-1178.466) -- 0:00:28 555000 -- (-1180.785) (-1181.721) [-1181.577] (-1178.467) * (-1177.371) (-1180.364) (-1182.667) [-1181.527] -- 0:00:28 Average standard deviation of split frequencies: 0.013407 555500 -- (-1180.373) [-1178.100] (-1178.269) (-1178.631) * (-1180.768) (-1183.718) [-1179.810] (-1178.132) -- 0:00:28 556000 -- [-1181.160] (-1182.182) (-1181.671) (-1178.073) * (-1177.167) [-1181.856] (-1177.488) (-1177.118) -- 0:00:27 556500 -- (-1180.113) (-1178.544) [-1180.298] (-1177.600) * [-1177.111] (-1177.884) (-1181.454) (-1177.341) -- 0:00:27 557000 -- (-1178.572) [-1178.128] (-1182.013) (-1179.497) * [-1177.108] (-1180.690) (-1180.546) (-1180.377) -- 0:00:27 557500 -- [-1178.328] (-1179.993) (-1179.144) (-1179.177) * (-1177.076) (-1178.080) (-1178.032) [-1180.562] -- 0:00:27 558000 -- (-1180.641) [-1177.678] (-1178.284) (-1182.478) * (-1179.604) (-1178.105) (-1177.881) [-1178.050] -- 0:00:27 558500 -- (-1179.267) (-1178.752) [-1177.918] (-1181.914) * [-1178.905] (-1177.280) (-1178.042) (-1179.062) -- 0:00:27 559000 -- (-1180.599) [-1177.515] (-1182.784) (-1177.946) * [-1179.515] (-1178.149) (-1178.156) (-1180.248) -- 0:00:27 559500 -- (-1177.585) (-1177.592) (-1177.198) [-1178.137] * [-1178.341] (-1181.493) (-1178.022) (-1183.152) -- 0:00:27 560000 -- (-1183.042) [-1178.713] (-1182.021) (-1179.072) * [-1177.546] (-1177.922) (-1177.184) (-1179.785) -- 0:00:27 Average standard deviation of split frequencies: 0.013085 560500 -- (-1180.314) (-1180.037) [-1179.703] (-1178.585) * [-1177.415] (-1180.121) (-1178.223) (-1179.602) -- 0:00:27 561000 -- (-1180.043) (-1180.950) (-1179.002) [-1177.467] * (-1181.847) [-1179.580] (-1177.228) (-1177.709) -- 0:00:27 561500 -- (-1179.779) (-1181.253) [-1178.147] (-1182.635) * [-1178.448] (-1180.348) (-1180.111) (-1177.526) -- 0:00:27 562000 -- [-1177.376] (-1179.603) (-1179.635) (-1178.218) * (-1177.463) (-1177.476) (-1179.803) [-1178.178] -- 0:00:27 562500 -- [-1178.998] (-1178.889) (-1177.930) (-1179.279) * [-1178.058] (-1180.779) (-1177.945) (-1179.688) -- 0:00:27 563000 -- [-1179.783] (-1182.045) (-1178.115) (-1181.153) * (-1178.556) [-1180.468] (-1181.661) (-1177.100) -- 0:00:27 563500 -- (-1178.703) [-1179.029] (-1180.642) (-1180.006) * (-1178.095) (-1178.067) [-1183.800] (-1182.104) -- 0:00:27 564000 -- (-1178.812) (-1178.073) (-1177.866) [-1183.554] * (-1179.319) (-1177.596) [-1184.333] (-1177.958) -- 0:00:27 564500 -- [-1179.886] (-1179.763) (-1180.737) (-1180.534) * [-1179.505] (-1179.439) (-1182.201) (-1179.086) -- 0:00:27 565000 -- (-1179.428) [-1178.992] (-1178.046) (-1178.355) * (-1179.123) (-1178.775) [-1176.919] (-1182.084) -- 0:00:26 Average standard deviation of split frequencies: 0.013375 565500 -- [-1177.429] (-1178.767) (-1177.999) (-1179.525) * (-1190.121) (-1177.943) (-1176.901) [-1180.258] -- 0:00:26 566000 -- [-1179.218] (-1177.701) (-1179.014) (-1178.892) * (-1178.367) (-1178.620) [-1176.902] (-1183.143) -- 0:00:26 566500 -- [-1180.060] (-1179.365) (-1178.346) (-1182.335) * (-1178.569) (-1180.018) (-1177.267) [-1179.780] -- 0:00:26 567000 -- (-1179.326) (-1180.983) (-1178.078) [-1180.270] * (-1183.661) [-1180.699] (-1177.482) (-1178.679) -- 0:00:26 567500 -- (-1177.907) (-1186.399) (-1179.037) [-1178.326] * (-1182.453) (-1178.258) (-1179.263) [-1178.559] -- 0:00:26 568000 -- [-1178.333] (-1180.914) (-1178.536) (-1182.268) * (-1179.343) (-1177.829) [-1179.414] (-1178.688) -- 0:00:26 568500 -- (-1181.745) (-1180.512) (-1179.706) [-1177.773] * (-1180.410) (-1181.542) (-1180.976) [-1180.957] -- 0:00:26 569000 -- (-1180.287) (-1177.455) (-1177.268) [-1178.034] * [-1179.374] (-1179.748) (-1180.811) (-1179.277) -- 0:00:26 569500 -- (-1179.111) (-1179.728) (-1179.052) [-1178.705] * (-1177.847) (-1180.015) (-1178.695) [-1183.403] -- 0:00:27 570000 -- (-1180.711) [-1177.671] (-1180.955) (-1182.078) * [-1179.731] (-1183.801) (-1178.661) (-1178.544) -- 0:00:27 Average standard deviation of split frequencies: 0.013703 570500 -- (-1181.661) [-1177.426] (-1180.801) (-1180.706) * (-1179.853) (-1184.388) [-1178.906] (-1181.251) -- 0:00:27 571000 -- (-1177.963) (-1178.153) (-1178.180) [-1179.134] * (-1181.901) [-1179.459] (-1180.384) (-1177.925) -- 0:00:27 571500 -- (-1178.286) [-1179.118] (-1179.644) (-1180.148) * [-1181.349] (-1180.656) (-1179.430) (-1178.605) -- 0:00:26 572000 -- (-1177.483) (-1178.968) [-1179.001] (-1178.840) * [-1179.164] (-1179.397) (-1179.295) (-1181.522) -- 0:00:26 572500 -- [-1180.328] (-1179.895) (-1178.135) (-1179.051) * (-1183.027) (-1178.046) [-1179.034] (-1181.202) -- 0:00:26 573000 -- [-1179.939] (-1181.209) (-1177.925) (-1178.926) * (-1181.044) (-1181.173) [-1180.994] (-1178.742) -- 0:00:26 573500 -- (-1181.949) (-1181.761) [-1178.021] (-1177.613) * [-1177.908] (-1181.748) (-1178.867) (-1178.320) -- 0:00:26 574000 -- (-1179.164) (-1179.846) [-1178.533] (-1178.294) * (-1179.543) (-1178.251) (-1179.481) [-1178.978] -- 0:00:26 574500 -- [-1179.102] (-1179.965) (-1179.516) (-1178.073) * (-1183.035) (-1178.763) [-1179.105] (-1179.290) -- 0:00:26 575000 -- [-1179.635] (-1179.198) (-1181.386) (-1177.519) * (-1180.388) (-1178.153) (-1178.127) [-1179.866] -- 0:00:26 Average standard deviation of split frequencies: 0.013769 575500 -- (-1182.162) (-1182.147) (-1178.522) [-1177.047] * (-1181.337) (-1179.062) (-1180.372) [-1178.709] -- 0:00:26 576000 -- (-1180.783) (-1178.850) (-1183.419) [-1178.637] * (-1179.341) (-1179.723) (-1178.444) [-1182.615] -- 0:00:26 576500 -- [-1181.756] (-1177.661) (-1181.109) (-1179.426) * [-1176.928] (-1177.166) (-1178.766) (-1181.175) -- 0:00:26 577000 -- (-1178.784) (-1178.274) (-1185.072) [-1178.037] * (-1179.006) [-1178.449] (-1178.254) (-1179.325) -- 0:00:26 577500 -- [-1178.129] (-1178.273) (-1180.572) (-1177.812) * (-1179.422) (-1184.152) (-1181.002) [-1180.944] -- 0:00:26 578000 -- (-1179.209) (-1177.588) (-1179.771) [-1181.768] * (-1185.958) (-1180.989) [-1179.052] (-1180.883) -- 0:00:26 578500 -- [-1178.581] (-1177.443) (-1181.885) (-1180.910) * [-1179.353] (-1179.720) (-1180.179) (-1186.781) -- 0:00:26 579000 -- (-1178.236) [-1177.532] (-1178.732) (-1178.047) * (-1179.196) (-1178.464) [-1177.714] (-1181.318) -- 0:00:26 579500 -- (-1178.602) (-1178.418) (-1177.526) [-1177.179] * (-1180.535) (-1184.822) [-1177.431] (-1178.062) -- 0:00:26 580000 -- (-1177.488) [-1179.339] (-1178.592) (-1182.684) * (-1179.994) (-1186.031) (-1177.997) [-1177.798] -- 0:00:26 Average standard deviation of split frequencies: 0.013706 580500 -- [-1179.318] (-1178.982) (-1178.498) (-1179.582) * (-1184.899) (-1180.003) (-1177.174) [-1179.273] -- 0:00:26 581000 -- (-1180.073) (-1179.723) (-1179.111) [-1179.626] * (-1178.228) (-1177.968) (-1179.503) [-1179.430] -- 0:00:25 581500 -- (-1180.666) (-1179.319) [-1177.835] (-1178.591) * (-1180.228) [-1178.963] (-1179.160) (-1179.383) -- 0:00:25 582000 -- (-1179.351) (-1179.928) (-1178.340) [-1180.145] * (-1179.289) (-1177.740) (-1179.539) [-1179.398] -- 0:00:25 582500 -- (-1178.360) (-1184.874) [-1178.501] (-1182.893) * (-1179.789) [-1179.358] (-1178.309) (-1180.186) -- 0:00:25 583000 -- (-1177.290) (-1177.974) (-1180.258) [-1179.448] * (-1178.773) [-1180.712] (-1184.086) (-1181.613) -- 0:00:25 583500 -- (-1180.143) [-1178.049] (-1183.685) (-1179.225) * [-1179.480] (-1181.447) (-1181.467) (-1179.968) -- 0:00:25 584000 -- (-1181.311) [-1178.315] (-1180.209) (-1179.103) * (-1178.619) (-1179.638) (-1178.447) [-1177.905] -- 0:00:25 584500 -- (-1180.009) [-1179.345] (-1181.495) (-1178.923) * (-1178.292) (-1179.448) (-1182.880) [-1179.187] -- 0:00:25 585000 -- (-1178.504) [-1178.680] (-1178.243) (-1178.055) * (-1177.181) (-1177.603) (-1182.904) [-1181.442] -- 0:00:25 Average standard deviation of split frequencies: 0.014007 585500 -- (-1178.205) (-1178.457) (-1177.373) [-1178.019] * (-1179.518) [-1178.538] (-1179.040) (-1182.809) -- 0:00:25 586000 -- (-1184.553) (-1177.997) [-1177.000] (-1178.999) * (-1179.496) [-1180.983] (-1179.231) (-1179.502) -- 0:00:26 586500 -- [-1182.215] (-1179.136) (-1179.346) (-1178.331) * (-1178.260) (-1182.633) (-1179.011) [-1180.773] -- 0:00:26 587000 -- (-1179.608) (-1178.880) (-1178.602) [-1177.776] * [-1181.147] (-1181.778) (-1181.830) (-1177.392) -- 0:00:26 587500 -- (-1178.522) [-1181.412] (-1178.854) (-1177.239) * (-1182.815) (-1180.163) (-1179.607) [-1178.945] -- 0:00:25 588000 -- (-1180.542) [-1178.222] (-1177.786) (-1183.716) * (-1180.229) (-1178.139) [-1178.681] (-1178.307) -- 0:00:25 588500 -- (-1179.949) [-1179.510] (-1179.451) (-1177.695) * (-1181.554) (-1177.843) [-1178.332] (-1183.239) -- 0:00:25 589000 -- (-1181.426) (-1178.390) [-1178.445] (-1181.249) * (-1178.606) [-1182.278] (-1177.895) (-1183.591) -- 0:00:25 589500 -- (-1181.204) (-1178.496) (-1177.304) [-1178.091] * [-1177.373] (-1178.468) (-1179.477) (-1181.846) -- 0:00:25 590000 -- (-1178.286) (-1178.469) (-1178.035) [-1178.635] * (-1177.363) (-1182.275) (-1180.018) [-1180.317] -- 0:00:25 Average standard deviation of split frequencies: 0.012957 590500 -- (-1180.054) (-1178.443) [-1177.815] (-1181.616) * (-1179.071) (-1183.744) [-1178.807] (-1179.535) -- 0:00:25 591000 -- (-1179.642) (-1178.660) [-1178.305] (-1178.464) * (-1178.191) (-1183.195) (-1182.837) [-1179.135] -- 0:00:25 591500 -- (-1179.078) [-1179.901] (-1178.320) (-1179.146) * [-1178.048] (-1179.483) (-1180.026) (-1178.301) -- 0:00:25 592000 -- (-1179.502) (-1180.035) (-1177.478) [-1181.048] * [-1178.883] (-1179.928) (-1178.611) (-1180.677) -- 0:00:25 592500 -- (-1179.360) (-1180.350) (-1183.564) [-1181.346] * (-1183.089) (-1180.214) [-1179.583] (-1189.401) -- 0:00:25 593000 -- (-1178.222) (-1178.494) [-1179.020] (-1177.908) * (-1179.635) [-1177.915] (-1177.845) (-1183.739) -- 0:00:25 593500 -- (-1179.706) (-1177.360) (-1181.105) [-1178.688] * (-1183.375) [-1177.560] (-1181.509) (-1183.714) -- 0:00:25 594000 -- (-1178.146) (-1177.289) (-1179.045) [-1178.347] * (-1178.589) (-1177.734) [-1180.515] (-1180.739) -- 0:00:25 594500 -- (-1178.240) [-1177.701] (-1182.711) (-1182.465) * (-1179.740) (-1179.277) (-1180.529) [-1182.612] -- 0:00:25 595000 -- (-1177.606) (-1178.184) [-1178.877] (-1183.838) * (-1178.681) (-1178.672) [-1178.431] (-1181.553) -- 0:00:25 Average standard deviation of split frequencies: 0.012562 595500 -- (-1180.305) [-1177.610] (-1178.970) (-1178.925) * (-1179.258) [-1178.799] (-1179.516) (-1177.719) -- 0:00:25 596000 -- (-1179.366) [-1181.534] (-1177.780) (-1180.084) * (-1179.373) (-1180.406) (-1181.119) [-1177.731] -- 0:00:25 596500 -- (-1180.645) [-1178.571] (-1179.343) (-1180.598) * (-1177.650) (-1183.576) [-1178.149] (-1180.523) -- 0:00:25 597000 -- (-1182.178) (-1180.957) (-1178.517) [-1177.949] * (-1181.213) (-1179.892) [-1179.422] (-1182.247) -- 0:00:24 597500 -- [-1178.530] (-1180.181) (-1179.704) (-1177.231) * (-1180.040) (-1179.185) [-1180.176] (-1181.454) -- 0:00:24 598000 -- [-1184.061] (-1185.382) (-1178.775) (-1178.503) * (-1179.556) (-1180.837) (-1179.835) [-1177.594] -- 0:00:24 598500 -- (-1178.624) [-1180.528] (-1177.516) (-1177.690) * (-1179.540) [-1179.029] (-1179.232) (-1180.359) -- 0:00:24 599000 -- [-1179.204] (-1178.560) (-1177.820) (-1179.908) * (-1182.218) (-1189.697) [-1178.586] (-1183.337) -- 0:00:24 599500 -- [-1178.823] (-1178.145) (-1177.471) (-1180.119) * (-1179.673) (-1181.322) [-1177.645] (-1181.273) -- 0:00:24 600000 -- (-1179.996) (-1178.330) [-1179.571] (-1181.230) * (-1182.114) [-1179.473] (-1178.592) (-1183.490) -- 0:00:24 Average standard deviation of split frequencies: 0.013065 600500 -- (-1178.939) (-1183.557) (-1177.562) [-1178.015] * (-1181.096) (-1179.534) (-1179.448) [-1177.547] -- 0:00:24 601000 -- (-1180.960) [-1179.953] (-1181.442) (-1179.977) * [-1179.883] (-1180.256) (-1178.326) (-1177.590) -- 0:00:24 601500 -- (-1177.881) (-1179.337) [-1181.829] (-1178.972) * (-1179.503) [-1179.436] (-1178.378) (-1177.191) -- 0:00:24 602000 -- (-1177.091) (-1179.379) (-1183.036) [-1179.868] * [-1179.041] (-1180.876) (-1180.539) (-1177.222) -- 0:00:24 602500 -- (-1179.887) (-1178.451) [-1179.505] (-1178.614) * [-1178.338] (-1179.613) (-1184.906) (-1177.565) -- 0:00:25 603000 -- (-1177.738) (-1178.585) [-1177.819] (-1178.284) * (-1177.408) (-1178.445) (-1179.561) [-1179.917] -- 0:00:25 603500 -- [-1179.043] (-1180.108) (-1177.924) (-1178.520) * (-1177.502) (-1177.944) [-1177.663] (-1181.081) -- 0:00:24 604000 -- (-1179.212) (-1177.147) (-1177.738) [-1179.074] * (-1179.371) [-1177.203] (-1177.860) (-1178.733) -- 0:00:24 604500 -- (-1181.150) (-1179.010) [-1177.193] (-1179.138) * (-1178.269) (-1182.203) [-1177.725] (-1179.166) -- 0:00:24 605000 -- [-1182.657] (-1177.960) (-1179.907) (-1179.012) * [-1177.493] (-1177.646) (-1178.439) (-1178.977) -- 0:00:24 Average standard deviation of split frequencies: 0.012858 605500 -- (-1178.980) (-1182.286) (-1178.254) [-1178.064] * (-1184.076) (-1178.755) [-1177.741] (-1183.013) -- 0:00:24 606000 -- (-1180.613) (-1182.292) [-1177.691] (-1177.910) * (-1180.993) (-1179.589) [-1178.315] (-1178.466) -- 0:00:24 606500 -- (-1181.272) (-1179.982) (-1177.854) [-1177.677] * [-1180.228] (-1178.145) (-1182.513) (-1179.777) -- 0:00:24 607000 -- [-1178.212] (-1181.661) (-1180.438) (-1180.325) * (-1182.054) (-1181.283) (-1180.782) [-1178.776] -- 0:00:24 607500 -- [-1178.093] (-1180.354) (-1179.699) (-1178.535) * (-1181.508) (-1179.511) [-1178.643] (-1177.968) -- 0:00:24 608000 -- (-1180.946) (-1181.952) [-1180.632] (-1178.120) * (-1180.813) (-1179.124) (-1177.684) [-1178.336] -- 0:00:24 608500 -- [-1180.830] (-1177.625) (-1180.769) (-1178.990) * (-1179.352) (-1179.368) (-1177.242) [-1177.883] -- 0:00:24 609000 -- (-1178.244) (-1181.476) (-1178.402) [-1177.565] * [-1179.386] (-1179.862) (-1178.024) (-1179.052) -- 0:00:24 609500 -- (-1177.225) [-1179.254] (-1178.936) (-1177.014) * (-1177.310) (-1179.778) [-1177.533] (-1178.984) -- 0:00:24 610000 -- (-1184.815) (-1178.165) (-1178.053) [-1178.619] * [-1177.338] (-1180.727) (-1178.317) (-1182.075) -- 0:00:24 Average standard deviation of split frequencies: 0.012578 610500 -- (-1179.235) (-1179.670) [-1177.829] (-1182.040) * [-1177.448] (-1180.275) (-1177.816) (-1178.069) -- 0:00:24 611000 -- (-1181.207) [-1178.508] (-1178.431) (-1178.447) * [-1177.337] (-1183.177) (-1179.029) (-1177.800) -- 0:00:24 611500 -- (-1181.080) [-1178.868] (-1177.971) (-1181.825) * (-1181.363) (-1186.506) [-1178.580] (-1182.023) -- 0:00:24 612000 -- (-1178.509) (-1177.734) (-1187.305) [-1186.161] * (-1181.330) (-1179.793) (-1180.583) [-1180.149] -- 0:00:24 612500 -- [-1180.420] (-1180.210) (-1178.668) (-1185.134) * [-1180.501] (-1179.362) (-1177.738) (-1178.994) -- 0:00:24 613000 -- (-1179.411) (-1177.356) (-1178.182) [-1180.406] * [-1177.816] (-1180.165) (-1178.660) (-1181.990) -- 0:00:23 613500 -- (-1177.777) (-1178.655) [-1178.487] (-1180.198) * [-1177.954] (-1178.462) (-1178.144) (-1179.594) -- 0:00:23 614000 -- (-1178.686) [-1178.141] (-1181.145) (-1179.077) * (-1177.786) [-1180.169] (-1178.395) (-1179.935) -- 0:00:23 614500 -- (-1180.439) [-1177.779] (-1177.488) (-1179.500) * [-1177.465] (-1183.023) (-1178.664) (-1177.847) -- 0:00:23 615000 -- (-1182.089) (-1178.234) (-1179.987) [-1179.618] * (-1177.432) (-1180.746) [-1179.586] (-1179.746) -- 0:00:23 Average standard deviation of split frequencies: 0.012379 615500 -- (-1183.318) (-1178.234) [-1179.574] (-1179.036) * (-1177.655) (-1178.293) (-1179.469) [-1177.412] -- 0:00:23 616000 -- (-1179.002) (-1177.969) (-1181.102) [-1178.685] * [-1181.150] (-1178.511) (-1180.100) (-1179.024) -- 0:00:23 616500 -- (-1179.764) [-1179.470] (-1178.640) (-1178.437) * [-1180.059] (-1179.269) (-1179.748) (-1178.690) -- 0:00:23 617000 -- (-1187.064) (-1180.488) (-1188.235) [-1177.588] * [-1180.165] (-1177.763) (-1179.488) (-1178.745) -- 0:00:23 617500 -- (-1182.957) (-1177.828) [-1179.273] (-1177.653) * (-1182.815) (-1178.206) (-1179.779) [-1178.314] -- 0:00:23 618000 -- (-1182.557) [-1178.113] (-1180.033) (-1178.145) * (-1181.560) (-1178.207) (-1178.207) [-1180.018] -- 0:00:23 618500 -- (-1180.966) (-1179.964) [-1180.489] (-1177.569) * (-1181.363) (-1178.848) (-1179.559) [-1178.811] -- 0:00:24 619000 -- [-1183.057] (-1177.755) (-1181.304) (-1179.667) * [-1181.782] (-1179.429) (-1181.743) (-1178.064) -- 0:00:24 619500 -- (-1179.480) [-1179.703] (-1179.981) (-1179.475) * (-1177.455) (-1178.313) (-1178.757) [-1178.311] -- 0:00:23 620000 -- (-1179.231) (-1180.389) [-1179.863] (-1182.338) * [-1180.269] (-1179.595) (-1178.442) (-1178.855) -- 0:00:23 Average standard deviation of split frequencies: 0.012331 620500 -- [-1179.781] (-1179.019) (-1180.691) (-1180.132) * (-1180.836) (-1182.069) [-1179.844] (-1181.632) -- 0:00:23 621000 -- (-1183.302) (-1180.126) [-1179.547] (-1178.559) * (-1177.909) [-1178.233] (-1179.645) (-1183.039) -- 0:00:23 621500 -- (-1177.929) (-1178.031) (-1179.309) [-1179.042] * (-1181.194) (-1178.131) [-1182.405] (-1180.060) -- 0:00:23 622000 -- (-1180.274) (-1180.361) (-1178.231) [-1183.369] * (-1180.856) (-1180.467) (-1183.648) [-1178.246] -- 0:00:23 622500 -- (-1177.879) [-1178.918] (-1181.147) (-1179.123) * (-1182.528) [-1179.519] (-1178.816) (-1178.621) -- 0:00:23 623000 -- (-1178.588) [-1179.271] (-1179.903) (-1180.774) * (-1183.573) (-1178.893) [-1180.471] (-1182.192) -- 0:00:23 623500 -- (-1178.865) [-1185.860] (-1184.606) (-1183.357) * (-1177.517) [-1179.406] (-1184.637) (-1182.501) -- 0:00:23 624000 -- (-1179.130) (-1188.190) [-1181.774] (-1182.827) * [-1178.054] (-1178.240) (-1179.929) (-1178.788) -- 0:00:23 624500 -- (-1179.991) (-1179.141) [-1179.643] (-1181.878) * (-1179.636) (-1177.762) (-1177.787) [-1179.946] -- 0:00:23 625000 -- (-1177.254) (-1177.097) (-1179.783) [-1182.439] * [-1179.973] (-1177.451) (-1180.745) (-1179.756) -- 0:00:23 Average standard deviation of split frequencies: 0.011871 625500 -- (-1178.007) (-1178.357) [-1180.663] (-1180.123) * (-1178.394) (-1177.435) (-1178.714) [-1179.555] -- 0:00:23 626000 -- (-1180.756) (-1179.937) (-1182.050) [-1179.030] * (-1182.311) [-1180.408] (-1179.678) (-1180.836) -- 0:00:23 626500 -- (-1182.814) [-1179.936] (-1182.050) (-1183.747) * (-1180.429) (-1178.355) (-1179.676) [-1179.241] -- 0:00:23 627000 -- (-1185.060) (-1182.307) (-1177.615) [-1177.947] * [-1180.902] (-1179.691) (-1179.360) (-1181.344) -- 0:00:23 627500 -- [-1181.750] (-1181.518) (-1177.270) (-1178.371) * (-1178.273) [-1177.773] (-1179.370) (-1178.911) -- 0:00:23 628000 -- (-1179.713) (-1181.079) (-1178.365) [-1177.722] * [-1179.667] (-1180.328) (-1180.576) (-1178.621) -- 0:00:23 628500 -- (-1180.743) (-1178.913) (-1177.424) [-1177.722] * [-1177.755] (-1178.162) (-1179.388) (-1180.106) -- 0:00:23 629000 -- (-1179.799) (-1179.242) [-1177.054] (-1181.436) * [-1180.243] (-1178.860) (-1178.150) (-1179.837) -- 0:00:23 629500 -- (-1181.626) (-1181.084) (-1182.309) [-1178.923] * (-1179.283) [-1177.615] (-1177.870) (-1180.090) -- 0:00:22 630000 -- (-1182.018) [-1178.882] (-1178.869) (-1178.960) * (-1179.917) [-1178.713] (-1178.672) (-1181.933) -- 0:00:22 Average standard deviation of split frequencies: 0.011446 630500 -- [-1182.661] (-1180.613) (-1181.688) (-1182.979) * [-1177.908] (-1178.500) (-1182.172) (-1183.382) -- 0:00:22 631000 -- [-1178.950] (-1181.239) (-1179.298) (-1180.668) * (-1177.913) (-1180.423) [-1182.040] (-1178.471) -- 0:00:22 631500 -- (-1182.425) [-1178.209] (-1178.172) (-1180.645) * (-1178.455) (-1180.740) (-1180.710) [-1179.682] -- 0:00:22 632000 -- (-1181.129) (-1177.571) [-1178.235] (-1184.842) * [-1178.933] (-1178.275) (-1179.560) (-1179.748) -- 0:00:22 632500 -- (-1177.779) (-1177.936) (-1180.383) [-1178.614] * (-1179.155) (-1179.622) [-1183.733] (-1177.593) -- 0:00:22 633000 -- (-1178.786) (-1179.650) [-1185.932] (-1178.761) * (-1177.546) (-1177.863) [-1183.359] (-1179.735) -- 0:00:22 633500 -- (-1178.223) (-1179.023) [-1179.736] (-1180.965) * (-1178.321) (-1178.068) (-1178.448) [-1178.593] -- 0:00:22 634000 -- [-1180.401] (-1179.338) (-1179.201) (-1181.261) * (-1177.907) [-1178.764] (-1180.423) (-1179.577) -- 0:00:22 634500 -- [-1178.056] (-1177.972) (-1177.565) (-1177.236) * (-1177.928) (-1177.617) (-1184.524) [-1179.515] -- 0:00:23 635000 -- (-1179.508) [-1177.316] (-1177.266) (-1177.363) * (-1178.116) (-1179.194) (-1180.968) [-1177.628] -- 0:00:22 Average standard deviation of split frequencies: 0.011442 635500 -- (-1178.203) (-1177.019) (-1179.479) [-1177.221] * [-1177.981] (-1179.278) (-1177.820) (-1179.316) -- 0:00:22 636000 -- (-1180.389) [-1179.051] (-1179.990) (-1179.834) * [-1179.180] (-1178.047) (-1179.735) (-1178.722) -- 0:00:22 636500 -- (-1185.140) (-1177.853) [-1179.569] (-1177.968) * (-1177.788) (-1181.435) (-1180.175) [-1182.159] -- 0:00:22 637000 -- [-1185.960] (-1179.447) (-1178.341) (-1177.885) * [-1177.088] (-1178.474) (-1177.817) (-1184.635) -- 0:00:22 637500 -- [-1179.221] (-1177.316) (-1178.033) (-1182.784) * (-1177.182) (-1179.537) (-1179.478) [-1178.648] -- 0:00:22 638000 -- [-1178.887] (-1177.499) (-1178.845) (-1181.642) * [-1177.250] (-1179.301) (-1179.786) (-1180.568) -- 0:00:22 638500 -- (-1182.679) [-1179.396] (-1179.428) (-1179.352) * (-1177.304) (-1180.933) [-1180.499] (-1180.476) -- 0:00:22 639000 -- [-1180.470] (-1178.708) (-1178.157) (-1178.613) * (-1180.407) (-1181.883) [-1181.575] (-1178.741) -- 0:00:22 639500 -- (-1179.188) [-1178.465] (-1178.237) (-1179.590) * [-1178.277] (-1178.801) (-1180.736) (-1182.034) -- 0:00:22 640000 -- (-1179.242) [-1179.576] (-1180.640) (-1180.468) * [-1177.460] (-1182.708) (-1182.225) (-1178.064) -- 0:00:22 Average standard deviation of split frequencies: 0.011589 640500 -- (-1177.865) [-1180.396] (-1180.536) (-1178.792) * [-1177.994] (-1180.954) (-1184.395) (-1177.489) -- 0:00:22 641000 -- (-1179.022) (-1177.006) (-1178.338) [-1180.369] * (-1179.940) (-1178.968) [-1178.199] (-1180.121) -- 0:00:22 641500 -- (-1178.888) (-1182.595) (-1179.558) [-1178.818] * [-1178.400] (-1177.435) (-1179.037) (-1185.706) -- 0:00:22 642000 -- (-1178.057) (-1178.752) (-1180.579) [-1177.898] * (-1178.175) [-1179.738] (-1178.164) (-1180.099) -- 0:00:22 642500 -- (-1177.217) (-1180.158) [-1179.784] (-1178.829) * (-1177.930) (-1177.979) (-1178.290) [-1183.682] -- 0:00:22 643000 -- (-1179.104) (-1179.838) (-1179.181) [-1178.708] * (-1178.363) (-1177.875) (-1179.286) [-1178.406] -- 0:00:22 643500 -- [-1177.562] (-1178.770) (-1178.171) (-1180.598) * [-1180.973] (-1179.320) (-1179.875) (-1179.021) -- 0:00:22 644000 -- (-1178.456) (-1178.894) (-1178.071) [-1178.834] * (-1178.766) (-1179.073) (-1178.293) [-1181.206] -- 0:00:22 644500 -- (-1181.734) (-1179.053) [-1179.779] (-1178.291) * [-1184.363] (-1182.402) (-1178.995) (-1180.815) -- 0:00:22 645000 -- (-1184.753) [-1179.520] (-1179.410) (-1180.317) * (-1179.818) (-1184.648) (-1178.546) [-1183.031] -- 0:00:22 Average standard deviation of split frequencies: 0.012041 645500 -- (-1178.847) (-1179.377) [-1182.235] (-1182.562) * [-1177.768] (-1182.483) (-1179.310) (-1179.942) -- 0:00:21 646000 -- (-1177.662) [-1178.732] (-1182.235) (-1181.868) * (-1177.971) [-1177.796] (-1178.140) (-1183.013) -- 0:00:21 646500 -- [-1180.898] (-1179.252) (-1183.855) (-1180.136) * (-1178.512) [-1180.731] (-1179.936) (-1178.658) -- 0:00:21 647000 -- (-1178.242) (-1178.624) (-1187.086) [-1181.064] * [-1178.981] (-1180.122) (-1180.863) (-1179.856) -- 0:00:21 647500 -- (-1178.162) (-1180.177) [-1178.266] (-1180.809) * (-1177.121) (-1178.604) (-1178.413) [-1178.700] -- 0:00:21 648000 -- (-1177.608) [-1181.850] (-1178.407) (-1178.624) * [-1177.402] (-1179.074) (-1181.363) (-1178.858) -- 0:00:21 648500 -- (-1180.108) (-1183.199) [-1178.251] (-1177.598) * (-1180.658) [-1178.184] (-1181.311) (-1183.121) -- 0:00:21 649000 -- (-1181.236) (-1181.702) (-1178.671) [-1177.618] * [-1180.066] (-1181.157) (-1180.057) (-1183.252) -- 0:00:21 649500 -- [-1183.184] (-1180.226) (-1178.242) (-1178.346) * (-1183.271) [-1178.709] (-1178.435) (-1180.340) -- 0:00:21 650000 -- (-1177.954) (-1180.241) (-1178.374) [-1177.478] * (-1179.239) [-1177.821] (-1178.896) (-1178.670) -- 0:00:21 Average standard deviation of split frequencies: 0.011547 650500 -- (-1179.986) (-1177.572) [-1179.005] (-1177.951) * [-1181.341] (-1179.311) (-1179.952) (-1179.948) -- 0:00:21 651000 -- (-1177.773) (-1179.252) (-1179.507) [-1176.962] * [-1176.905] (-1178.037) (-1179.267) (-1178.917) -- 0:00:21 651500 -- (-1178.229) (-1183.486) [-1182.898] (-1182.180) * [-1177.018] (-1178.355) (-1179.589) (-1180.291) -- 0:00:21 652000 -- [-1178.505] (-1182.840) (-1181.570) (-1180.084) * [-1179.150] (-1177.228) (-1181.309) (-1179.282) -- 0:00:21 652500 -- (-1178.200) (-1178.193) [-1178.575] (-1177.703) * (-1180.567) (-1179.035) (-1177.522) [-1179.736] -- 0:00:21 653000 -- (-1177.838) (-1179.141) [-1180.199] (-1178.136) * (-1180.265) (-1177.617) (-1177.745) [-1178.557] -- 0:00:21 653500 -- (-1179.468) (-1181.286) [-1179.127] (-1177.353) * (-1179.040) (-1177.627) (-1177.615) [-1177.488] -- 0:00:21 654000 -- (-1181.511) (-1179.305) (-1181.727) [-1178.570] * (-1178.399) (-1182.771) [-1177.269] (-1178.168) -- 0:00:21 654500 -- (-1180.178) (-1180.758) (-1186.089) [-1178.474] * [-1178.252] (-1179.171) (-1178.198) (-1179.757) -- 0:00:21 655000 -- (-1178.192) (-1182.250) [-1181.635] (-1181.197) * [-1179.934] (-1177.507) (-1178.348) (-1180.655) -- 0:00:21 Average standard deviation of split frequencies: 0.011902 655500 -- (-1179.575) (-1179.407) (-1177.739) [-1181.715] * (-1177.728) (-1177.417) (-1178.000) [-1177.267] -- 0:00:21 656000 -- (-1179.346) (-1179.533) [-1181.103] (-1180.531) * (-1178.715) (-1177.572) (-1179.212) [-1177.851] -- 0:00:21 656500 -- [-1179.787] (-1184.352) (-1181.828) (-1181.415) * (-1177.943) (-1177.937) [-1178.568] (-1180.832) -- 0:00:21 657000 -- (-1180.682) (-1181.494) [-1180.858] (-1182.163) * (-1177.117) [-1180.142] (-1178.729) (-1179.851) -- 0:00:21 657500 -- (-1178.873) (-1177.821) [-1179.962] (-1183.806) * (-1179.665) (-1177.297) (-1179.887) [-1177.349] -- 0:00:21 658000 -- (-1183.055) (-1177.486) (-1184.180) [-1183.478] * (-1180.139) (-1180.237) (-1178.317) [-1177.539] -- 0:00:21 658500 -- [-1182.743] (-1180.704) (-1178.590) (-1180.906) * (-1177.970) [-1180.073] (-1178.332) (-1178.375) -- 0:00:21 659000 -- (-1179.239) (-1180.276) (-1178.590) [-1180.199] * (-1182.335) (-1179.514) [-1178.004] (-1182.460) -- 0:00:21 659500 -- (-1182.939) (-1179.238) [-1181.473] (-1183.067) * (-1183.982) [-1182.670] (-1180.990) (-1180.213) -- 0:00:21 660000 -- (-1180.538) (-1183.338) (-1178.730) [-1178.461] * (-1181.480) (-1181.248) (-1181.341) [-1181.212] -- 0:00:21 Average standard deviation of split frequencies: 0.011773 660500 -- (-1181.859) (-1180.660) (-1179.101) [-1178.520] * (-1177.130) (-1177.182) (-1179.601) [-1180.736] -- 0:00:21 661000 -- (-1181.613) (-1179.599) (-1178.537) [-1179.496] * (-1179.744) [-1177.889] (-1177.980) (-1182.618) -- 0:00:21 661500 -- [-1177.189] (-1178.939) (-1178.925) (-1179.820) * (-1184.648) [-1177.355] (-1178.180) (-1178.765) -- 0:00:20 662000 -- (-1178.294) (-1180.686) (-1179.016) [-1182.682] * (-1181.293) [-1177.437] (-1177.806) (-1180.224) -- 0:00:20 662500 -- (-1179.554) (-1181.406) [-1177.647] (-1177.348) * (-1179.815) (-1177.945) (-1177.374) [-1178.190] -- 0:00:20 663000 -- (-1177.843) [-1178.027] (-1177.664) (-1179.022) * (-1178.394) [-1180.219] (-1179.504) (-1179.518) -- 0:00:20 663500 -- [-1178.054] (-1181.005) (-1177.653) (-1177.701) * (-1178.360) [-1179.842] (-1177.288) (-1178.698) -- 0:00:20 664000 -- (-1178.114) [-1178.436] (-1182.016) (-1179.309) * (-1181.311) (-1178.927) [-1178.218] (-1180.284) -- 0:00:20 664500 -- (-1179.136) [-1178.293] (-1181.723) (-1179.091) * (-1179.336) [-1180.305] (-1177.863) (-1178.118) -- 0:00:20 665000 -- [-1177.942] (-1187.632) (-1177.960) (-1177.177) * [-1178.786] (-1178.199) (-1178.693) (-1179.046) -- 0:00:20 Average standard deviation of split frequencies: 0.012241 665500 -- (-1180.936) [-1180.482] (-1179.177) (-1177.421) * (-1179.391) [-1179.291] (-1179.428) (-1177.847) -- 0:00:20 666000 -- (-1179.662) (-1177.789) (-1178.652) [-1177.421] * (-1177.537) [-1177.917] (-1177.935) (-1180.033) -- 0:00:20 666500 -- (-1179.448) [-1178.425] (-1179.067) (-1180.789) * (-1180.501) [-1181.955] (-1178.169) (-1177.791) -- 0:00:20 667000 -- (-1183.123) [-1180.671] (-1181.761) (-1177.744) * (-1180.206) (-1186.066) [-1179.408] (-1178.675) -- 0:00:20 667500 -- (-1177.585) (-1180.234) (-1180.381) [-1177.503] * (-1180.696) [-1187.365] (-1177.957) (-1180.782) -- 0:00:20 668000 -- (-1178.242) [-1178.114] (-1178.593) (-1179.114) * (-1183.207) [-1178.420] (-1181.672) (-1179.082) -- 0:00:20 668500 -- (-1178.806) (-1180.300) [-1179.379] (-1178.795) * (-1185.444) [-1179.333] (-1180.651) (-1178.283) -- 0:00:20 669000 -- (-1179.021) (-1179.843) [-1179.618] (-1178.759) * [-1181.854] (-1178.006) (-1179.880) (-1179.507) -- 0:00:20 669500 -- [-1181.693] (-1178.249) (-1178.974) (-1182.521) * (-1177.579) [-1177.594] (-1180.660) (-1184.440) -- 0:00:20 670000 -- (-1178.514) [-1178.009] (-1177.440) (-1181.283) * (-1177.761) (-1178.188) (-1178.330) [-1178.930] -- 0:00:20 Average standard deviation of split frequencies: 0.011422 670500 -- (-1178.411) (-1179.582) (-1178.232) [-1178.020] * (-1180.827) [-1179.636] (-1176.962) (-1179.509) -- 0:00:20 671000 -- [-1177.693] (-1181.368) (-1180.417) (-1180.834) * (-1177.940) (-1178.849) (-1178.380) [-1179.434] -- 0:00:20 671500 -- (-1182.925) [-1177.864] (-1178.651) (-1180.474) * (-1179.729) (-1179.223) (-1179.473) [-1178.222] -- 0:00:20 672000 -- (-1177.582) [-1177.425] (-1179.200) (-1178.253) * (-1180.296) (-1177.456) [-1180.146] (-1180.050) -- 0:00:20 672500 -- [-1178.366] (-1180.005) (-1177.626) (-1182.376) * (-1178.958) [-1177.614] (-1178.319) (-1178.402) -- 0:00:20 673000 -- [-1178.965] (-1179.957) (-1179.489) (-1185.415) * [-1180.032] (-1178.390) (-1181.793) (-1178.869) -- 0:00:20 673500 -- (-1181.731) (-1180.801) [-1178.901] (-1184.576) * (-1179.402) (-1179.475) [-1181.440] (-1177.437) -- 0:00:20 674000 -- (-1184.891) [-1181.219] (-1178.535) (-1179.442) * (-1180.165) [-1177.407] (-1177.842) (-1179.317) -- 0:00:20 674500 -- (-1182.727) (-1177.671) [-1180.591] (-1178.289) * (-1178.911) (-1179.402) (-1180.169) [-1178.397] -- 0:00:20 675000 -- (-1185.906) [-1178.182] (-1183.369) (-1180.529) * [-1178.081] (-1181.040) (-1178.161) (-1177.744) -- 0:00:20 Average standard deviation of split frequencies: 0.011158 675500 -- (-1178.866) [-1177.022] (-1181.127) (-1179.855) * (-1179.210) (-1182.661) (-1178.591) [-1178.988] -- 0:00:20 676000 -- (-1177.047) [-1177.060] (-1181.137) (-1183.766) * (-1178.001) (-1182.393) (-1178.693) [-1177.918] -- 0:00:20 676500 -- (-1178.073) [-1177.643] (-1179.044) (-1180.069) * (-1177.267) (-1178.477) [-1177.596] (-1180.382) -- 0:00:20 677000 -- (-1179.095) [-1177.762] (-1177.194) (-1181.119) * (-1182.423) (-1179.819) [-1178.897] (-1182.548) -- 0:00:20 677500 -- (-1180.248) (-1178.373) (-1177.190) [-1179.193] * [-1179.246] (-1179.100) (-1177.981) (-1182.894) -- 0:00:19 678000 -- (-1179.043) (-1179.282) [-1178.873] (-1180.208) * (-1184.210) (-1182.801) (-1182.055) [-1181.022] -- 0:00:19 678500 -- (-1177.244) (-1181.227) [-1180.197] (-1178.244) * [-1178.380] (-1184.086) (-1185.878) (-1179.358) -- 0:00:19 679000 -- (-1179.180) [-1179.751] (-1183.122) (-1181.272) * (-1179.119) (-1181.933) (-1178.896) [-1180.120] -- 0:00:19 679500 -- (-1177.589) [-1181.158] (-1179.553) (-1184.873) * (-1179.034) (-1180.740) [-1177.894] (-1178.497) -- 0:00:19 680000 -- (-1179.958) [-1178.152] (-1179.069) (-1180.736) * (-1179.918) [-1177.414] (-1177.738) (-1178.498) -- 0:00:19 Average standard deviation of split frequencies: 0.011427 680500 -- [-1178.112] (-1178.230) (-1177.138) (-1177.938) * (-1177.132) (-1177.616) [-1178.435] (-1178.064) -- 0:00:19 681000 -- [-1178.054] (-1179.764) (-1178.377) (-1177.853) * (-1178.315) (-1177.436) (-1179.489) [-1178.254] -- 0:00:19 681500 -- (-1182.386) (-1184.583) [-1178.376] (-1179.000) * (-1182.909) [-1180.573] (-1178.505) (-1180.427) -- 0:00:19 682000 -- (-1179.276) [-1181.412] (-1177.679) (-1178.962) * (-1180.578) (-1179.288) [-1178.236] (-1180.465) -- 0:00:19 682500 -- (-1180.171) (-1178.956) (-1177.832) [-1182.770] * (-1177.440) [-1180.677] (-1180.265) (-1178.202) -- 0:00:19 683000 -- (-1178.308) (-1179.140) (-1177.606) [-1180.961] * [-1177.280] (-1179.450) (-1179.853) (-1178.742) -- 0:00:19 683500 -- (-1180.601) (-1182.516) (-1180.234) [-1184.640] * (-1179.672) (-1180.754) [-1179.201] (-1179.619) -- 0:00:19 684000 -- (-1180.365) [-1181.427] (-1180.007) (-1179.573) * (-1178.887) [-1177.656] (-1180.373) (-1182.413) -- 0:00:19 684500 -- (-1179.654) (-1178.632) [-1179.693] (-1185.469) * (-1179.744) (-1179.537) [-1180.074] (-1179.529) -- 0:00:19 685000 -- (-1179.667) (-1182.330) [-1179.316] (-1177.575) * (-1179.248) (-1178.950) (-1178.242) [-1178.012] -- 0:00:19 Average standard deviation of split frequencies: 0.011167 685500 -- (-1177.617) (-1180.932) [-1179.045] (-1178.178) * (-1179.525) (-1179.743) (-1178.693) [-1178.268] -- 0:00:19 686000 -- [-1179.549] (-1180.849) (-1184.264) (-1178.715) * [-1181.172] (-1180.039) (-1178.704) (-1178.608) -- 0:00:19 686500 -- (-1180.298) (-1181.306) [-1180.081] (-1180.625) * (-1178.666) [-1177.843] (-1177.370) (-1178.154) -- 0:00:19 687000 -- [-1178.546] (-1183.238) (-1177.817) (-1178.159) * (-1180.470) [-1177.534] (-1177.280) (-1179.610) -- 0:00:19 687500 -- (-1182.718) (-1180.818) (-1180.057) [-1177.711] * (-1182.699) [-1177.674] (-1177.527) (-1180.507) -- 0:00:19 688000 -- (-1180.003) (-1177.748) [-1180.408] (-1177.517) * [-1178.266] (-1181.691) (-1181.389) (-1178.955) -- 0:00:19 688500 -- (-1179.658) [-1177.644] (-1179.626) (-1177.768) * (-1180.170) (-1181.186) [-1179.265] (-1177.559) -- 0:00:19 689000 -- (-1179.205) (-1178.952) [-1179.205] (-1178.678) * [-1177.666] (-1179.611) (-1179.759) (-1177.758) -- 0:00:19 689500 -- (-1178.441) (-1180.075) [-1178.152] (-1180.838) * [-1178.526] (-1180.636) (-1178.269) (-1178.623) -- 0:00:19 690000 -- [-1178.327] (-1178.079) (-1180.785) (-1180.726) * (-1178.049) (-1180.608) (-1179.447) [-1179.846] -- 0:00:19 Average standard deviation of split frequencies: 0.011177 690500 -- (-1179.254) (-1178.150) [-1180.723] (-1179.419) * [-1177.868] (-1179.093) (-1179.501) (-1178.155) -- 0:00:19 691000 -- (-1180.640) (-1181.855) [-1182.023] (-1180.255) * (-1177.931) (-1178.330) [-1178.179] (-1181.178) -- 0:00:19 691500 -- [-1178.295] (-1179.347) (-1184.356) (-1178.795) * (-1180.052) (-1182.386) (-1178.612) [-1180.346] -- 0:00:19 692000 -- (-1180.253) (-1177.399) (-1184.226) [-1178.600] * [-1188.174] (-1177.446) (-1179.500) (-1180.593) -- 0:00:19 692500 -- [-1178.135] (-1178.540) (-1184.683) (-1177.952) * (-1184.295) (-1178.503) [-1177.721] (-1178.403) -- 0:00:19 693000 -- [-1180.782] (-1180.318) (-1185.384) (-1177.689) * (-1180.726) [-1178.172] (-1178.895) (-1178.048) -- 0:00:19 693500 -- [-1180.612] (-1181.782) (-1177.493) (-1178.116) * [-1180.460] (-1180.530) (-1178.676) (-1180.234) -- 0:00:19 694000 -- (-1185.327) [-1178.468] (-1179.848) (-1178.550) * (-1179.897) (-1178.929) (-1180.257) [-1178.575] -- 0:00:18 694500 -- [-1181.693] (-1179.758) (-1177.190) (-1177.054) * [-1179.914] (-1179.215) (-1185.326) (-1178.642) -- 0:00:18 695000 -- (-1182.294) (-1180.841) [-1177.509] (-1177.167) * (-1179.108) (-1178.594) (-1181.087) [-1179.951] -- 0:00:18 Average standard deviation of split frequencies: 0.011006 695500 -- (-1181.965) (-1179.810) [-1177.155] (-1179.346) * (-1180.447) [-1178.098] (-1177.789) (-1179.462) -- 0:00:18 696000 -- [-1181.904] (-1178.948) (-1177.148) (-1181.181) * [-1181.164] (-1179.284) (-1180.818) (-1181.241) -- 0:00:18 696500 -- [-1178.197] (-1179.142) (-1180.265) (-1178.467) * (-1179.928) (-1177.781) [-1178.776] (-1189.203) -- 0:00:18 697000 -- (-1179.206) (-1178.030) (-1178.047) [-1177.922] * (-1178.623) (-1177.787) (-1177.777) [-1178.501] -- 0:00:18 697500 -- [-1178.298] (-1178.012) (-1180.749) (-1178.592) * (-1179.531) (-1182.412) [-1177.756] (-1178.250) -- 0:00:18 698000 -- (-1179.249) [-1177.960] (-1179.033) (-1178.182) * (-1179.511) (-1178.621) (-1178.029) [-1177.878] -- 0:00:18 698500 -- (-1178.501) (-1177.558) (-1178.256) [-1177.341] * (-1177.355) (-1183.013) (-1180.278) [-1177.409] -- 0:00:18 699000 -- (-1177.845) (-1178.613) (-1177.957) [-1178.510] * (-1180.455) (-1179.094) [-1179.891] (-1180.823) -- 0:00:18 699500 -- (-1178.197) [-1179.765] (-1179.976) (-1181.220) * (-1179.785) [-1181.562] (-1183.616) (-1183.390) -- 0:00:18 700000 -- (-1177.988) [-1178.357] (-1179.531) (-1179.024) * [-1181.152] (-1179.134) (-1178.975) (-1178.502) -- 0:00:18 Average standard deviation of split frequencies: 0.011438 700500 -- (-1177.847) (-1179.494) (-1179.727) [-1180.263] * (-1179.194) [-1182.625] (-1177.641) (-1177.245) -- 0:00:18 701000 -- (-1178.006) (-1180.542) [-1177.790] (-1179.058) * [-1183.634] (-1178.682) (-1179.335) (-1177.381) -- 0:00:18 701500 -- (-1178.671) (-1181.058) [-1177.660] (-1178.784) * [-1180.595] (-1180.097) (-1178.702) (-1178.544) -- 0:00:18 702000 -- (-1179.529) (-1178.758) [-1177.262] (-1179.440) * (-1179.193) [-1181.427] (-1178.962) (-1180.106) -- 0:00:18 702500 -- [-1179.481] (-1178.739) (-1179.857) (-1178.052) * (-1178.994) (-1180.156) (-1180.862) [-1178.953] -- 0:00:18 703000 -- (-1180.642) (-1181.698) (-1178.233) [-1180.241] * [-1179.668] (-1181.426) (-1180.193) (-1180.655) -- 0:00:18 703500 -- (-1178.149) [-1177.916] (-1179.520) (-1178.686) * (-1177.856) (-1181.794) [-1178.966] (-1186.004) -- 0:00:18 704000 -- [-1181.390] (-1186.743) (-1177.896) (-1181.755) * (-1178.274) (-1182.121) (-1179.473) [-1180.247] -- 0:00:18 704500 -- (-1180.376) [-1179.214] (-1178.724) (-1178.242) * [-1179.497] (-1179.051) (-1180.225) (-1178.946) -- 0:00:18 705000 -- [-1178.123] (-1178.427) (-1177.803) (-1181.129) * (-1181.926) (-1180.129) (-1182.403) [-1179.768] -- 0:00:18 Average standard deviation of split frequencies: 0.012137 705500 -- (-1182.940) (-1177.569) (-1182.016) [-1180.104] * [-1182.715] (-1177.923) (-1181.119) (-1180.226) -- 0:00:18 706000 -- (-1179.539) (-1179.540) (-1177.258) [-1181.661] * (-1179.501) (-1178.574) (-1177.704) [-1180.036] -- 0:00:18 706500 -- (-1179.632) [-1180.388] (-1178.769) (-1180.469) * (-1182.654) [-1177.998] (-1185.506) (-1179.513) -- 0:00:18 707000 -- (-1180.392) [-1178.301] (-1178.022) (-1181.030) * (-1178.178) (-1180.462) [-1179.677] (-1179.964) -- 0:00:18 707500 -- (-1183.608) (-1177.764) (-1179.059) [-1177.956] * (-1180.408) (-1179.420) (-1180.114) [-1178.794] -- 0:00:18 708000 -- (-1183.249) (-1182.009) (-1179.621) [-1179.142] * (-1179.631) (-1178.289) (-1177.425) [-1177.363] -- 0:00:18 708500 -- (-1181.591) (-1181.277) [-1177.089] (-1177.099) * [-1180.839] (-1179.537) (-1182.136) (-1179.199) -- 0:00:18 709000 -- (-1181.356) (-1177.807) [-1177.258] (-1181.625) * (-1180.488) (-1179.649) (-1179.984) [-1177.577] -- 0:00:18 709500 -- (-1181.087) (-1178.679) (-1184.568) [-1177.871] * (-1179.980) (-1180.398) (-1180.426) [-1177.685] -- 0:00:18 710000 -- (-1181.752) [-1178.202] (-1178.407) (-1178.770) * [-1179.491] (-1177.999) (-1180.849) (-1181.929) -- 0:00:17 Average standard deviation of split frequencies: 0.012096 710500 -- (-1180.835) (-1178.377) [-1178.399] (-1185.771) * (-1179.276) [-1179.328] (-1178.508) (-1180.555) -- 0:00:17 711000 -- [-1178.774] (-1180.257) (-1179.167) (-1177.200) * (-1179.483) [-1180.485] (-1177.593) (-1178.785) -- 0:00:17 711500 -- [-1179.697] (-1178.728) (-1178.008) (-1177.159) * (-1181.031) (-1178.072) (-1178.202) [-1179.133] -- 0:00:17 712000 -- (-1181.125) (-1180.340) [-1177.849] (-1177.294) * [-1178.777] (-1178.660) (-1178.553) (-1179.602) -- 0:00:17 712500 -- [-1177.545] (-1181.761) (-1178.999) (-1181.038) * [-1179.702] (-1178.347) (-1178.577) (-1178.355) -- 0:00:17 713000 -- [-1178.032] (-1180.447) (-1183.876) (-1181.917) * (-1178.761) [-1179.818] (-1179.548) (-1180.353) -- 0:00:17 713500 -- [-1178.654] (-1180.709) (-1182.816) (-1178.039) * (-1179.425) (-1180.983) [-1177.639] (-1177.764) -- 0:00:17 714000 -- [-1177.339] (-1180.070) (-1182.127) (-1178.139) * [-1179.076] (-1179.564) (-1177.727) (-1179.145) -- 0:00:17 714500 -- (-1180.745) (-1178.096) (-1178.469) [-1179.183] * (-1177.964) (-1178.326) [-1178.301] (-1178.709) -- 0:00:17 715000 -- [-1177.946] (-1179.583) (-1177.028) (-1181.321) * [-1177.419] (-1177.945) (-1177.699) (-1179.556) -- 0:00:17 Average standard deviation of split frequencies: 0.012122 715500 -- (-1182.948) (-1179.184) [-1178.650] (-1186.914) * (-1180.859) (-1178.682) (-1177.880) [-1177.808] -- 0:00:17 716000 -- [-1178.885] (-1181.718) (-1180.498) (-1182.526) * [-1181.796] (-1179.818) (-1178.280) (-1179.931) -- 0:00:17 716500 -- (-1178.749) [-1182.951] (-1178.620) (-1180.915) * (-1178.586) (-1180.466) (-1178.657) [-1177.513] -- 0:00:17 717000 -- (-1182.674) (-1180.192) (-1178.631) [-1179.620] * [-1177.403] (-1179.633) (-1179.793) (-1178.700) -- 0:00:17 717500 -- (-1183.090) (-1177.895) [-1177.855] (-1179.350) * (-1180.166) (-1179.771) (-1178.756) [-1178.824] -- 0:00:17 718000 -- (-1180.623) (-1177.467) (-1180.894) [-1179.833] * (-1180.002) (-1183.390) (-1181.426) [-1180.659] -- 0:00:17 718500 -- [-1177.863] (-1178.172) (-1178.059) (-1179.253) * (-1178.597) (-1178.298) [-1181.310] (-1179.913) -- 0:00:17 719000 -- (-1179.693) (-1179.540) [-1177.297] (-1179.631) * (-1179.767) (-1177.438) [-1181.302] (-1178.206) -- 0:00:17 719500 -- (-1180.725) (-1178.905) (-1181.325) [-1181.103] * (-1179.685) [-1177.805] (-1180.016) (-1177.783) -- 0:00:17 720000 -- (-1181.388) (-1179.006) (-1179.696) [-1178.235] * (-1178.362) [-1177.820] (-1179.864) (-1178.549) -- 0:00:17 Average standard deviation of split frequencies: 0.011851 720500 -- (-1178.312) (-1179.810) [-1180.555] (-1181.108) * (-1181.146) [-1179.303] (-1181.033) (-1178.839) -- 0:00:17 721000 -- [-1177.702] (-1180.068) (-1178.804) (-1181.684) * (-1179.344) [-1178.783] (-1179.372) (-1180.233) -- 0:00:17 721500 -- (-1177.414) (-1178.872) [-1177.698] (-1178.882) * (-1178.305) (-1179.267) (-1182.776) [-1177.247] -- 0:00:17 722000 -- (-1180.949) (-1180.611) (-1180.573) [-1181.140] * [-1181.873] (-1179.557) (-1180.178) (-1179.951) -- 0:00:17 722500 -- (-1178.710) (-1182.575) (-1179.095) [-1179.512] * (-1177.386) (-1181.673) [-1177.779] (-1178.702) -- 0:00:17 723000 -- [-1180.016] (-1180.485) (-1178.509) (-1180.236) * [-1177.795] (-1181.394) (-1177.410) (-1180.966) -- 0:00:17 723500 -- (-1179.630) (-1180.945) [-1178.816] (-1178.808) * (-1180.017) (-1180.878) [-1177.549] (-1181.956) -- 0:00:17 724000 -- (-1179.061) (-1182.950) [-1178.417] (-1178.106) * (-1179.968) (-1180.869) (-1178.191) [-1180.073] -- 0:00:17 724500 -- (-1177.398) (-1183.774) [-1177.503] (-1177.812) * [-1180.117] (-1179.388) (-1177.673) (-1177.729) -- 0:00:17 725000 -- (-1177.643) (-1178.278) [-1180.080] (-1178.190) * (-1183.056) [-1178.637] (-1179.625) (-1177.916) -- 0:00:17 Average standard deviation of split frequencies: 0.011955 725500 -- (-1177.381) (-1179.368) [-1179.771] (-1178.559) * (-1178.708) (-1179.668) (-1180.519) [-1178.188] -- 0:00:17 726000 -- (-1178.234) (-1179.215) (-1181.231) [-1178.617] * (-1178.346) (-1178.256) [-1178.458] (-1179.159) -- 0:00:16 726500 -- (-1186.349) (-1181.774) (-1182.640) [-1183.678] * (-1180.675) (-1178.140) (-1180.470) [-1177.445] -- 0:00:16 727000 -- (-1182.840) [-1178.054] (-1185.438) (-1178.873) * (-1178.268) (-1180.212) (-1181.918) [-1180.728] -- 0:00:16 727500 -- (-1184.754) (-1179.786) (-1180.851) [-1180.415] * [-1179.504] (-1178.339) (-1182.732) (-1179.825) -- 0:00:16 728000 -- [-1177.776] (-1180.475) (-1178.752) (-1178.697) * [-1180.198] (-1178.814) (-1179.400) (-1183.108) -- 0:00:16 728500 -- (-1177.934) (-1181.065) (-1178.013) [-1178.474] * (-1180.458) (-1178.804) [-1179.950] (-1178.841) -- 0:00:16 729000 -- [-1178.047] (-1182.224) (-1178.184) (-1178.607) * [-1179.016] (-1180.852) (-1177.070) (-1180.504) -- 0:00:16 729500 -- (-1178.071) [-1180.092] (-1178.242) (-1179.859) * (-1177.418) [-1178.391] (-1181.724) (-1182.619) -- 0:00:16 730000 -- (-1178.294) (-1180.242) (-1177.305) [-1181.913] * (-1178.756) [-1178.391] (-1179.247) (-1180.759) -- 0:00:16 Average standard deviation of split frequencies: 0.011841 730500 -- [-1180.166] (-1180.012) (-1180.892) (-1177.741) * (-1178.673) (-1183.522) (-1178.483) [-1177.466] -- 0:00:16 731000 -- [-1179.114] (-1181.070) (-1180.654) (-1177.592) * (-1178.925) [-1179.529] (-1179.952) (-1180.475) -- 0:00:16 731500 -- (-1179.061) (-1179.394) (-1183.602) [-1177.327] * (-1183.058) (-1180.952) [-1180.699] (-1181.201) -- 0:00:16 732000 -- (-1178.848) [-1178.316] (-1181.928) (-1180.976) * (-1177.563) [-1178.876] (-1178.986) (-1179.742) -- 0:00:16 732500 -- (-1179.656) (-1177.777) [-1178.825] (-1178.266) * [-1179.632] (-1181.944) (-1178.987) (-1184.292) -- 0:00:16 733000 -- (-1177.204) (-1180.806) (-1178.461) [-1177.409] * [-1177.300] (-1179.712) (-1179.344) (-1180.161) -- 0:00:16 733500 -- [-1177.637] (-1179.977) (-1179.791) (-1179.559) * (-1179.255) [-1178.473] (-1178.465) (-1180.997) -- 0:00:16 734000 -- [-1179.688] (-1180.392) (-1177.468) (-1177.494) * [-1179.874] (-1177.364) (-1179.841) (-1180.535) -- 0:00:16 734500 -- (-1182.526) (-1180.329) [-1177.431] (-1178.396) * (-1178.938) (-1177.994) (-1179.779) [-1177.575] -- 0:00:16 735000 -- (-1184.354) (-1180.643) [-1177.731] (-1179.698) * [-1179.143] (-1179.685) (-1179.539) (-1178.584) -- 0:00:16 Average standard deviation of split frequencies: 0.011755 735500 -- (-1183.132) [-1177.668] (-1178.305) (-1180.702) * (-1177.104) (-1179.341) (-1181.298) [-1177.241] -- 0:00:16 736000 -- (-1179.041) [-1180.559] (-1178.207) (-1181.966) * (-1177.139) (-1179.840) (-1183.828) [-1178.082] -- 0:00:16 736500 -- (-1177.143) (-1179.196) [-1177.956] (-1178.075) * (-1179.908) [-1178.351] (-1178.807) (-1179.614) -- 0:00:16 737000 -- (-1180.453) (-1179.435) (-1181.649) [-1178.709] * (-1181.366) [-1178.051] (-1179.937) (-1178.804) -- 0:00:16 737500 -- [-1180.044] (-1180.580) (-1182.232) (-1179.619) * (-1179.447) (-1177.847) [-1180.946] (-1181.236) -- 0:00:16 738000 -- (-1179.653) [-1179.434] (-1181.893) (-1179.743) * (-1180.984) (-1176.938) (-1178.242) [-1181.523] -- 0:00:16 738500 -- (-1179.677) [-1177.596] (-1182.982) (-1177.382) * [-1177.937] (-1178.058) (-1180.473) (-1182.655) -- 0:00:16 739000 -- (-1178.197) (-1177.770) [-1181.551] (-1177.760) * (-1182.107) (-1177.672) [-1178.939] (-1180.567) -- 0:00:16 739500 -- (-1182.883) (-1180.862) [-1182.229] (-1178.027) * (-1177.431) [-1177.280] (-1180.154) (-1180.260) -- 0:00:16 740000 -- (-1182.052) (-1178.330) (-1178.303) [-1177.790] * [-1180.257] (-1177.293) (-1178.447) (-1180.673) -- 0:00:16 Average standard deviation of split frequencies: 0.011906 740500 -- (-1179.965) [-1178.708] (-1178.324) (-1180.898) * (-1188.019) (-1178.148) (-1179.403) [-1179.444] -- 0:00:16 741000 -- (-1179.679) (-1181.686) [-1180.166] (-1178.654) * (-1179.270) (-1179.441) [-1180.146] (-1181.027) -- 0:00:16 741500 -- (-1181.122) (-1179.668) (-1179.846) [-1177.790] * (-1179.232) (-1178.297) (-1179.411) [-1179.264] -- 0:00:16 742000 -- [-1179.277] (-1183.745) (-1178.056) (-1178.853) * (-1179.150) (-1178.411) (-1180.541) [-1180.096] -- 0:00:15 742500 -- (-1178.746) (-1181.468) (-1178.802) [-1179.937] * (-1181.804) (-1178.770) [-1179.264] (-1179.630) -- 0:00:15 743000 -- (-1178.791) (-1179.397) (-1178.707) [-1177.737] * (-1182.843) [-1177.763] (-1178.926) (-1179.897) -- 0:00:15 743500 -- (-1180.240) (-1179.408) [-1177.401] (-1178.574) * [-1177.862] (-1185.126) (-1180.468) (-1179.891) -- 0:00:15 744000 -- (-1182.740) (-1180.383) (-1177.939) [-1181.573] * (-1178.900) (-1179.039) [-1177.748] (-1178.262) -- 0:00:15 744500 -- (-1183.085) (-1180.340) [-1178.106] (-1182.798) * [-1179.371] (-1179.462) (-1180.704) (-1180.792) -- 0:00:15 745000 -- (-1179.830) (-1177.675) [-1179.149] (-1180.722) * (-1179.714) (-1179.484) (-1180.315) [-1178.714] -- 0:00:15 Average standard deviation of split frequencies: 0.012192 745500 -- [-1178.228] (-1178.258) (-1179.543) (-1181.775) * [-1178.669] (-1178.873) (-1181.149) (-1181.191) -- 0:00:15 746000 -- [-1177.970] (-1177.535) (-1181.869) (-1179.449) * [-1178.639] (-1178.688) (-1182.394) (-1189.642) -- 0:00:15 746500 -- (-1179.946) [-1178.213] (-1178.652) (-1179.429) * [-1177.977] (-1180.477) (-1186.145) (-1184.226) -- 0:00:15 747000 -- (-1179.560) [-1177.185] (-1177.891) (-1184.201) * [-1179.214] (-1181.767) (-1182.258) (-1180.612) -- 0:00:15 747500 -- (-1180.146) (-1178.424) (-1179.973) [-1183.007] * (-1181.514) (-1181.565) [-1178.554] (-1182.230) -- 0:00:15 748000 -- (-1178.734) (-1178.135) [-1177.211] (-1179.861) * (-1179.216) (-1180.353) [-1179.336] (-1179.919) -- 0:00:15 748500 -- (-1177.120) (-1178.300) [-1181.644] (-1179.025) * [-1181.340] (-1179.061) (-1180.838) (-1181.733) -- 0:00:15 749000 -- [-1177.744] (-1179.846) (-1180.520) (-1177.779) * (-1177.498) (-1178.771) (-1182.221) [-1177.992] -- 0:00:15 749500 -- [-1179.744] (-1178.984) (-1177.340) (-1177.430) * (-1184.331) [-1178.722] (-1178.747) (-1179.120) -- 0:00:15 750000 -- (-1178.836) (-1177.880) (-1180.093) [-1178.478] * [-1181.845] (-1177.752) (-1181.305) (-1179.315) -- 0:00:15 Average standard deviation of split frequencies: 0.012449 750500 -- (-1180.369) [-1177.407] (-1179.438) (-1179.639) * (-1180.459) (-1179.743) (-1180.180) [-1177.821] -- 0:00:15 751000 -- (-1178.939) (-1177.564) [-1178.818] (-1178.286) * [-1178.959] (-1182.062) (-1179.397) (-1179.998) -- 0:00:15 751500 -- (-1182.553) (-1181.526) (-1179.122) [-1177.809] * (-1182.414) (-1181.938) [-1179.050] (-1182.966) -- 0:00:15 752000 -- (-1183.861) (-1180.025) (-1179.557) [-1178.122] * (-1177.549) [-1181.699] (-1180.269) (-1178.797) -- 0:00:15 752500 -- [-1181.353] (-1178.590) (-1179.751) (-1177.389) * (-1179.658) (-1179.019) (-1177.825) [-1179.481] -- 0:00:15 753000 -- (-1177.806) (-1183.939) [-1182.056] (-1177.462) * (-1179.743) (-1178.425) (-1177.369) [-1178.139] -- 0:00:15 753500 -- (-1178.359) (-1177.222) (-1187.797) [-1177.459] * [-1178.475] (-1182.452) (-1177.438) (-1179.075) -- 0:00:15 754000 -- (-1178.611) [-1179.998] (-1181.162) (-1177.755) * (-1180.112) [-1181.724] (-1177.742) (-1180.242) -- 0:00:15 754500 -- (-1179.202) [-1179.913] (-1181.479) (-1178.983) * [-1180.500] (-1179.826) (-1178.316) (-1180.051) -- 0:00:15 755000 -- [-1178.363] (-1178.780) (-1182.487) (-1179.280) * (-1179.331) (-1179.797) (-1181.124) [-1177.343] -- 0:00:15 Average standard deviation of split frequencies: 0.012544 755500 -- (-1178.224) [-1178.715] (-1181.334) (-1185.440) * (-1180.933) [-1179.481] (-1180.726) (-1177.779) -- 0:00:15 756000 -- (-1178.094) (-1177.915) (-1178.930) [-1179.399] * (-1179.841) (-1178.037) (-1180.981) [-1181.045] -- 0:00:15 756500 -- (-1182.576) (-1177.597) [-1180.487] (-1181.197) * (-1179.709) (-1177.132) (-1177.849) [-1178.113] -- 0:00:15 757000 -- (-1186.368) [-1179.298] (-1180.340) (-1178.278) * (-1178.306) (-1178.455) (-1179.062) [-1180.449] -- 0:00:15 757500 -- (-1180.716) (-1179.682) (-1179.165) [-1177.628] * (-1179.802) (-1178.954) [-1180.635] (-1178.437) -- 0:00:15 758000 -- (-1180.286) (-1178.291) [-1178.573] (-1179.026) * (-1178.991) (-1178.921) [-1180.565] (-1177.551) -- 0:00:15 758500 -- (-1182.670) (-1180.005) [-1179.575] (-1180.089) * (-1178.144) (-1179.116) [-1178.593] (-1181.954) -- 0:00:14 759000 -- (-1181.939) [-1180.674] (-1177.996) (-1179.974) * (-1179.864) (-1180.290) (-1179.749) [-1179.362] -- 0:00:14 759500 -- (-1179.070) [-1179.558] (-1180.180) (-1180.634) * (-1179.014) (-1180.778) (-1178.718) [-1177.633] -- 0:00:14 760000 -- (-1179.363) (-1180.949) [-1179.221] (-1182.680) * (-1179.958) [-1180.312] (-1181.552) (-1182.097) -- 0:00:14 Average standard deviation of split frequencies: 0.012176 760500 -- (-1179.888) [-1177.720] (-1178.905) (-1180.905) * (-1177.813) (-1182.111) (-1179.681) [-1180.934] -- 0:00:14 761000 -- (-1179.451) [-1187.705] (-1177.894) (-1186.650) * [-1178.277] (-1179.419) (-1179.480) (-1177.996) -- 0:00:14 761500 -- (-1179.603) (-1179.030) [-1181.298] (-1178.700) * (-1181.395) (-1178.717) (-1179.426) [-1178.657] -- 0:00:14 762000 -- (-1178.391) (-1177.289) (-1179.514) [-1178.168] * (-1179.272) (-1177.707) [-1178.806] (-1180.143) -- 0:00:14 762500 -- (-1178.733) (-1177.813) (-1179.307) [-1177.747] * (-1180.110) [-1179.941] (-1178.214) (-1184.176) -- 0:00:14 763000 -- (-1180.308) [-1178.236] (-1179.568) (-1182.701) * (-1178.893) (-1178.095) [-1180.428] (-1183.868) -- 0:00:14 763500 -- (-1178.386) [-1178.801] (-1178.168) (-1178.277) * (-1177.613) (-1179.924) [-1181.605] (-1189.671) -- 0:00:14 764000 -- (-1179.624) (-1179.592) [-1176.961] (-1178.239) * (-1178.539) (-1180.353) (-1181.265) [-1177.886] -- 0:00:14 764500 -- (-1179.224) [-1179.133] (-1178.441) (-1182.137) * (-1178.266) [-1180.084] (-1177.730) (-1179.309) -- 0:00:14 765000 -- (-1178.853) [-1178.349] (-1178.983) (-1180.021) * [-1178.252] (-1179.721) (-1177.979) (-1178.760) -- 0:00:14 Average standard deviation of split frequencies: 0.012091 765500 -- [-1178.252] (-1181.053) (-1180.342) (-1179.943) * (-1178.053) [-1178.817] (-1178.790) (-1179.822) -- 0:00:14 766000 -- [-1178.865] (-1181.133) (-1178.422) (-1178.457) * [-1179.187] (-1179.045) (-1179.586) (-1180.755) -- 0:00:14 766500 -- [-1179.827] (-1186.813) (-1177.083) (-1179.891) * (-1178.775) [-1181.374] (-1179.182) (-1182.817) -- 0:00:14 767000 -- (-1180.512) (-1193.040) [-1186.412] (-1180.326) * (-1183.017) [-1178.683] (-1181.821) (-1178.540) -- 0:00:14 767500 -- (-1180.263) (-1180.134) (-1177.668) [-1177.660] * (-1179.298) [-1180.891] (-1179.471) (-1182.949) -- 0:00:14 768000 -- (-1180.115) (-1179.410) [-1181.434] (-1181.191) * [-1179.890] (-1177.987) (-1179.056) (-1180.875) -- 0:00:14 768500 -- (-1180.017) (-1178.962) [-1177.809] (-1178.649) * (-1180.495) (-1181.884) (-1178.373) [-1179.691] -- 0:00:14 769000 -- (-1177.912) (-1178.336) (-1178.906) [-1178.412] * (-1181.557) [-1178.820] (-1180.434) (-1180.204) -- 0:00:14 769500 -- (-1179.031) [-1178.957] (-1177.985) (-1179.834) * (-1183.173) (-1180.069) (-1182.505) [-1179.091] -- 0:00:14 770000 -- (-1178.693) (-1177.525) (-1181.295) [-1179.638] * [-1178.016] (-1179.500) (-1183.205) (-1179.622) -- 0:00:14 Average standard deviation of split frequencies: 0.011622 770500 -- (-1177.669) (-1178.292) [-1179.647] (-1177.630) * [-1178.494] (-1178.497) (-1181.337) (-1179.245) -- 0:00:14 771000 -- (-1177.776) (-1177.981) [-1178.630] (-1180.982) * (-1179.369) (-1183.074) (-1178.776) [-1178.597] -- 0:00:14 771500 -- (-1177.408) [-1177.804] (-1177.624) (-1180.875) * (-1179.822) (-1178.577) (-1179.082) [-1177.244] -- 0:00:14 772000 -- (-1178.091) [-1178.380] (-1179.143) (-1178.987) * (-1177.979) [-1177.570] (-1178.484) (-1180.979) -- 0:00:14 772500 -- (-1182.265) (-1177.595) (-1178.545) [-1177.722] * [-1178.401] (-1177.886) (-1179.969) (-1179.184) -- 0:00:14 773000 -- (-1177.412) [-1177.587] (-1178.721) (-1178.089) * [-1179.859] (-1182.488) (-1180.198) (-1179.361) -- 0:00:14 773500 -- (-1179.050) [-1177.585] (-1177.030) (-1180.011) * (-1180.372) (-1186.997) (-1181.425) [-1182.660] -- 0:00:14 774000 -- [-1178.803] (-1182.539) (-1178.435) (-1179.647) * (-1179.273) (-1180.944) (-1179.300) [-1182.206] -- 0:00:14 774500 -- (-1179.161) (-1177.736) (-1181.457) [-1180.611] * (-1178.215) (-1178.483) [-1178.513] (-1178.418) -- 0:00:13 775000 -- (-1179.562) [-1178.614] (-1182.092) (-1184.178) * [-1178.365] (-1178.077) (-1178.588) (-1178.151) -- 0:00:13 Average standard deviation of split frequencies: 0.011792 775500 -- (-1183.260) (-1177.521) [-1179.090] (-1180.473) * (-1179.513) (-1178.973) (-1181.740) [-1179.625] -- 0:00:13 776000 -- (-1179.577) [-1178.274] (-1181.042) (-1179.269) * (-1179.256) (-1178.416) (-1179.220) [-1179.002] -- 0:00:13 776500 -- (-1181.134) [-1178.936] (-1184.435) (-1178.641) * (-1177.563) (-1183.116) [-1178.473] (-1179.033) -- 0:00:13 777000 -- (-1179.091) (-1177.926) (-1181.679) [-1178.442] * (-1177.430) (-1183.468) (-1180.293) [-1179.484] -- 0:00:13 777500 -- (-1177.762) (-1178.088) [-1180.910] (-1178.787) * (-1179.155) (-1180.226) [-1182.240] (-1179.177) -- 0:00:13 778000 -- (-1179.709) (-1179.155) (-1181.343) [-1178.633] * [-1177.393] (-1181.985) (-1180.031) (-1177.481) -- 0:00:13 778500 -- (-1178.435) [-1180.897] (-1179.319) (-1177.924) * (-1178.116) (-1180.458) (-1179.711) [-1177.621] -- 0:00:13 779000 -- [-1179.252] (-1183.110) (-1182.445) (-1178.225) * (-1178.594) (-1178.250) (-1179.593) [-1178.349] -- 0:00:13 779500 -- [-1180.398] (-1177.687) (-1181.467) (-1178.662) * (-1181.662) [-1178.126] (-1179.785) (-1183.147) -- 0:00:13 780000 -- [-1177.978] (-1177.558) (-1179.113) (-1177.427) * (-1181.537) (-1178.185) (-1178.450) [-1179.165] -- 0:00:13 Average standard deviation of split frequencies: 0.011722 780500 -- (-1179.782) (-1177.655) (-1177.752) [-1177.459] * (-1182.350) (-1178.345) (-1178.715) [-1178.428] -- 0:00:13 781000 -- (-1178.356) [-1178.113] (-1178.370) (-1177.016) * [-1181.715] (-1179.918) (-1177.788) (-1180.221) -- 0:00:13 781500 -- (-1182.225) [-1178.492] (-1180.223) (-1177.333) * (-1182.385) (-1178.006) (-1178.640) [-1185.938] -- 0:00:13 782000 -- (-1178.687) [-1179.359] (-1179.424) (-1177.385) * [-1181.229] (-1177.971) (-1178.157) (-1180.137) -- 0:00:13 782500 -- (-1179.924) (-1177.453) [-1183.995] (-1177.350) * (-1181.245) (-1179.842) [-1178.338] (-1179.020) -- 0:00:13 783000 -- (-1180.091) (-1178.672) (-1180.372) [-1178.461] * (-1181.747) [-1187.177] (-1177.133) (-1179.828) -- 0:00:13 783500 -- (-1186.646) (-1179.647) (-1179.936) [-1178.797] * (-1179.100) (-1178.944) [-1178.167] (-1179.927) -- 0:00:13 784000 -- (-1183.792) [-1177.480] (-1181.668) (-1177.950) * [-1178.677] (-1179.754) (-1185.401) (-1180.487) -- 0:00:13 784500 -- (-1179.592) (-1179.417) [-1178.695] (-1179.483) * (-1178.652) (-1183.442) (-1181.840) [-1179.276] -- 0:00:13 785000 -- [-1180.676] (-1181.664) (-1179.569) (-1182.246) * (-1177.643) (-1178.066) [-1180.027] (-1179.283) -- 0:00:13 Average standard deviation of split frequencies: 0.011325 785500 -- [-1177.688] (-1179.239) (-1177.453) (-1181.425) * [-1178.034] (-1178.995) (-1178.564) (-1182.869) -- 0:00:13 786000 -- [-1178.555] (-1178.512) (-1179.066) (-1181.615) * (-1177.828) (-1181.323) [-1178.792] (-1180.890) -- 0:00:13 786500 -- (-1178.977) (-1180.929) [-1177.819] (-1179.368) * (-1178.998) (-1178.951) (-1181.158) [-1178.960] -- 0:00:13 787000 -- (-1179.929) (-1177.774) (-1183.703) [-1179.533] * (-1179.760) (-1179.797) [-1180.542] (-1182.001) -- 0:00:13 787500 -- (-1180.940) (-1177.753) [-1178.708] (-1178.576) * (-1180.693) (-1178.753) (-1178.189) [-1180.977] -- 0:00:13 788000 -- (-1181.276) (-1178.416) (-1178.310) [-1179.209] * (-1180.883) [-1177.609] (-1177.506) (-1180.702) -- 0:00:13 788500 -- (-1180.810) [-1179.074] (-1181.419) (-1179.743) * (-1179.272) (-1179.357) (-1178.124) [-1178.359] -- 0:00:13 789000 -- (-1181.267) [-1179.323] (-1177.872) (-1179.939) * (-1187.390) (-1179.321) [-1178.851] (-1179.009) -- 0:00:13 789500 -- [-1179.747] (-1179.208) (-1179.293) (-1183.254) * (-1178.550) (-1177.006) (-1177.008) [-1181.007] -- 0:00:13 790000 -- (-1180.921) (-1178.133) (-1179.460) [-1186.955] * (-1177.993) (-1182.071) (-1178.480) [-1179.389] -- 0:00:13 Average standard deviation of split frequencies: 0.011574 790500 -- (-1181.139) (-1177.885) [-1178.264] (-1181.212) * (-1178.017) (-1184.359) [-1178.499] (-1180.122) -- 0:00:12 791000 -- (-1179.625) [-1178.854] (-1179.427) (-1179.863) * (-1179.301) (-1179.464) (-1178.803) [-1177.825] -- 0:00:12 791500 -- [-1179.978] (-1179.821) (-1178.642) (-1178.213) * (-1181.046) (-1177.906) (-1180.354) [-1180.020] -- 0:00:12 792000 -- [-1179.265] (-1178.299) (-1181.336) (-1177.124) * (-1180.902) (-1177.531) [-1178.426] (-1181.702) -- 0:00:12 792500 -- (-1178.388) (-1180.388) (-1183.847) [-1177.978] * [-1178.330] (-1177.647) (-1186.976) (-1180.496) -- 0:00:12 793000 -- (-1181.002) [-1185.751] (-1177.975) (-1177.510) * (-1184.402) (-1178.031) (-1186.836) [-1177.645] -- 0:00:12 793500 -- (-1179.268) (-1179.939) (-1183.256) [-1179.229] * (-1179.336) (-1177.774) (-1181.521) [-1177.773] -- 0:00:12 794000 -- (-1177.695) (-1177.791) (-1180.151) [-1179.571] * [-1182.818] (-1179.571) (-1181.143) (-1179.323) -- 0:00:12 794500 -- [-1180.694] (-1177.991) (-1179.702) (-1179.202) * (-1181.376) (-1178.372) [-1178.747] (-1179.764) -- 0:00:12 795000 -- (-1179.620) [-1179.621] (-1182.807) (-1177.837) * [-1178.361] (-1181.630) (-1178.622) (-1179.708) -- 0:00:12 Average standard deviation of split frequencies: 0.011474 795500 -- (-1185.889) (-1180.657) (-1179.433) [-1176.891] * [-1180.105] (-1179.567) (-1178.994) (-1179.652) -- 0:00:12 796000 -- (-1180.920) (-1179.818) [-1178.933] (-1177.936) * (-1181.150) [-1180.114] (-1178.521) (-1179.671) -- 0:00:12 796500 -- [-1180.200] (-1180.973) (-1179.093) (-1179.795) * [-1179.346] (-1182.484) (-1180.964) (-1178.816) -- 0:00:12 797000 -- (-1178.059) (-1180.146) [-1178.539] (-1181.791) * (-1180.541) (-1179.073) (-1183.744) [-1181.534] -- 0:00:12 797500 -- [-1178.186] (-1179.711) (-1179.134) (-1181.384) * (-1180.489) (-1178.114) [-1179.377] (-1181.609) -- 0:00:12 798000 -- (-1178.288) (-1179.425) [-1180.114] (-1181.344) * [-1178.619] (-1178.471) (-1183.400) (-1178.920) -- 0:00:12 798500 -- (-1178.386) (-1184.377) [-1178.052] (-1178.883) * (-1178.030) [-1177.164] (-1179.214) (-1179.539) -- 0:00:12 799000 -- [-1177.842] (-1180.612) (-1182.032) (-1180.927) * [-1181.499] (-1177.343) (-1177.176) (-1178.182) -- 0:00:12 799500 -- (-1180.821) (-1178.003) (-1178.088) [-1177.262] * [-1178.163] (-1179.477) (-1179.869) (-1177.862) -- 0:00:12 800000 -- (-1177.284) (-1179.608) (-1181.202) [-1179.915] * (-1179.543) (-1178.328) (-1180.125) [-1181.565] -- 0:00:12 Average standard deviation of split frequencies: 0.011812 800500 -- (-1178.385) [-1178.470] (-1178.404) (-1179.815) * (-1177.623) (-1178.264) (-1178.048) [-1177.679] -- 0:00:12 801000 -- [-1178.522] (-1183.416) (-1177.407) (-1178.014) * [-1180.030] (-1179.880) (-1179.380) (-1177.820) -- 0:00:12 801500 -- (-1179.976) (-1180.402) (-1177.580) [-1180.771] * (-1177.859) (-1177.526) [-1178.139] (-1180.049) -- 0:00:12 802000 -- (-1178.315) (-1178.385) (-1180.259) [-1179.556] * [-1179.488] (-1180.060) (-1184.406) (-1179.926) -- 0:00:12 802500 -- [-1179.902] (-1178.931) (-1179.515) (-1179.881) * (-1179.602) (-1177.401) (-1178.466) [-1182.902] -- 0:00:12 803000 -- [-1177.986] (-1179.641) (-1180.885) (-1178.534) * [-1179.002] (-1178.595) (-1178.968) (-1178.571) -- 0:00:12 803500 -- (-1178.621) (-1178.622) (-1180.958) [-1178.676] * (-1179.406) [-1178.472] (-1178.615) (-1179.296) -- 0:00:12 804000 -- (-1180.376) (-1178.745) (-1178.005) [-1179.089] * (-1178.043) (-1181.223) (-1179.322) [-1179.202] -- 0:00:12 804500 -- (-1178.083) [-1179.905] (-1178.835) (-1178.687) * [-1177.721] (-1181.368) (-1177.692) (-1180.208) -- 0:00:12 805000 -- [-1179.643] (-1177.648) (-1177.935) (-1178.913) * [-1178.919] (-1179.634) (-1178.821) (-1179.901) -- 0:00:12 Average standard deviation of split frequencies: 0.012076 805500 -- (-1181.663) [-1180.681] (-1180.706) (-1177.629) * [-1178.654] (-1178.740) (-1181.656) (-1180.424) -- 0:00:12 806000 -- [-1178.281] (-1178.894) (-1179.992) (-1179.607) * (-1183.552) (-1179.929) (-1180.378) [-1177.307] -- 0:00:12 806500 -- (-1178.529) (-1179.624) (-1178.132) [-1179.441] * (-1179.614) [-1181.165] (-1180.212) (-1185.571) -- 0:00:11 807000 -- (-1180.732) (-1178.063) (-1178.010) [-1178.774] * (-1178.683) (-1179.113) (-1178.140) [-1179.189] -- 0:00:11 807500 -- [-1178.301] (-1181.065) (-1177.712) (-1178.647) * (-1178.138) (-1182.122) (-1179.732) [-1178.938] -- 0:00:11 808000 -- [-1180.266] (-1182.401) (-1177.849) (-1178.949) * (-1179.016) [-1178.205] (-1178.483) (-1181.679) -- 0:00:11 808500 -- (-1180.388) (-1178.607) (-1178.119) [-1179.138] * (-1177.643) (-1179.126) [-1179.598] (-1181.380) -- 0:00:11 809000 -- [-1179.968] (-1178.960) (-1180.295) (-1180.137) * (-1179.618) [-1179.719] (-1178.443) (-1180.840) -- 0:00:11 809500 -- (-1178.605) (-1178.231) (-1180.049) [-1179.066] * (-1178.260) (-1179.603) [-1178.581] (-1183.727) -- 0:00:11 810000 -- (-1181.233) (-1179.270) [-1180.005] (-1178.561) * (-1178.214) (-1179.399) [-1178.142] (-1177.664) -- 0:00:11 Average standard deviation of split frequencies: 0.012041 810500 -- (-1183.160) [-1180.397] (-1179.706) (-1178.818) * (-1179.161) (-1178.469) [-1177.795] (-1178.300) -- 0:00:11 811000 -- [-1181.636] (-1177.433) (-1181.146) (-1179.119) * (-1178.192) [-1182.308] (-1179.439) (-1177.821) -- 0:00:11 811500 -- (-1180.917) [-1177.911] (-1177.992) (-1180.279) * (-1181.989) [-1178.062] (-1178.882) (-1178.181) -- 0:00:11 812000 -- [-1179.575] (-1181.794) (-1179.705) (-1178.859) * (-1178.784) (-1181.002) [-1178.391] (-1179.803) -- 0:00:11 812500 -- [-1180.508] (-1181.808) (-1178.404) (-1184.303) * (-1179.967) (-1179.164) [-1177.942] (-1178.784) -- 0:00:11 813000 -- (-1179.746) [-1182.331] (-1180.516) (-1180.839) * [-1177.593] (-1183.918) (-1177.173) (-1179.152) -- 0:00:11 813500 -- [-1178.264] (-1181.466) (-1177.796) (-1179.437) * (-1182.397) (-1178.413) (-1181.204) [-1178.765] -- 0:00:11 814000 -- (-1178.755) (-1178.561) (-1179.585) [-1182.039] * [-1179.324] (-1178.416) (-1181.438) (-1178.190) -- 0:00:11 814500 -- [-1179.454] (-1178.899) (-1178.171) (-1177.660) * (-1178.747) [-1179.991] (-1177.142) (-1179.245) -- 0:00:11 815000 -- [-1179.362] (-1177.980) (-1180.444) (-1179.261) * (-1178.197) [-1182.566] (-1177.775) (-1182.304) -- 0:00:11 Average standard deviation of split frequencies: 0.012098 815500 -- (-1180.788) (-1177.856) (-1188.065) [-1180.767] * (-1181.658) (-1179.940) (-1177.510) [-1180.319] -- 0:00:11 816000 -- (-1180.002) [-1177.838] (-1179.509) (-1180.390) * [-1179.653] (-1179.129) (-1178.913) (-1181.126) -- 0:00:11 816500 -- (-1178.180) (-1179.152) (-1181.204) [-1179.387] * [-1181.482] (-1179.062) (-1178.013) (-1178.197) -- 0:00:11 817000 -- (-1178.767) (-1180.823) [-1183.160] (-1180.332) * (-1192.596) (-1178.947) (-1178.757) [-1180.143] -- 0:00:11 817500 -- [-1179.699] (-1180.552) (-1180.981) (-1181.702) * (-1180.814) (-1177.244) (-1180.968) [-1179.243] -- 0:00:11 818000 -- (-1181.034) [-1182.220] (-1181.546) (-1182.277) * [-1178.565] (-1178.169) (-1185.765) (-1178.558) -- 0:00:11 818500 -- [-1178.139] (-1181.134) (-1181.633) (-1180.642) * (-1183.327) [-1178.031] (-1187.150) (-1178.599) -- 0:00:11 819000 -- (-1178.333) (-1181.670) (-1177.994) [-1179.445] * (-1181.020) (-1178.595) [-1179.714] (-1179.869) -- 0:00:11 819500 -- (-1176.998) [-1184.102] (-1178.087) (-1179.186) * (-1178.541) [-1183.180] (-1179.841) (-1179.075) -- 0:00:11 820000 -- [-1177.046] (-1178.723) (-1178.512) (-1179.088) * (-1178.679) [-1180.866] (-1178.733) (-1180.636) -- 0:00:11 Average standard deviation of split frequencies: 0.012232 820500 -- (-1178.867) (-1180.016) (-1180.378) [-1180.159] * (-1177.731) (-1179.395) [-1181.592] (-1178.587) -- 0:00:11 821000 -- [-1178.775] (-1179.115) (-1179.436) (-1180.410) * (-1179.494) [-1180.076] (-1179.064) (-1178.993) -- 0:00:11 821500 -- (-1178.009) (-1183.292) [-1178.262] (-1178.710) * (-1179.857) [-1177.594] (-1177.292) (-1181.213) -- 0:00:11 822000 -- (-1177.568) (-1184.287) (-1180.667) [-1180.218] * (-1179.745) [-1179.782] (-1179.337) (-1177.735) -- 0:00:11 822500 -- (-1177.677) (-1183.413) (-1179.196) [-1179.187] * [-1181.195] (-1179.554) (-1181.028) (-1178.920) -- 0:00:11 823000 -- [-1181.052] (-1179.585) (-1182.650) (-1178.116) * (-1181.358) (-1179.751) (-1179.077) [-1177.118] -- 0:00:10 823500 -- (-1179.353) (-1178.166) (-1178.179) [-1180.123] * (-1179.818) (-1178.727) [-1179.311] (-1177.677) -- 0:00:10 824000 -- (-1177.662) (-1177.919) (-1180.511) [-1178.446] * (-1181.079) (-1178.260) [-1178.879] (-1178.338) -- 0:00:10 824500 -- [-1177.681] (-1180.292) (-1179.969) (-1181.386) * (-1178.081) [-1178.161] (-1183.134) (-1180.097) -- 0:00:10 825000 -- [-1179.320] (-1177.497) (-1179.022) (-1180.067) * [-1179.008] (-1177.982) (-1182.849) (-1178.089) -- 0:00:10 Average standard deviation of split frequencies: 0.012220 825500 -- (-1179.587) (-1178.943) (-1180.143) [-1177.266] * (-1179.784) (-1177.986) (-1183.055) [-1180.325] -- 0:00:10 826000 -- (-1184.593) [-1181.446] (-1177.237) (-1178.100) * (-1178.585) [-1181.558] (-1182.038) (-1182.810) -- 0:00:10 826500 -- (-1184.211) [-1189.855] (-1177.553) (-1178.646) * (-1180.759) (-1182.346) [-1181.788] (-1184.211) -- 0:00:10 827000 -- (-1180.629) (-1179.603) (-1178.504) [-1177.569] * (-1181.201) (-1181.157) [-1178.289] (-1179.892) -- 0:00:10 827500 -- [-1180.912] (-1182.553) (-1182.036) (-1178.298) * (-1178.545) (-1178.508) [-1180.303] (-1179.637) -- 0:00:10 828000 -- (-1178.708) (-1178.478) [-1181.607] (-1178.928) * (-1177.724) (-1179.815) (-1186.027) [-1179.267] -- 0:00:10 828500 -- (-1178.568) (-1178.745) [-1177.125] (-1179.126) * [-1180.026] (-1178.657) (-1179.358) (-1178.203) -- 0:00:10 829000 -- (-1178.912) (-1177.741) (-1178.449) [-1180.357] * [-1181.146] (-1179.596) (-1183.690) (-1177.184) -- 0:00:10 829500 -- [-1177.532] (-1182.338) (-1180.687) (-1180.844) * [-1179.049] (-1184.148) (-1180.591) (-1176.995) -- 0:00:10 830000 -- (-1179.679) (-1179.635) (-1181.485) [-1184.653] * (-1179.968) [-1181.976] (-1183.751) (-1177.513) -- 0:00:10 Average standard deviation of split frequencies: 0.012318 830500 -- [-1178.779] (-1182.686) (-1180.250) (-1182.386) * [-1177.577] (-1179.365) (-1179.840) (-1177.583) -- 0:00:10 831000 -- (-1179.475) (-1179.825) (-1180.374) [-1178.617] * (-1177.523) (-1185.029) [-1181.602] (-1179.075) -- 0:00:10 831500 -- (-1182.525) [-1179.921] (-1177.803) (-1179.398) * (-1179.569) (-1179.371) [-1179.437] (-1176.960) -- 0:00:10 832000 -- (-1181.167) (-1178.125) [-1179.226] (-1181.141) * (-1178.371) (-1182.232) (-1177.521) [-1177.632] -- 0:00:10 832500 -- (-1187.075) [-1180.139] (-1179.822) (-1182.312) * (-1177.736) (-1179.352) [-1178.593] (-1179.207) -- 0:00:10 833000 -- [-1181.823] (-1185.605) (-1179.492) (-1181.003) * (-1178.746) (-1181.970) (-1177.261) [-1178.698] -- 0:00:10 833500 -- [-1183.290] (-1179.082) (-1179.445) (-1181.134) * [-1178.481] (-1178.186) (-1182.641) (-1181.499) -- 0:00:10 834000 -- [-1178.967] (-1180.785) (-1181.268) (-1178.784) * (-1179.759) (-1183.106) (-1179.171) [-1178.582] -- 0:00:10 834500 -- [-1179.798] (-1178.003) (-1180.213) (-1181.273) * (-1178.910) (-1177.285) [-1185.072] (-1179.955) -- 0:00:10 835000 -- (-1178.114) (-1182.259) (-1180.655) [-1180.400] * [-1180.230] (-1177.285) (-1181.156) (-1179.548) -- 0:00:10 Average standard deviation of split frequencies: 0.012107 835500 -- [-1178.084] (-1182.369) (-1178.875) (-1178.567) * (-1178.356) [-1177.578] (-1179.048) (-1179.383) -- 0:00:10 836000 -- (-1178.249) (-1180.864) [-1178.137] (-1178.651) * (-1178.173) (-1179.907) (-1178.679) [-1178.154] -- 0:00:10 836500 -- (-1179.184) (-1178.543) [-1178.721] (-1179.021) * (-1179.110) (-1179.680) [-1177.979] (-1179.176) -- 0:00:10 837000 -- (-1178.597) [-1180.301] (-1180.930) (-1179.998) * (-1180.401) (-1179.086) (-1179.024) [-1178.435] -- 0:00:10 837500 -- (-1177.230) [-1178.303] (-1181.588) (-1177.290) * [-1180.330] (-1177.155) (-1179.688) (-1178.123) -- 0:00:10 838000 -- (-1179.170) [-1178.708] (-1180.887) (-1178.140) * (-1180.584) (-1178.203) [-1180.681] (-1183.908) -- 0:00:10 838500 -- (-1180.298) (-1181.204) (-1178.352) [-1179.176] * (-1180.834) [-1178.680] (-1179.699) (-1180.472) -- 0:00:10 839000 -- [-1179.690] (-1179.526) (-1178.327) (-1180.250) * (-1180.757) (-1179.732) [-1181.838] (-1181.712) -- 0:00:09 839500 -- (-1181.730) [-1180.159] (-1182.188) (-1183.483) * (-1179.384) (-1177.400) (-1182.945) [-1177.700] -- 0:00:09 840000 -- (-1179.182) [-1179.564] (-1178.232) (-1179.409) * [-1177.770] (-1178.653) (-1178.618) (-1177.840) -- 0:00:09 Average standard deviation of split frequencies: 0.011530 840500 -- [-1178.047] (-1179.700) (-1181.673) (-1177.805) * (-1180.115) (-1178.782) [-1178.124] (-1177.483) -- 0:00:09 841000 -- (-1179.313) (-1180.684) [-1179.118] (-1178.670) * (-1178.543) [-1180.609] (-1181.069) (-1181.899) -- 0:00:09 841500 -- (-1179.856) (-1181.784) [-1178.077] (-1182.113) * (-1178.610) [-1181.498] (-1180.154) (-1179.599) -- 0:00:09 842000 -- (-1180.856) [-1179.439] (-1179.330) (-1176.903) * (-1177.778) (-1180.024) [-1179.847] (-1179.316) -- 0:00:09 842500 -- (-1179.690) (-1179.598) (-1178.115) [-1180.216] * [-1178.142] (-1180.189) (-1178.431) (-1180.381) -- 0:00:09 843000 -- [-1178.351] (-1179.350) (-1177.796) (-1181.024) * [-1182.263] (-1178.522) (-1178.210) (-1178.290) -- 0:00:09 843500 -- (-1178.163) (-1179.289) (-1181.824) [-1180.091] * (-1178.019) (-1182.370) (-1177.730) [-1178.061] -- 0:00:09 844000 -- (-1178.185) (-1179.293) [-1180.274] (-1180.310) * [-1180.457] (-1181.141) (-1178.360) (-1177.670) -- 0:00:09 844500 -- (-1178.987) [-1178.400] (-1178.070) (-1178.924) * (-1177.819) [-1182.716] (-1177.422) (-1181.441) -- 0:00:09 845000 -- (-1180.073) (-1179.411) [-1180.772] (-1178.988) * (-1178.523) (-1180.746) [-1177.322] (-1180.593) -- 0:00:09 Average standard deviation of split frequencies: 0.011980 845500 -- [-1177.668] (-1182.222) (-1180.247) (-1179.709) * (-1178.830) (-1177.152) [-1178.218] (-1181.597) -- 0:00:09 846000 -- [-1177.574] (-1180.232) (-1182.547) (-1180.086) * (-1178.790) (-1178.864) [-1178.886] (-1186.189) -- 0:00:09 846500 -- (-1179.128) (-1183.820) (-1179.046) [-1179.993] * [-1177.837] (-1178.319) (-1177.898) (-1185.293) -- 0:00:09 847000 -- (-1180.688) (-1178.280) [-1180.279] (-1182.016) * (-1177.826) (-1179.457) [-1179.362] (-1180.950) -- 0:00:09 847500 -- [-1179.451] (-1180.182) (-1178.679) (-1178.562) * (-1177.912) [-1177.425] (-1181.538) (-1181.060) -- 0:00:09 848000 -- [-1180.123] (-1178.630) (-1181.868) (-1183.759) * (-1181.420) (-1180.831) (-1180.148) [-1177.738] -- 0:00:09 848500 -- (-1178.897) (-1180.141) (-1181.830) [-1180.292] * (-1177.790) (-1178.235) [-1177.602] (-1179.573) -- 0:00:09 849000 -- [-1179.987] (-1181.359) (-1179.951) (-1180.421) * (-1182.981) (-1178.329) (-1179.164) [-1178.799] -- 0:00:09 849500 -- (-1178.980) (-1181.348) [-1178.040] (-1181.363) * (-1180.286) (-1177.558) [-1178.491] (-1179.411) -- 0:00:09 850000 -- (-1178.122) (-1178.032) [-1178.489] (-1179.279) * [-1181.225] (-1179.613) (-1179.464) (-1179.838) -- 0:00:09 Average standard deviation of split frequencies: 0.012330 850500 -- (-1178.212) [-1177.556] (-1178.440) (-1180.227) * (-1182.828) (-1178.650) [-1177.434] (-1180.896) -- 0:00:09 851000 -- [-1179.134] (-1179.235) (-1178.585) (-1179.123) * [-1181.827] (-1178.144) (-1181.409) (-1179.985) -- 0:00:09 851500 -- (-1178.136) (-1182.293) (-1177.837) [-1177.948] * (-1183.226) [-1178.232] (-1181.299) (-1184.151) -- 0:00:09 852000 -- [-1179.495] (-1180.158) (-1177.124) (-1180.559) * (-1183.610) (-1179.249) [-1178.037] (-1179.805) -- 0:00:09 852500 -- (-1178.633) (-1182.581) (-1177.439) [-1177.428] * (-1179.036) [-1178.601] (-1180.579) (-1180.731) -- 0:00:09 853000 -- (-1179.012) (-1178.594) [-1177.940] (-1180.017) * (-1178.834) (-1180.070) [-1179.330] (-1179.205) -- 0:00:09 853500 -- (-1178.183) (-1178.406) [-1180.374] (-1184.081) * [-1178.227] (-1178.017) (-1181.636) (-1179.340) -- 0:00:09 854000 -- (-1179.716) (-1181.052) [-1178.555] (-1181.549) * (-1179.885) (-1178.713) (-1179.285) [-1181.075] -- 0:00:09 854500 -- [-1178.548] (-1182.928) (-1180.061) (-1179.744) * [-1183.966] (-1179.349) (-1181.076) (-1180.006) -- 0:00:09 855000 -- (-1183.468) [-1178.504] (-1179.889) (-1178.105) * [-1177.259] (-1180.035) (-1178.554) (-1182.197) -- 0:00:08 Average standard deviation of split frequencies: 0.012494 855500 -- (-1177.663) (-1179.810) [-1177.834] (-1180.252) * (-1178.799) (-1177.691) (-1179.380) [-1178.048] -- 0:00:08 856000 -- (-1177.990) (-1179.040) (-1180.895) [-1178.808] * (-1179.585) [-1177.733] (-1177.315) (-1178.557) -- 0:00:08 856500 -- [-1179.003] (-1180.491) (-1181.574) (-1178.098) * (-1179.582) [-1178.589] (-1181.445) (-1179.561) -- 0:00:08 857000 -- [-1180.804] (-1182.585) (-1180.833) (-1177.340) * (-1179.291) [-1180.991] (-1180.221) (-1179.069) -- 0:00:08 857500 -- [-1180.867] (-1181.485) (-1179.582) (-1180.758) * (-1180.306) (-1177.843) [-1179.792] (-1182.713) -- 0:00:08 858000 -- (-1179.131) (-1179.464) (-1180.772) [-1180.878] * (-1181.135) (-1178.967) (-1181.126) [-1178.600] -- 0:00:08 858500 -- (-1177.853) (-1179.860) [-1177.401] (-1178.892) * (-1178.477) (-1183.919) (-1177.796) [-1178.051] -- 0:00:08 859000 -- (-1179.198) [-1177.403] (-1177.684) (-1183.912) * (-1180.580) [-1182.788] (-1178.616) (-1179.300) -- 0:00:08 859500 -- (-1181.727) (-1178.214) (-1182.191) [-1179.985] * (-1177.973) (-1182.217) (-1178.166) [-1179.859] -- 0:00:08 860000 -- (-1179.367) (-1177.983) [-1179.206] (-1179.667) * (-1178.219) (-1179.953) [-1180.150] (-1178.572) -- 0:00:08 Average standard deviation of split frequencies: 0.012632 860500 -- (-1179.594) (-1178.429) (-1178.863) [-1178.571] * (-1179.529) (-1181.830) (-1179.045) [-1177.592] -- 0:00:08 861000 -- [-1179.679] (-1178.450) (-1180.154) (-1178.799) * (-1180.424) (-1179.796) (-1179.120) [-1177.592] -- 0:00:08 861500 -- (-1179.135) (-1177.361) [-1182.176] (-1179.477) * (-1179.909) (-1180.618) [-1177.188] (-1180.302) -- 0:00:08 862000 -- (-1180.060) (-1180.897) (-1179.586) [-1179.781] * (-1180.124) (-1178.167) (-1180.334) [-1179.548] -- 0:00:08 862500 -- (-1179.429) (-1179.440) [-1179.493] (-1180.606) * (-1182.159) [-1177.652] (-1182.557) (-1178.264) -- 0:00:08 863000 -- (-1180.170) (-1179.449) (-1179.997) [-1179.099] * (-1182.967) (-1180.949) (-1178.899) [-1178.557] -- 0:00:08 863500 -- (-1178.659) [-1177.835] (-1179.590) (-1178.725) * (-1183.932) [-1180.019] (-1178.859) (-1184.779) -- 0:00:08 864000 -- (-1178.784) (-1181.681) (-1180.739) [-1180.398] * (-1183.426) [-1177.951] (-1177.897) (-1182.354) -- 0:00:08 864500 -- (-1179.824) (-1177.673) [-1181.172] (-1178.925) * (-1180.080) (-1178.114) [-1180.704] (-1177.969) -- 0:00:08 865000 -- (-1183.597) (-1179.995) (-1179.002) [-1178.071] * (-1179.024) (-1181.874) [-1180.505] (-1178.529) -- 0:00:08 Average standard deviation of split frequencies: 0.012656 865500 -- (-1179.351) (-1180.767) (-1179.947) [-1178.396] * (-1178.812) [-1184.284] (-1180.024) (-1177.267) -- 0:00:08 866000 -- (-1180.827) [-1179.274] (-1178.540) (-1177.638) * (-1178.063) (-1177.220) (-1180.520) [-1180.691] -- 0:00:08 866500 -- (-1178.425) (-1179.528) (-1178.055) [-1181.331] * [-1179.240] (-1177.240) (-1179.339) (-1179.279) -- 0:00:08 867000 -- [-1178.987] (-1177.987) (-1181.271) (-1181.936) * [-1181.025] (-1180.589) (-1180.856) (-1178.419) -- 0:00:08 867500 -- (-1178.863) (-1177.647) [-1179.134] (-1180.028) * (-1178.148) [-1179.779] (-1178.122) (-1177.906) -- 0:00:08 868000 -- (-1178.283) [-1181.230] (-1179.430) (-1180.740) * (-1178.629) (-1181.152) (-1179.187) [-1180.386] -- 0:00:08 868500 -- (-1178.775) (-1178.201) (-1183.189) [-1178.946] * [-1177.637] (-1180.704) (-1181.306) (-1178.198) -- 0:00:08 869000 -- (-1178.285) (-1181.604) (-1179.791) [-1177.654] * (-1182.016) [-1182.751] (-1178.040) (-1179.033) -- 0:00:08 869500 -- (-1178.996) (-1182.232) [-1178.879] (-1181.178) * (-1181.741) (-1180.853) (-1181.171) [-1177.685] -- 0:00:08 870000 -- (-1182.368) [-1179.648] (-1177.901) (-1180.521) * (-1180.687) (-1179.403) [-1177.417] (-1177.747) -- 0:00:08 Average standard deviation of split frequencies: 0.012622 870500 -- [-1184.749] (-1179.125) (-1179.673) (-1177.126) * (-1179.546) (-1179.479) [-1178.526] (-1178.456) -- 0:00:08 871000 -- (-1184.519) (-1177.270) [-1182.732] (-1182.125) * (-1179.794) (-1178.132) (-1180.902) [-1180.283] -- 0:00:07 871500 -- (-1178.250) (-1177.280) [-1177.315] (-1180.135) * (-1184.898) (-1179.480) (-1177.961) [-1178.186] -- 0:00:07 872000 -- (-1178.923) (-1181.802) [-1179.135] (-1179.790) * (-1183.162) [-1178.344] (-1177.597) (-1182.941) -- 0:00:07 872500 -- (-1180.640) [-1182.608] (-1182.631) (-1178.304) * (-1181.179) (-1181.097) [-1178.078] (-1181.089) -- 0:00:07 873000 -- (-1182.431) (-1180.156) [-1177.840] (-1178.687) * (-1177.149) [-1178.750] (-1178.823) (-1179.449) -- 0:00:07 873500 -- (-1179.691) (-1180.041) [-1177.436] (-1178.405) * (-1177.262) (-1178.394) (-1178.650) [-1181.391] -- 0:00:07 874000 -- (-1178.985) [-1179.482] (-1178.132) (-1179.301) * [-1179.409] (-1179.386) (-1177.800) (-1177.710) -- 0:00:07 874500 -- (-1180.661) [-1178.122] (-1179.498) (-1179.162) * (-1178.115) (-1177.866) (-1178.013) [-1178.257] -- 0:00:07 875000 -- (-1180.772) (-1179.321) [-1179.652] (-1177.852) * (-1180.401) (-1182.588) [-1178.401] (-1178.487) -- 0:00:07 Average standard deviation of split frequencies: 0.012747 875500 -- (-1181.187) (-1181.034) (-1179.967) [-1180.280] * (-1179.102) [-1182.353] (-1179.322) (-1179.465) -- 0:00:07 876000 -- [-1178.096] (-1184.723) (-1183.912) (-1179.189) * (-1178.568) (-1182.231) [-1178.642] (-1178.705) -- 0:00:07 876500 -- [-1178.660] (-1179.684) (-1180.518) (-1182.126) * (-1180.643) [-1181.376] (-1177.834) (-1181.851) -- 0:00:07 877000 -- (-1179.720) (-1179.869) (-1179.639) [-1177.176] * (-1182.405) (-1179.972) (-1180.780) [-1181.231] -- 0:00:07 877500 -- (-1180.072) (-1177.292) (-1177.639) [-1177.159] * (-1180.303) [-1180.419] (-1179.518) (-1177.218) -- 0:00:07 878000 -- (-1178.173) (-1177.867) [-1177.582] (-1178.508) * (-1179.057) [-1179.566] (-1178.066) (-1178.221) -- 0:00:07 878500 -- (-1177.559) [-1178.081] (-1177.988) (-1178.204) * (-1180.537) [-1178.784] (-1181.718) (-1181.685) -- 0:00:07 879000 -- (-1178.203) (-1178.769) (-1177.479) [-1177.814] * (-1178.195) (-1179.235) [-1180.848] (-1178.922) -- 0:00:07 879500 -- (-1180.093) (-1179.823) [-1180.362] (-1178.580) * [-1178.223] (-1178.166) (-1182.441) (-1177.643) -- 0:00:07 880000 -- [-1177.709] (-1179.822) (-1177.782) (-1180.305) * (-1178.584) [-1178.631] (-1178.491) (-1177.263) -- 0:00:07 Average standard deviation of split frequencies: 0.012579 880500 -- [-1177.848] (-1179.049) (-1182.435) (-1180.385) * (-1179.649) [-1180.866] (-1180.365) (-1178.269) -- 0:00:07 881000 -- (-1177.849) [-1179.551] (-1179.263) (-1180.332) * (-1179.673) (-1178.945) [-1178.815] (-1179.758) -- 0:00:07 881500 -- (-1179.841) (-1179.400) (-1178.947) [-1179.559] * (-1183.463) [-1182.480] (-1180.554) (-1178.732) -- 0:00:07 882000 -- (-1181.081) [-1180.013] (-1181.127) (-1178.859) * (-1184.043) [-1179.687] (-1180.863) (-1179.005) -- 0:00:07 882500 -- (-1177.550) (-1179.365) [-1181.467] (-1179.666) * (-1180.784) (-1181.067) [-1180.933] (-1181.324) -- 0:00:07 883000 -- [-1178.817] (-1181.168) (-1179.539) (-1180.393) * (-1177.614) (-1177.952) (-1183.725) [-1179.730] -- 0:00:07 883500 -- (-1177.505) (-1180.043) (-1180.254) [-1178.631] * (-1177.256) (-1181.364) [-1179.283] (-1177.313) -- 0:00:07 884000 -- [-1178.399] (-1179.639) (-1181.970) (-1181.259) * [-1179.648] (-1179.420) (-1178.517) (-1180.212) -- 0:00:07 884500 -- [-1179.547] (-1181.820) (-1183.034) (-1177.241) * [-1183.536] (-1182.595) (-1184.908) (-1180.214) -- 0:00:07 885000 -- (-1188.816) [-1178.072] (-1178.204) (-1182.488) * (-1186.170) [-1179.068] (-1182.369) (-1177.513) -- 0:00:07 Average standard deviation of split frequencies: 0.012736 885500 -- [-1178.586] (-1180.008) (-1178.970) (-1180.618) * (-1179.222) (-1180.352) (-1177.526) [-1177.386] -- 0:00:07 886000 -- [-1177.851] (-1181.455) (-1178.294) (-1185.163) * [-1179.216] (-1181.444) (-1180.747) (-1179.962) -- 0:00:07 886500 -- [-1179.225] (-1177.409) (-1178.613) (-1182.787) * (-1178.280) [-1181.242] (-1183.368) (-1177.397) -- 0:00:07 887000 -- (-1180.006) (-1178.687) [-1180.086] (-1179.128) * (-1179.867) [-1178.732] (-1177.801) (-1179.587) -- 0:00:07 887500 -- [-1182.125] (-1177.671) (-1178.053) (-1179.531) * [-1177.519] (-1179.775) (-1178.548) (-1180.852) -- 0:00:06 888000 -- [-1180.722] (-1181.944) (-1178.751) (-1181.870) * [-1177.804] (-1178.392) (-1181.089) (-1176.968) -- 0:00:06 888500 -- [-1178.403] (-1180.726) (-1178.951) (-1179.590) * (-1181.122) [-1178.247] (-1178.990) (-1179.523) -- 0:00:06 889000 -- (-1177.595) (-1179.002) (-1179.224) [-1180.085] * (-1182.719) (-1180.624) [-1178.953] (-1177.688) -- 0:00:06 889500 -- (-1177.403) [-1180.144] (-1178.387) (-1180.382) * (-1186.708) (-1183.889) (-1178.994) [-1179.137] -- 0:00:06 890000 -- (-1177.921) (-1178.566) [-1178.108] (-1177.694) * (-1181.557) [-1178.584] (-1177.814) (-1177.831) -- 0:00:06 Average standard deviation of split frequencies: 0.012603 890500 -- (-1180.947) (-1179.522) (-1182.350) [-1178.490] * (-1180.036) (-1177.711) [-1177.158] (-1181.214) -- 0:00:06 891000 -- (-1179.204) (-1177.376) (-1178.110) [-1178.849] * (-1177.588) [-1177.655] (-1178.290) (-1179.124) -- 0:00:06 891500 -- (-1177.944) [-1178.755] (-1179.472) (-1181.991) * (-1177.164) (-1180.751) (-1181.002) [-1177.827] -- 0:00:06 892000 -- [-1178.054] (-1177.704) (-1181.844) (-1178.659) * (-1181.504) (-1180.402) (-1181.633) [-1178.257] -- 0:00:06 892500 -- (-1177.728) (-1178.195) (-1179.123) [-1177.169] * (-1181.523) (-1181.938) [-1178.302] (-1178.648) -- 0:00:06 893000 -- (-1181.266) [-1178.472] (-1185.868) (-1179.138) * (-1178.404) (-1177.624) [-1182.816] (-1177.762) -- 0:00:06 893500 -- [-1178.340] (-1177.871) (-1177.996) (-1181.184) * (-1177.567) (-1177.929) [-1178.552] (-1176.971) -- 0:00:06 894000 -- [-1178.603] (-1177.789) (-1179.179) (-1181.085) * [-1178.672] (-1178.088) (-1181.280) (-1179.752) -- 0:00:06 894500 -- [-1179.388] (-1177.360) (-1179.669) (-1177.939) * (-1178.673) (-1179.209) [-1177.348] (-1180.449) -- 0:00:06 895000 -- (-1178.103) (-1177.949) (-1185.251) [-1177.824] * (-1179.246) [-1177.188] (-1179.120) (-1181.128) -- 0:00:06 Average standard deviation of split frequencies: 0.012035 895500 -- (-1178.011) [-1178.715] (-1179.305) (-1177.995) * (-1178.533) (-1180.319) (-1177.126) [-1179.778] -- 0:00:06 896000 -- [-1178.318] (-1177.499) (-1177.506) (-1179.042) * [-1179.711] (-1178.569) (-1178.197) (-1179.234) -- 0:00:06 896500 -- (-1180.548) (-1178.623) [-1177.962] (-1179.771) * (-1180.148) [-1179.062] (-1177.902) (-1180.721) -- 0:00:06 897000 -- [-1177.697] (-1180.979) (-1180.462) (-1178.176) * (-1182.702) [-1180.731] (-1178.580) (-1180.212) -- 0:00:06 897500 -- (-1183.425) (-1183.049) (-1181.250) [-1178.726] * [-1178.023] (-1178.841) (-1178.727) (-1183.937) -- 0:00:06 898000 -- [-1180.584] (-1182.662) (-1181.426) (-1179.868) * (-1181.369) (-1178.951) (-1179.328) [-1179.769] -- 0:00:06 898500 -- (-1177.730) [-1178.475] (-1178.081) (-1179.296) * (-1182.216) (-1178.481) [-1177.838] (-1178.702) -- 0:00:06 899000 -- (-1180.668) [-1178.686] (-1178.076) (-1178.184) * (-1180.647) (-1180.423) (-1178.269) [-1178.285] -- 0:00:06 899500 -- (-1178.575) [-1178.175] (-1179.062) (-1179.332) * (-1178.520) [-1181.336] (-1178.066) (-1178.884) -- 0:00:06 900000 -- (-1179.561) (-1178.623) (-1181.804) [-1180.215] * [-1178.509] (-1178.349) (-1180.374) (-1177.852) -- 0:00:06 Average standard deviation of split frequencies: 0.012267 900500 -- [-1178.704] (-1177.366) (-1182.503) (-1184.040) * (-1177.809) [-1178.073] (-1180.885) (-1178.417) -- 0:00:06 901000 -- (-1181.765) (-1177.575) [-1182.957] (-1181.212) * (-1178.223) [-1178.928] (-1178.846) (-1177.777) -- 0:00:06 901500 -- (-1178.696) (-1180.285) [-1187.495] (-1178.647) * (-1179.152) (-1180.687) (-1178.131) [-1177.802] -- 0:00:06 902000 -- (-1182.470) (-1180.380) [-1180.613] (-1178.952) * [-1181.432] (-1180.270) (-1177.260) (-1179.304) -- 0:00:06 902500 -- (-1181.859) (-1179.694) [-1179.221] (-1177.288) * (-1178.509) (-1180.824) (-1178.793) [-1178.017] -- 0:00:06 903000 -- [-1177.551] (-1178.886) (-1178.511) (-1179.571) * [-1179.685] (-1180.017) (-1178.081) (-1178.239) -- 0:00:06 903500 -- (-1177.576) (-1178.743) (-1178.376) [-1179.788] * (-1180.013) (-1179.161) [-1178.458] (-1180.202) -- 0:00:05 904000 -- (-1182.192) [-1182.395] (-1178.810) (-1177.734) * (-1178.402) (-1179.090) [-1179.411] (-1179.977) -- 0:00:05 904500 -- (-1181.504) (-1179.457) [-1178.847] (-1180.855) * [-1178.773] (-1179.999) (-1178.038) (-1181.376) -- 0:00:05 905000 -- (-1181.890) (-1179.780) (-1182.307) [-1180.446] * [-1178.235] (-1180.643) (-1182.382) (-1178.477) -- 0:00:05 Average standard deviation of split frequencies: 0.012292 905500 -- [-1179.965] (-1178.817) (-1185.102) (-1179.771) * (-1179.079) [-1178.849] (-1181.915) (-1179.379) -- 0:00:05 906000 -- [-1178.742] (-1177.745) (-1181.602) (-1179.191) * (-1178.232) (-1183.158) (-1177.241) [-1184.917] -- 0:00:05 906500 -- (-1183.082) [-1178.550] (-1180.292) (-1180.835) * (-1181.834) (-1181.650) (-1179.840) [-1183.869] -- 0:00:05 907000 -- (-1182.492) (-1183.853) (-1184.325) [-1179.162] * [-1179.582] (-1178.160) (-1177.935) (-1181.593) -- 0:00:05 907500 -- (-1178.922) (-1185.390) [-1179.838] (-1179.144) * (-1180.402) [-1185.741] (-1178.188) (-1181.311) -- 0:00:05 908000 -- [-1179.939] (-1181.284) (-1177.900) (-1178.546) * [-1178.857] (-1182.992) (-1177.544) (-1177.718) -- 0:00:05 908500 -- (-1183.532) (-1179.500) (-1176.962) [-1178.242] * (-1178.454) [-1179.652] (-1177.556) (-1177.634) -- 0:00:05 909000 -- (-1180.151) [-1179.462] (-1182.058) (-1180.026) * (-1178.680) (-1180.225) [-1178.943] (-1177.773) -- 0:00:05 909500 -- (-1180.587) [-1179.538] (-1178.494) (-1180.379) * (-1178.862) (-1178.898) [-1180.933] (-1182.321) -- 0:00:05 910000 -- (-1177.562) (-1181.189) (-1178.967) [-1181.149] * [-1179.002] (-1179.502) (-1179.563) (-1177.769) -- 0:00:05 Average standard deviation of split frequencies: 0.012003 910500 -- [-1177.583] (-1179.761) (-1177.608) (-1178.066) * (-1180.673) [-1178.747] (-1185.711) (-1178.427) -- 0:00:05 911000 -- (-1180.705) [-1180.730] (-1179.446) (-1177.876) * (-1179.730) [-1177.002] (-1183.954) (-1180.044) -- 0:00:05 911500 -- (-1178.604) (-1177.813) (-1178.421) [-1180.088] * (-1179.904) [-1177.700] (-1180.508) (-1180.938) -- 0:00:05 912000 -- (-1182.762) [-1177.968] (-1179.629) (-1179.106) * [-1183.281] (-1178.063) (-1180.861) (-1177.489) -- 0:00:05 912500 -- [-1178.727] (-1179.373) (-1179.184) (-1180.527) * [-1178.119] (-1178.359) (-1178.337) (-1178.361) -- 0:00:05 913000 -- [-1178.760] (-1180.604) (-1177.275) (-1179.249) * (-1178.193) (-1181.398) (-1177.918) [-1177.922] -- 0:00:05 913500 -- (-1178.714) [-1183.611] (-1178.363) (-1179.995) * (-1178.638) (-1178.216) [-1178.301] (-1178.077) -- 0:00:05 914000 -- (-1179.000) (-1181.509) (-1178.686) [-1180.562] * (-1179.690) (-1179.547) [-1180.249] (-1180.862) -- 0:00:05 914500 -- [-1178.841] (-1186.654) (-1180.158) (-1182.164) * [-1180.507] (-1182.419) (-1179.925) (-1182.780) -- 0:00:05 915000 -- (-1177.715) (-1188.292) (-1178.580) [-1180.348] * [-1179.160] (-1179.711) (-1183.050) (-1178.272) -- 0:00:05 Average standard deviation of split frequencies: 0.012062 915500 -- (-1178.296) (-1178.042) (-1181.615) [-1179.754] * [-1180.560] (-1179.150) (-1179.374) (-1181.049) -- 0:00:05 916000 -- (-1182.499) [-1178.619] (-1180.364) (-1180.160) * (-1179.643) (-1177.811) [-1177.627] (-1178.034) -- 0:00:05 916500 -- [-1178.604] (-1178.619) (-1180.337) (-1178.771) * (-1177.413) (-1180.147) (-1180.348) [-1179.030] -- 0:00:05 917000 -- (-1180.643) [-1180.005] (-1177.765) (-1183.211) * [-1178.123] (-1177.608) (-1178.867) (-1180.247) -- 0:00:05 917500 -- (-1178.204) (-1179.282) (-1177.872) [-1178.696] * (-1179.177) (-1177.941) (-1179.336) [-1182.941] -- 0:00:05 918000 -- (-1181.735) [-1178.481] (-1179.524) (-1180.736) * (-1179.405) (-1178.048) [-1177.855] (-1180.387) -- 0:00:05 918500 -- (-1179.108) [-1181.651] (-1178.338) (-1179.327) * (-1179.503) (-1180.371) (-1181.878) [-1179.120] -- 0:00:05 919000 -- (-1177.952) (-1178.188) (-1180.267) [-1181.314] * [-1179.680] (-1177.026) (-1181.943) (-1183.798) -- 0:00:05 919500 -- (-1177.940) (-1178.944) [-1177.720] (-1180.199) * (-1181.292) (-1178.583) (-1179.030) [-1178.718] -- 0:00:04 920000 -- (-1180.138) (-1178.833) (-1178.598) [-1183.030] * (-1180.261) (-1178.843) (-1181.718) [-1180.111] -- 0:00:04 Average standard deviation of split frequencies: 0.012001 920500 -- [-1178.295] (-1181.558) (-1183.312) (-1183.506) * (-1179.416) (-1178.825) (-1177.933) [-1177.345] -- 0:00:04 921000 -- (-1177.419) [-1180.903] (-1178.329) (-1180.414) * [-1179.926] (-1178.205) (-1178.248) (-1179.146) -- 0:00:04 921500 -- (-1178.084) [-1181.047] (-1179.818) (-1177.923) * [-1183.176] (-1179.414) (-1180.691) (-1178.249) -- 0:00:04 922000 -- (-1178.277) [-1179.693] (-1177.846) (-1178.390) * (-1181.261) [-1179.110] (-1177.790) (-1177.935) -- 0:00:04 922500 -- [-1179.490] (-1178.402) (-1180.296) (-1179.860) * [-1177.523] (-1179.792) (-1178.277) (-1178.495) -- 0:00:04 923000 -- (-1179.448) (-1180.452) [-1180.110] (-1178.008) * (-1179.614) [-1178.419] (-1182.220) (-1180.160) -- 0:00:04 923500 -- (-1179.927) (-1177.851) (-1184.657) [-1178.039] * [-1179.778] (-1179.329) (-1176.905) (-1178.363) -- 0:00:04 924000 -- (-1180.168) (-1185.361) (-1180.357) [-1178.475] * (-1181.997) (-1177.690) (-1179.749) [-1178.885] -- 0:00:04 924500 -- (-1177.668) (-1180.347) [-1182.102] (-1178.833) * (-1178.603) [-1178.765] (-1182.459) (-1179.183) -- 0:00:04 925000 -- (-1177.600) (-1181.117) (-1180.295) [-1178.292] * (-1179.782) [-1178.201] (-1177.863) (-1178.471) -- 0:00:04 Average standard deviation of split frequencies: 0.011900 925500 -- (-1178.608) [-1178.512] (-1177.937) (-1180.495) * (-1177.476) (-1186.587) [-1178.350] (-1179.755) -- 0:00:04 926000 -- (-1177.864) (-1180.381) (-1180.272) [-1179.382] * (-1178.533) (-1179.240) (-1177.312) [-1177.462] -- 0:00:04 926500 -- (-1178.019) [-1178.222] (-1179.416) (-1180.961) * (-1179.889) [-1179.489] (-1181.513) (-1177.462) -- 0:00:04 927000 -- (-1179.364) (-1178.524) [-1177.551] (-1180.741) * (-1180.052) (-1179.368) (-1181.074) [-1180.856] -- 0:00:04 927500 -- (-1179.679) (-1180.815) (-1181.138) [-1177.630] * (-1180.680) (-1182.444) (-1179.542) [-1179.944] -- 0:00:04 928000 -- (-1182.619) (-1179.624) (-1180.071) [-1182.860] * [-1179.643] (-1181.717) (-1183.328) (-1179.989) -- 0:00:04 928500 -- (-1180.031) (-1181.324) (-1178.138) [-1182.294] * [-1181.053] (-1179.826) (-1181.963) (-1177.335) -- 0:00:04 929000 -- [-1180.321] (-1186.530) (-1178.880) (-1180.772) * (-1178.543) (-1177.876) [-1181.471] (-1179.171) -- 0:00:04 929500 -- (-1183.499) (-1179.262) [-1183.035] (-1180.330) * [-1179.653] (-1177.745) (-1187.961) (-1182.441) -- 0:00:04 930000 -- (-1180.374) (-1179.770) [-1177.302] (-1179.472) * (-1181.877) (-1179.276) (-1181.346) [-1180.329] -- 0:00:04 Average standard deviation of split frequencies: 0.011555 930500 -- [-1180.283] (-1177.548) (-1179.705) (-1177.865) * (-1181.308) (-1179.809) (-1179.613) [-1180.407] -- 0:00:04 931000 -- (-1179.451) (-1178.846) [-1178.530] (-1178.183) * (-1180.412) (-1178.657) (-1177.762) [-1178.221] -- 0:00:04 931500 -- (-1178.052) [-1178.848] (-1177.510) (-1178.856) * (-1178.542) (-1179.171) (-1177.193) [-1177.909] -- 0:00:04 932000 -- [-1183.103] (-1178.065) (-1177.784) (-1178.494) * (-1178.198) (-1181.241) [-1177.458] (-1180.239) -- 0:00:04 932500 -- (-1179.581) (-1179.767) (-1179.782) [-1185.125] * (-1183.926) [-1178.946] (-1181.061) (-1178.903) -- 0:00:04 933000 -- [-1180.559] (-1182.933) (-1177.876) (-1185.161) * (-1180.517) [-1178.532] (-1178.198) (-1181.588) -- 0:00:04 933500 -- (-1178.148) (-1179.211) (-1183.401) [-1180.754] * (-1179.931) (-1178.284) [-1178.384] (-1178.090) -- 0:00:04 934000 -- (-1178.596) (-1178.426) [-1179.498] (-1180.012) * (-1177.181) [-1178.943] (-1177.964) (-1179.086) -- 0:00:04 934500 -- [-1177.515] (-1183.674) (-1178.767) (-1178.552) * (-1177.779) [-1181.052] (-1180.039) (-1178.338) -- 0:00:04 935000 -- [-1180.886] (-1189.306) (-1181.567) (-1182.705) * [-1179.695] (-1178.972) (-1178.839) (-1178.268) -- 0:00:04 Average standard deviation of split frequencies: 0.011395 935500 -- (-1179.404) [-1179.862] (-1179.462) (-1180.017) * (-1183.736) (-1178.939) [-1179.142] (-1179.405) -- 0:00:03 936000 -- [-1178.019] (-1179.182) (-1178.060) (-1178.218) * [-1178.772] (-1182.646) (-1179.255) (-1182.179) -- 0:00:03 936500 -- (-1179.917) (-1180.317) [-1178.752] (-1180.973) * [-1179.111] (-1179.617) (-1178.539) (-1182.370) -- 0:00:03 937000 -- (-1182.028) (-1183.245) (-1179.740) [-1178.486] * [-1180.929] (-1179.597) (-1177.966) (-1177.358) -- 0:00:03 937500 -- (-1182.422) [-1181.260] (-1179.822) (-1178.842) * (-1181.207) [-1177.638] (-1177.439) (-1181.150) -- 0:00:03 938000 -- [-1180.591] (-1184.985) (-1186.653) (-1180.896) * (-1182.214) (-1177.754) (-1181.219) [-1178.412] -- 0:00:03 938500 -- (-1179.696) (-1177.396) [-1177.778] (-1180.093) * (-1178.890) [-1181.591] (-1181.252) (-1179.312) -- 0:00:03 939000 -- (-1180.408) [-1177.960] (-1177.588) (-1178.675) * (-1179.055) (-1181.628) [-1179.913] (-1181.194) -- 0:00:03 939500 -- (-1178.252) (-1177.313) [-1177.587] (-1177.501) * (-1182.370) [-1180.336] (-1178.682) (-1179.202) -- 0:00:03 940000 -- [-1178.975] (-1178.984) (-1178.324) (-1179.908) * (-1178.551) [-1177.719] (-1181.236) (-1178.035) -- 0:00:03 Average standard deviation of split frequencies: 0.011182 940500 -- [-1178.551] (-1180.302) (-1182.203) (-1178.401) * (-1181.589) [-1178.699] (-1177.485) (-1179.179) -- 0:00:03 941000 -- [-1178.327] (-1180.665) (-1183.768) (-1180.543) * (-1178.525) [-1178.289] (-1177.493) (-1180.722) -- 0:00:03 941500 -- [-1179.961] (-1183.532) (-1179.779) (-1178.705) * (-1178.313) (-1179.380) (-1177.617) [-1178.567] -- 0:00:03 942000 -- (-1179.101) [-1182.689] (-1179.386) (-1178.315) * (-1177.377) (-1181.170) [-1179.042] (-1178.199) -- 0:00:03 942500 -- (-1182.476) (-1179.685) (-1177.885) [-1180.260] * (-1179.631) [-1181.366] (-1177.858) (-1181.750) -- 0:00:03 943000 -- (-1178.737) (-1180.911) (-1181.133) [-1179.667] * (-1180.812) [-1177.148] (-1178.046) (-1177.258) -- 0:00:03 943500 -- (-1179.102) (-1182.948) [-1177.154] (-1177.962) * (-1178.733) (-1177.464) [-1177.812] (-1177.912) -- 0:00:03 944000 -- (-1178.072) [-1179.937] (-1180.048) (-1177.870) * (-1178.530) [-1177.112] (-1178.081) (-1178.974) -- 0:00:03 944500 -- [-1179.165] (-1177.632) (-1178.958) (-1179.279) * (-1182.589) (-1177.536) (-1179.902) [-1179.841] -- 0:00:03 945000 -- [-1180.419] (-1178.640) (-1179.581) (-1179.190) * (-1181.727) (-1178.905) [-1179.783] (-1177.215) -- 0:00:03 Average standard deviation of split frequencies: 0.011337 945500 -- (-1178.388) (-1178.256) [-1180.036] (-1178.153) * (-1179.301) (-1178.509) [-1177.329] (-1177.968) -- 0:00:03 946000 -- (-1179.166) (-1178.179) [-1178.701] (-1178.807) * (-1178.729) [-1180.106] (-1179.677) (-1181.857) -- 0:00:03 946500 -- (-1181.104) (-1182.457) (-1180.330) [-1179.535] * [-1178.122] (-1177.617) (-1179.880) (-1182.687) -- 0:00:03 947000 -- (-1179.662) (-1181.173) (-1181.561) [-1177.832] * [-1178.506] (-1178.618) (-1178.512) (-1182.610) -- 0:00:03 947500 -- [-1177.796] (-1183.266) (-1179.004) (-1182.294) * (-1178.318) (-1178.763) (-1179.426) [-1178.616] -- 0:00:03 948000 -- [-1179.246] (-1177.220) (-1179.954) (-1179.955) * (-1179.678) [-1180.055] (-1177.468) (-1179.200) -- 0:00:03 948500 -- (-1177.339) [-1181.936] (-1180.626) (-1178.915) * (-1177.788) [-1178.672] (-1179.068) (-1180.152) -- 0:00:03 949000 -- (-1179.373) [-1182.239] (-1179.705) (-1177.109) * (-1178.414) (-1178.866) [-1179.846] (-1181.020) -- 0:00:03 949500 -- (-1179.829) (-1181.876) [-1179.199] (-1177.526) * [-1185.105] (-1180.773) (-1177.409) (-1180.328) -- 0:00:03 950000 -- (-1180.558) [-1178.676] (-1177.526) (-1177.413) * (-1181.689) (-1180.104) (-1178.265) [-1179.432] -- 0:00:03 Average standard deviation of split frequencies: 0.011126 950500 -- (-1177.914) (-1179.085) [-1177.284] (-1181.071) * (-1179.221) (-1179.850) [-1176.969] (-1180.806) -- 0:00:03 951000 -- [-1177.677] (-1179.494) (-1177.264) (-1181.039) * (-1180.741) (-1180.864) [-1178.108] (-1179.210) -- 0:00:03 951500 -- [-1183.171] (-1177.984) (-1178.113) (-1179.068) * (-1179.335) (-1178.820) (-1178.630) [-1183.231] -- 0:00:03 952000 -- (-1180.776) (-1177.925) (-1178.514) [-1177.823] * (-1178.197) (-1179.080) (-1177.678) [-1178.473] -- 0:00:02 952500 -- (-1177.149) (-1180.639) (-1178.725) [-1179.017] * (-1178.347) [-1180.170] (-1177.153) (-1177.764) -- 0:00:02 953000 -- [-1176.972] (-1183.827) (-1181.127) (-1178.240) * (-1182.049) (-1180.135) [-1177.261] (-1178.502) -- 0:00:02 953500 -- (-1179.609) [-1179.726] (-1180.878) (-1180.149) * (-1179.562) (-1178.134) [-1177.772] (-1180.596) -- 0:00:02 954000 -- [-1178.203] (-1182.547) (-1180.492) (-1180.639) * (-1177.691) [-1178.038] (-1178.035) (-1177.647) -- 0:00:02 954500 -- (-1178.113) [-1178.118] (-1178.089) (-1180.666) * (-1177.375) (-1177.257) (-1178.156) [-1177.418] -- 0:00:02 955000 -- (-1177.705) (-1178.966) [-1179.611] (-1182.425) * (-1177.861) (-1178.981) [-1177.722] (-1178.755) -- 0:00:02 Average standard deviation of split frequencies: 0.011064 955500 -- (-1180.194) (-1186.420) (-1181.311) [-1177.850] * [-1178.707] (-1178.816) (-1179.200) (-1178.505) -- 0:00:02 956000 -- (-1178.092) [-1182.437] (-1180.764) (-1178.228) * (-1177.422) [-1179.263] (-1181.295) (-1177.776) -- 0:00:02 956500 -- (-1179.339) (-1183.076) (-1178.509) [-1177.961] * (-1179.700) (-1176.975) (-1181.807) [-1178.009] -- 0:00:02 957000 -- [-1177.963] (-1186.290) (-1179.593) (-1178.502) * [-1179.162] (-1177.283) (-1184.022) (-1178.628) -- 0:00:02 957500 -- (-1179.932) [-1181.500] (-1178.968) (-1178.156) * (-1177.386) [-1178.172] (-1178.710) (-1177.469) -- 0:00:02 958000 -- [-1180.022] (-1182.714) (-1182.164) (-1178.174) * [-1179.144] (-1177.464) (-1179.339) (-1177.930) -- 0:00:02 958500 -- (-1180.129) [-1179.610] (-1177.323) (-1178.163) * (-1178.214) (-1178.288) [-1180.877] (-1181.194) -- 0:00:02 959000 -- (-1180.668) (-1178.997) [-1178.069] (-1180.248) * [-1179.035] (-1179.523) (-1178.623) (-1180.052) -- 0:00:02 959500 -- (-1178.962) [-1177.694] (-1178.133) (-1179.041) * (-1177.871) (-1179.635) (-1181.136) [-1177.347] -- 0:00:02 960000 -- [-1179.173] (-1177.405) (-1177.953) (-1178.929) * (-1178.798) (-1178.768) [-1181.488] (-1177.463) -- 0:00:02 Average standard deviation of split frequencies: 0.011256 960500 -- (-1178.870) (-1177.574) (-1179.677) [-1180.975] * (-1181.923) (-1179.113) (-1177.729) [-1178.375] -- 0:00:02 961000 -- (-1178.806) (-1180.082) (-1177.925) [-1178.007] * (-1183.741) (-1180.500) [-1178.011] (-1180.430) -- 0:00:02 961500 -- (-1178.810) (-1179.720) (-1177.331) [-1177.202] * (-1181.922) (-1182.536) [-1178.787] (-1180.292) -- 0:00:02 962000 -- [-1177.830] (-1179.866) (-1177.593) (-1178.506) * [-1180.879] (-1185.294) (-1179.744) (-1178.874) -- 0:00:02 962500 -- [-1178.149] (-1179.328) (-1177.855) (-1177.484) * [-1179.557] (-1180.929) (-1178.792) (-1178.822) -- 0:00:02 963000 -- (-1177.763) (-1182.299) [-1178.058] (-1178.353) * (-1180.200) [-1180.686] (-1179.139) (-1179.581) -- 0:00:02 963500 -- (-1177.658) [-1179.078] (-1179.215) (-1179.908) * (-1178.375) (-1185.910) [-1177.695] (-1181.878) -- 0:00:02 964000 -- (-1180.253) (-1181.316) [-1178.576] (-1178.944) * (-1178.356) (-1183.078) (-1179.425) [-1180.244] -- 0:00:02 964500 -- (-1178.069) (-1178.763) (-1180.278) [-1179.735] * [-1179.282] (-1181.496) (-1178.296) (-1181.695) -- 0:00:02 965000 -- (-1180.996) (-1177.938) [-1178.632] (-1180.719) * (-1176.887) (-1179.372) (-1177.588) [-1179.252] -- 0:00:02 Average standard deviation of split frequencies: 0.011376 965500 -- (-1177.613) (-1179.529) [-1178.248] (-1180.385) * (-1178.596) (-1178.451) [-1179.273] (-1179.304) -- 0:00:02 966000 -- (-1178.707) (-1180.489) (-1179.686) [-1177.765] * (-1182.428) [-1177.356] (-1178.923) (-1178.136) -- 0:00:02 966500 -- (-1179.147) (-1177.851) [-1178.583] (-1178.388) * (-1179.245) [-1177.334] (-1179.546) (-1177.648) -- 0:00:02 967000 -- (-1178.588) (-1180.515) [-1180.427] (-1179.966) * (-1178.347) (-1180.220) [-1180.598] (-1178.998) -- 0:00:02 967500 -- (-1181.254) [-1178.717] (-1177.070) (-1180.298) * (-1177.048) [-1179.582] (-1180.896) (-1181.204) -- 0:00:02 968000 -- (-1178.132) [-1177.950] (-1177.508) (-1179.994) * (-1181.960) (-1181.989) [-1178.836] (-1185.035) -- 0:00:01 968500 -- [-1179.218] (-1179.351) (-1179.259) (-1180.580) * (-1178.324) [-1177.874] (-1179.702) (-1180.258) -- 0:00:01 969000 -- [-1182.080] (-1179.533) (-1181.421) (-1177.485) * [-1177.999] (-1179.264) (-1179.377) (-1181.789) -- 0:00:01 969500 -- (-1182.472) (-1178.970) (-1182.345) [-1178.430] * [-1177.697] (-1179.961) (-1179.457) (-1178.262) -- 0:00:01 970000 -- [-1184.075] (-1180.987) (-1179.615) (-1178.723) * (-1177.240) (-1180.191) [-1179.592] (-1177.527) -- 0:00:01 Average standard deviation of split frequencies: 0.011352 970500 -- [-1182.703] (-1179.081) (-1185.913) (-1178.224) * (-1177.372) [-1179.898] (-1188.749) (-1177.998) -- 0:00:01 971000 -- (-1182.910) (-1180.808) [-1178.239] (-1181.399) * [-1178.413] (-1180.136) (-1179.184) (-1179.167) -- 0:00:01 971500 -- (-1179.601) (-1180.237) (-1183.295) [-1179.467] * (-1179.427) (-1187.017) (-1178.336) [-1177.757] -- 0:00:01 972000 -- (-1184.173) (-1178.688) [-1178.997] (-1180.964) * [-1180.736] (-1178.477) (-1178.832) (-1178.072) -- 0:00:01 972500 -- (-1179.293) [-1182.516] (-1179.831) (-1179.934) * [-1180.561] (-1177.313) (-1179.128) (-1179.964) -- 0:00:01 973000 -- [-1178.006] (-1180.698) (-1180.942) (-1178.900) * (-1177.916) [-1178.230] (-1179.957) (-1181.451) -- 0:00:01 973500 -- (-1178.323) (-1177.491) (-1181.504) [-1180.405] * (-1178.047) (-1178.376) [-1179.344] (-1180.274) -- 0:00:01 974000 -- (-1177.838) (-1178.030) [-1182.966] (-1177.729) * (-1178.121) (-1180.396) (-1179.770) [-1179.882] -- 0:00:01 974500 -- (-1180.086) (-1177.785) (-1181.436) [-1177.085] * (-1177.845) (-1177.629) (-1181.119) [-1179.573] -- 0:00:01 975000 -- [-1179.469] (-1181.281) (-1187.641) (-1177.255) * (-1182.552) [-1178.534] (-1179.346) (-1180.122) -- 0:00:01 Average standard deviation of split frequencies: 0.011290 975500 -- [-1179.406] (-1179.988) (-1186.130) (-1181.789) * (-1179.261) (-1178.098) (-1178.156) [-1177.366] -- 0:00:01 976000 -- (-1178.514) [-1178.418] (-1181.956) (-1177.691) * (-1182.065) (-1180.802) [-1177.713] (-1179.814) -- 0:00:01 976500 -- (-1177.780) (-1177.254) (-1181.299) [-1179.511] * [-1181.461] (-1182.034) (-1177.340) (-1179.432) -- 0:00:01 977000 -- [-1178.742] (-1177.614) (-1178.037) (-1178.541) * [-1178.724] (-1183.276) (-1178.334) (-1180.960) -- 0:00:01 977500 -- [-1177.958] (-1177.893) (-1180.200) (-1179.666) * (-1181.572) (-1178.789) [-1180.038] (-1181.495) -- 0:00:01 978000 -- [-1177.963] (-1183.002) (-1181.295) (-1179.148) * (-1178.526) (-1178.773) [-1178.525] (-1179.523) -- 0:00:01 978500 -- (-1178.656) (-1181.251) [-1182.312] (-1177.371) * [-1180.597] (-1180.033) (-1178.470) (-1179.228) -- 0:00:01 979000 -- (-1182.898) (-1181.620) (-1182.199) [-1178.026] * (-1179.826) (-1179.367) [-1182.782] (-1179.476) -- 0:00:01 979500 -- (-1179.019) [-1179.760] (-1180.154) (-1176.784) * [-1178.134] (-1177.972) (-1183.610) (-1179.868) -- 0:00:01 980000 -- (-1178.235) (-1181.152) [-1179.137] (-1177.222) * (-1179.248) (-1179.126) (-1180.816) [-1177.833] -- 0:00:01 Average standard deviation of split frequencies: 0.011176 980500 -- (-1179.387) (-1179.437) [-1178.443] (-1178.400) * (-1177.513) [-1181.166] (-1180.443) (-1178.356) -- 0:00:01 981000 -- [-1177.371] (-1178.314) (-1178.073) (-1179.088) * (-1180.224) (-1179.192) [-1178.863] (-1178.528) -- 0:00:01 981500 -- [-1179.166] (-1179.080) (-1180.598) (-1179.882) * (-1181.207) (-1177.681) [-1177.363] (-1179.092) -- 0:00:01 982000 -- (-1178.719) (-1178.892) (-1180.635) [-1178.743] * (-1179.561) [-1177.062] (-1179.764) (-1181.077) -- 0:00:01 982500 -- [-1177.000] (-1178.449) (-1178.335) (-1178.081) * [-1179.689] (-1180.781) (-1178.590) (-1178.906) -- 0:00:01 983000 -- (-1179.258) [-1177.028] (-1179.224) (-1177.463) * [-1179.874] (-1178.084) (-1179.310) (-1178.806) -- 0:00:01 983500 -- (-1178.082) [-1180.787] (-1179.409) (-1179.244) * (-1178.028) (-1178.410) (-1178.046) [-1178.690] -- 0:00:01 984000 -- (-1178.544) (-1178.710) [-1179.914] (-1179.990) * [-1178.066] (-1179.126) (-1177.405) (-1177.594) -- 0:00:00 984500 -- [-1179.002] (-1181.896) (-1180.860) (-1179.591) * [-1177.161] (-1178.041) (-1177.159) (-1188.929) -- 0:00:00 985000 -- (-1178.506) (-1184.300) (-1179.744) [-1181.954] * [-1178.092] (-1178.041) (-1178.260) (-1178.971) -- 0:00:00 Average standard deviation of split frequencies: 0.011415 985500 -- (-1178.786) [-1179.569] (-1177.821) (-1178.865) * (-1184.600) (-1177.980) (-1177.731) [-1177.502] -- 0:00:00 986000 -- (-1178.575) [-1178.856] (-1178.598) (-1178.212) * (-1186.464) [-1180.402] (-1179.423) (-1182.503) -- 0:00:00 986500 -- [-1181.011] (-1181.995) (-1177.746) (-1178.192) * (-1180.361) [-1177.425] (-1180.445) (-1182.429) -- 0:00:00 987000 -- (-1182.504) [-1177.451] (-1180.373) (-1179.772) * (-1180.223) (-1179.641) [-1178.711] (-1180.639) -- 0:00:00 987500 -- [-1178.043] (-1177.543) (-1180.567) (-1179.489) * (-1179.847) [-1179.095] (-1178.854) (-1182.158) -- 0:00:00 988000 -- (-1178.468) (-1180.102) [-1177.514] (-1177.971) * [-1180.018] (-1183.409) (-1179.185) (-1184.429) -- 0:00:00 988500 -- [-1179.981] (-1179.583) (-1181.303) (-1177.364) * (-1179.932) [-1178.114] (-1179.158) (-1182.926) -- 0:00:00 989000 -- (-1179.574) (-1182.487) [-1178.323] (-1180.939) * (-1180.356) (-1181.498) (-1178.276) [-1180.984] -- 0:00:00 989500 -- (-1180.970) (-1182.425) (-1177.070) [-1178.637] * [-1179.988] (-1177.682) (-1180.181) (-1177.718) -- 0:00:00 990000 -- [-1178.467] (-1181.864) (-1178.600) (-1179.454) * (-1180.879) (-1177.674) (-1177.205) [-1177.983] -- 0:00:00 Average standard deviation of split frequencies: 0.011747 990500 -- [-1178.310] (-1179.614) (-1177.796) (-1179.738) * [-1178.294] (-1179.549) (-1177.886) (-1178.573) -- 0:00:00 991000 -- (-1180.484) [-1178.382] (-1177.796) (-1177.647) * (-1178.271) [-1180.279] (-1179.778) (-1177.845) -- 0:00:00 991500 -- (-1178.279) (-1177.390) (-1178.415) [-1180.777] * (-1178.734) (-1179.145) (-1179.050) [-1178.372] -- 0:00:00 992000 -- (-1177.035) (-1181.687) [-1177.636] (-1177.982) * (-1177.871) (-1178.336) (-1184.266) [-1177.439] -- 0:00:00 992500 -- (-1178.156) (-1181.917) [-1178.696] (-1178.516) * (-1178.902) (-1177.011) (-1183.367) [-1183.236] -- 0:00:00 993000 -- [-1177.213] (-1179.573) (-1178.791) (-1177.962) * [-1178.896] (-1177.575) (-1178.541) (-1186.427) -- 0:00:00 993500 -- [-1177.123] (-1182.687) (-1178.514) (-1181.587) * (-1184.927) [-1177.571] (-1177.891) (-1178.004) -- 0:00:00 994000 -- (-1177.614) (-1182.650) [-1179.054] (-1180.841) * (-1182.308) (-1177.779) [-1179.113] (-1177.905) -- 0:00:00 994500 -- (-1179.094) (-1186.798) [-1178.136] (-1178.189) * (-1178.251) (-1183.525) (-1178.949) [-1179.063] -- 0:00:00 995000 -- [-1177.266] (-1180.458) (-1182.465) (-1184.799) * [-1180.363] (-1181.895) (-1178.707) (-1177.482) -- 0:00:00 Average standard deviation of split frequencies: 0.011270 995500 -- [-1179.996] (-1178.206) (-1182.264) (-1179.038) * [-1181.384] (-1177.652) (-1177.697) (-1178.343) -- 0:00:00 996000 -- (-1179.207) (-1182.472) (-1180.569) [-1178.263] * (-1181.203) (-1177.188) [-1177.748] (-1182.244) -- 0:00:00 996500 -- (-1179.055) (-1177.531) (-1185.944) [-1177.331] * [-1178.062] (-1177.669) (-1179.858) (-1180.778) -- 0:00:00 997000 -- (-1177.352) (-1178.729) [-1181.658] (-1179.601) * (-1180.505) (-1182.613) [-1184.336] (-1177.554) -- 0:00:00 997500 -- [-1177.170] (-1177.897) (-1180.481) (-1177.710) * (-1179.285) (-1188.241) (-1181.805) [-1177.875] -- 0:00:00 998000 -- (-1177.451) (-1178.332) (-1182.023) [-1178.561] * [-1181.472] (-1182.378) (-1181.431) (-1178.824) -- 0:00:00 998500 -- (-1180.001) (-1178.359) (-1177.734) [-1177.986] * [-1178.143] (-1179.708) (-1178.966) (-1181.889) -- 0:00:00 999000 -- (-1180.519) (-1178.475) (-1179.727) [-1179.423] * (-1177.143) (-1177.960) [-1181.536] (-1177.609) -- 0:00:00 999500 -- (-1182.888) [-1181.348] (-1182.371) (-1177.083) * (-1178.052) (-1181.528) (-1182.182) [-1178.430] -- 0:00:00 1000000 -- (-1182.843) (-1180.762) (-1179.505) [-1179.254] * (-1178.828) (-1178.593) (-1177.412) [-1178.978] -- 0:00:00 Average standard deviation of split frequencies: 0.011306 Analysis completed in 1 mins 2 seconds Analysis used 60.48 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1176.78 Likelihood of best state for "cold" chain of run 2 was -1176.78 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.5 % ( 70 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 26.6 % ( 18 %) Dirichlet(Pi{all}) 28.4 % ( 26 %) Slider(Pi{all}) 79.6 % ( 57 %) Multiplier(Alpha{1,2}) 77.5 % ( 57 %) Multiplier(Alpha{3}) 19.1 % ( 25 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 72 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 88 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 32 %) Multiplier(V{all}) 97.5 % ( 99 %) Nodeslider(V{all}) 30.4 % ( 31 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.8 % ( 76 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 27.2 % ( 26 %) Dirichlet(Pi{all}) 28.8 % ( 22 %) Slider(Pi{all}) 79.3 % ( 58 %) Multiplier(Alpha{1,2}) 77.2 % ( 50 %) Multiplier(Alpha{3}) 18.5 % ( 18 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 72 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 92 %) ParsSPR(Tau{all},V{all}) 28.0 % ( 25 %) Multiplier(V{all}) 97.5 % ( 98 %) Nodeslider(V{all}) 30.7 % ( 16 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166908 0.82 0.67 3 | 166622 166976 0.83 4 | 166660 166249 166585 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 167449 0.82 0.67 3 | 166208 166916 0.84 4 | 166452 166002 166973 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1178.43 | 2 2 | | 1| | 2 1 212 2 2 | | 1 1 1 1 11 2 2 | |1 2 2 * 1 1 | | 1 * 1 2 1 1 12 1 1 21 | | 1 1 1 22 1 222 1 22 2 2 | | 2 1 1 1 11 2 12 2 | |21 2 22 2 1 12 2 2 2 1 2 | | 22 22 1 2 111 2 22 1 * 1 * 1 1 2| | 11 2 22 | | 2 1 2 2 | | 1 1 2 1 2 1 11 | | 2 1 2 1 | | 1 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1180.15 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1178.51 -1184.13 2 -1178.50 -1182.30 -------------------------------------- TOTAL -1178.50 -1183.58 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.905452 0.094808 0.356476 1.519429 0.867081 1465.60 1483.30 1.000 r(A<->C){all} 0.169669 0.020159 0.000136 0.461478 0.133191 192.46 225.71 1.003 r(A<->G){all} 0.166236 0.020571 0.000033 0.457779 0.128493 194.55 209.56 1.000 r(A<->T){all} 0.167918 0.019109 0.000033 0.443459 0.134105 167.09 189.00 1.001 r(C<->G){all} 0.169471 0.019703 0.000073 0.458198 0.134536 149.15 209.13 1.001 r(C<->T){all} 0.158770 0.017565 0.000156 0.430053 0.126714 175.49 181.17 1.001 r(G<->T){all} 0.167935 0.019048 0.000011 0.438642 0.133907 204.27 267.00 1.000 pi(A){all} 0.226681 0.000202 0.199648 0.255317 0.226341 1318.79 1338.82 1.000 pi(C){all} 0.305590 0.000236 0.277730 0.338775 0.305417 1373.16 1427.49 1.000 pi(G){all} 0.272672 0.000231 0.243215 0.302381 0.272589 1287.38 1316.64 1.000 pi(T){all} 0.195057 0.000181 0.168997 0.221741 0.194641 1146.54 1266.23 1.001 alpha{1,2} 0.433590 0.237180 0.000274 1.428154 0.260938 792.76 840.56 1.000 alpha{3} 0.461069 0.245521 0.000113 1.412858 0.295526 1192.78 1249.30 1.001 pinvar{all} 0.998195 0.000005 0.994021 0.999999 0.998879 1196.19 1252.25 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ...*.* 8 -- .****. 9 -- ..*.*. 10 -- .*..*. 11 -- .*.*** 12 -- ..**.. 13 -- .*...* 14 -- .**.** 15 -- .**... 16 -- ..**** 17 -- ..*..* 18 -- .***.* 19 -- ...**. 20 -- ....** 21 -- .*.*.. 22 -- .*..** ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 459 0.152898 0.001413 0.151899 0.153897 2 8 451 0.150233 0.003298 0.147901 0.152565 2 9 446 0.148568 0.014133 0.138574 0.158561 2 10 441 0.146902 0.013662 0.137242 0.156562 2 11 431 0.143571 0.000471 0.143238 0.143904 2 12 430 0.143238 0.007537 0.137908 0.148568 2 13 428 0.142572 0.024497 0.125250 0.159893 2 14 427 0.142239 0.018373 0.129247 0.155230 2 15 423 0.140906 0.012719 0.131912 0.149900 2 16 419 0.139574 0.006124 0.135243 0.143904 2 17 415 0.138241 0.008009 0.132578 0.143904 2 18 415 0.138241 0.005182 0.134577 0.141905 2 19 413 0.137575 0.019315 0.123917 0.151233 2 20 413 0.137575 0.008951 0.131246 0.143904 2 21 403 0.134244 0.025910 0.115923 0.152565 2 22 288 0.095936 0.011306 0.087941 0.103931 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.104325 0.011780 0.000018 0.324130 0.070663 1.000 2 length{all}[2] 0.102718 0.011024 0.000022 0.311321 0.070248 1.000 2 length{all}[3] 0.100274 0.010105 0.000047 0.307483 0.069044 1.000 2 length{all}[4] 0.098690 0.009456 0.000063 0.289496 0.069880 1.000 2 length{all}[5] 0.100446 0.010351 0.000002 0.299634 0.070513 1.000 2 length{all}[6] 0.098465 0.009989 0.000040 0.286295 0.068299 1.000 2 length{all}[7] 0.104663 0.010888 0.000026 0.319934 0.072153 1.012 2 length{all}[8] 0.097163 0.008792 0.000408 0.292380 0.063253 0.998 2 length{all}[9] 0.104939 0.013112 0.000394 0.316493 0.073017 0.998 2 length{all}[10] 0.106177 0.011216 0.000112 0.294255 0.070152 0.999 2 length{all}[11] 0.097869 0.009565 0.000098 0.299844 0.064388 1.001 2 length{all}[12] 0.099986 0.009847 0.000274 0.316211 0.064273 1.004 2 length{all}[13] 0.101742 0.010098 0.000216 0.308873 0.070518 1.002 2 length{all}[14] 0.100963 0.009968 0.000255 0.304230 0.068716 0.998 2 length{all}[15] 0.099973 0.010757 0.000056 0.320673 0.063552 0.998 2 length{all}[16] 0.096568 0.012031 0.000379 0.280511 0.065228 0.998 2 length{all}[17] 0.097731 0.009637 0.000156 0.282525 0.069075 1.000 2 length{all}[18] 0.110423 0.011681 0.000048 0.338251 0.080549 0.998 2 length{all}[19] 0.097109 0.008330 0.000513 0.290232 0.067323 0.998 2 length{all}[20] 0.105340 0.009861 0.000359 0.302119 0.078849 1.000 2 length{all}[21] 0.096633 0.008744 0.000208 0.280721 0.074270 1.005 2 length{all}[22] 0.101706 0.010304 0.000051 0.328991 0.075264 0.997 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.011306 Maximum standard deviation of split frequencies = 0.025910 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.012 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |---------------------------------------------------------------------- C3 (3) + |----------------------------------------------------------------------- C4 (4) | |------------------------------------------------------------------------ C5 (5) | \---------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 45 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 858 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 57 patterns at 286 / 286 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 57 patterns at 286 / 286 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 55632 bytes for conP 5016 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.012783 0.013287 0.025333 0.041051 0.053431 0.013547 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1169.647704 Iterating by ming2 Initial: fx= 1169.647704 x= 0.01278 0.01329 0.02533 0.04105 0.05343 0.01355 0.30000 1.30000 1 h-m-p 0.0000 0.0000 689.2631 ++ 1148.102272 m 0.0000 13 | 1/8 2 h-m-p 0.0001 0.0004 89.0825 ++ 1147.967835 m 0.0004 24 | 2/8 3 h-m-p 0.0000 0.0000 1720.6306 ++ 1147.753781 m 0.0000 35 | 3/8 4 h-m-p 0.0000 0.0001 1375.4391 ++ 1145.286187 m 0.0001 46 | 4/8 5 h-m-p 0.0001 0.0003 148.5111 ++ 1140.151700 m 0.0003 57 | 5/8 6 h-m-p 0.0000 0.0003 1083.5034 ++ 1124.720352 m 0.0003 68 | 6/8 7 h-m-p 1.6000 8.0000 0.0001 ------C 1124.720352 0 0.0001 85 | 6/8 8 h-m-p 0.0160 8.0000 0.0000 +++++ 1124.720352 m 8.0000 101 | 6/8 9 h-m-p 0.0035 1.7455 0.3420 ------------.. | 6/8 10 h-m-p 0.0160 8.0000 0.0000 +++++ 1124.720352 m 8.0000 140 | 6/8 11 h-m-p 0.0160 8.0000 0.5008 ---------C 1124.720352 0 0.0000 162 | 6/8 12 h-m-p 0.0160 8.0000 0.0002 ----Y 1124.720352 0 0.0000 179 | 6/8 13 h-m-p 0.0160 8.0000 0.0106 +++++ 1124.720349 m 8.0000 195 | 6/8 14 h-m-p 0.0773 1.5587 1.0979 ----------Y 1124.720349 0 0.0000 218 | 6/8 15 h-m-p 0.0160 8.0000 0.0000 +++++ 1124.720349 m 8.0000 232 | 6/8 16 h-m-p 0.0160 8.0000 0.0426 +++++ 1124.720333 m 8.0000 248 | 6/8 17 h-m-p 0.1829 0.9143 1.3698 ---------------.. | 6/8 18 h-m-p 0.0160 8.0000 0.0001 +++++ 1124.720333 m 8.0000 288 | 6/8 19 h-m-p 0.0160 8.0000 0.0495 +++++ 1124.720290 m 8.0000 304 | 6/8 20 h-m-p 0.5356 8.0000 0.7389 ----------------.. | 6/8 21 h-m-p 0.0160 8.0000 0.0002 +++++ 1124.720290 m 8.0000 347 | 6/8 22 h-m-p 0.0160 8.0000 0.4428 -----------Y 1124.720290 0 0.0000 371 | 6/8 23 h-m-p 0.0160 8.0000 0.0001 +++++ 1124.720290 m 8.0000 387 | 6/8 24 h-m-p 0.0020 0.9903 0.7087 --------Y 1124.720290 0 0.0000 408 | 6/8 25 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/8 26 h-m-p 0.0160 8.0000 0.0002 +++++ 1124.720289 m 8.0000 448 | 6/8 27 h-m-p 0.0160 8.0000 0.4469 -------------.. | 6/8 28 h-m-p 0.0160 8.0000 0.0002 +++++ 1124.720289 m 8.0000 488 | 6/8 29 h-m-p 0.0160 8.0000 0.4324 -----------C 1124.720289 0 0.0000 512 | 6/8 30 h-m-p 0.0044 2.2082 0.3301 +++++ 1124.719741 m 2.2082 528 | 7/8 31 h-m-p 0.9084 8.0000 0.2306 -------------C 1124.719741 0 0.0000 554 | 7/8 32 h-m-p 0.0160 8.0000 0.0001 ------C 1124.719741 0 0.0000 572 Out.. lnL = -1124.719741 573 lfun, 573 eigenQcodon, 3438 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.081872 0.058156 0.085648 0.072865 0.013571 0.073802 0.241828 0.745778 0.150529 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 15.780162 np = 9 lnL0 = -1221.267905 Iterating by ming2 Initial: fx= 1221.267905 x= 0.08187 0.05816 0.08565 0.07286 0.01357 0.07380 0.24183 0.74578 0.15053 1 h-m-p 0.0000 0.0001 562.2944 ++ 1202.488673 m 0.0001 14 | 1/9 2 h-m-p 0.0000 0.0002 854.4333 ++ 1146.286786 m 0.0002 26 | 2/9 3 h-m-p 0.0000 0.0000 28238.8151 ++ 1130.810543 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0000 161.6586 ++ 1130.743662 m 0.0000 50 | 4/9 5 h-m-p 0.0000 0.0014 57.5929 ++++ 1127.165975 m 0.0014 64 | 5/9 6 h-m-p 0.0000 0.0000 510.1546 ++ 1126.392318 m 0.0000 76 | 6/9 7 h-m-p 0.0000 0.0000 12285.0468 ++ 1124.720003 m 0.0000 88 | 7/9 8 h-m-p 1.6000 8.0000 0.0002 ++ 1124.720001 m 8.0000 100 | 7/9 9 h-m-p 0.0105 5.2562 0.1661 ----------Y 1124.720001 0 0.0000 124 | 7/9 10 h-m-p 0.0152 7.6009 0.0177 +++++ 1124.719726 m 7.6009 141 | 8/9 11 h-m-p 0.4981 5.3775 0.0399 ++ 1124.719587 m 5.3775 155 | 9/9 12 h-m-p 0.0160 8.0000 0.0000 Y 1124.719587 0 0.0160 168 | 9/9 13 h-m-p 0.0160 8.0000 0.0000 Y 1124.719587 0 0.0160 180 Out.. lnL = -1124.719587 181 lfun, 543 eigenQcodon, 2172 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 initial w for M2:NSpselection reset. 0.012183 0.094474 0.067930 0.058293 0.042320 0.011833 0.000100 1.083717 0.132517 0.451079 2.793223 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 8.083238 np = 11 lnL0 = -1198.213912 Iterating by ming2 Initial: fx= 1198.213912 x= 0.01218 0.09447 0.06793 0.05829 0.04232 0.01183 0.00011 1.08372 0.13252 0.45108 2.79322 1 h-m-p 0.0000 0.0000 577.7462 ++ 1197.362964 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0009 165.3587 ++++ 1175.284148 m 0.0009 32 | 2/11 3 h-m-p 0.0000 0.0000 289.9548 ++ 1174.892890 m 0.0000 46 | 3/11 4 h-m-p 0.0000 0.0018 153.2873 ++++ 1144.753417 m 0.0018 62 | 4/11 5 h-m-p 0.0000 0.0000 7568.0594 ++ 1136.169307 m 0.0000 76 | 5/11 6 h-m-p 0.0009 0.0047 15.1442 ++ 1135.991113 m 0.0047 90 | 6/11 7 h-m-p 0.0000 0.0002 117.6333 ++ 1133.636300 m 0.0002 104 | 7/11 8 h-m-p 0.0003 0.0109 46.7417 +++ 1124.720220 m 0.0109 119 | 8/11 9 h-m-p 1.6000 8.0000 0.0001 ++ 1124.720220 m 8.0000 133 | 8/11 10 h-m-p 0.0160 8.0000 0.7329 -----------Y 1124.720220 0 0.0000 161 | 8/11 11 h-m-p 0.0160 8.0000 0.0007 +++++ 1124.720219 m 8.0000 181 | 8/11 12 h-m-p 0.0160 8.0000 1.8035 -------------.. | 8/11 13 h-m-p 0.0160 8.0000 0.0001 +++++ 1124.720219 m 8.0000 226 | 8/11 14 h-m-p 0.0160 8.0000 0.8968 -------------.. | 8/11 15 h-m-p 0.0160 8.0000 0.0001 +++++ 1124.720219 m 8.0000 274 | 8/11 16 h-m-p 0.0160 8.0000 1.5727 -----------C 1124.720219 0 0.0000 302 | 8/11 17 h-m-p 0.0160 8.0000 0.0506 +++++ 1124.720158 m 8.0000 319 | 8/11 18 h-m-p 0.1986 8.0000 2.0399 -------------N 1124.720158 0 0.0000 349 | 8/11 19 h-m-p 0.0160 8.0000 0.0023 +++++ 1124.720155 m 8.0000 366 | 8/11 20 h-m-p 0.0160 8.0000 2.1425 -------------.. | 8/11 21 h-m-p 0.0160 8.0000 0.0002 +++++ 1124.720155 m 8.0000 411 | 8/11 22 h-m-p 0.0160 8.0000 1.0078 -------------.. | 8/11 23 h-m-p 0.0160 8.0000 0.0002 +++++ 1124.720155 m 8.0000 456 | 8/11 24 h-m-p 0.0160 8.0000 1.2054 -------------.. | 8/11 25 h-m-p 0.0160 8.0000 0.0002 +++++ 1124.720154 m 8.0000 501 | 8/11 26 h-m-p 0.0024 1.1890 5.0080 +++++ 1124.719589 m 1.1890 521 | 9/11 27 h-m-p 1.6000 8.0000 0.0980 ++ 1124.719588 m 8.0000 535 | 9/11 28 h-m-p 1.1620 8.0000 0.6745 ++ 1124.719587 m 8.0000 551 | 9/11 29 h-m-p 1.6000 8.0000 0.0241 ++ 1124.719587 m 8.0000 567 | 9/11 30 h-m-p 0.2684 8.0000 0.7184 +++ 1124.719587 m 8.0000 584 | 9/11 31 h-m-p 1.6000 8.0000 0.0000 N 1124.719587 0 1.6000 600 | 9/11 32 h-m-p 0.0160 8.0000 0.0000 Y 1124.719587 0 0.0160 616 Out.. lnL = -1124.719587 617 lfun, 2468 eigenQcodon, 11106 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1124.807903 S = -1124.721390 -0.033725 Calculating f(w|X), posterior probabilities of site classes. did 10 / 57 patterns 0:04 did 20 / 57 patterns 0:04 did 30 / 57 patterns 0:04 did 40 / 57 patterns 0:04 did 50 / 57 patterns 0:04 did 57 / 57 patterns 0:04 Time used: 0:04 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.021985 0.076856 0.018658 0.038507 0.053417 0.069031 0.000100 0.358723 1.831632 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 28.159582 np = 9 lnL0 = -1194.563405 Iterating by ming2 Initial: fx= 1194.563405 x= 0.02198 0.07686 0.01866 0.03851 0.05342 0.06903 0.00011 0.35872 1.83163 1 h-m-p 0.0000 0.0000 580.1272 ++ 1194.291776 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0045 80.1616 +++++ 1168.827041 m 0.0045 29 | 2/9 3 h-m-p 0.0000 0.0002 528.2310 ++ 1140.256280 m 0.0002 41 | 3/9 4 h-m-p 0.0058 0.6898 13.0995 ------------.. | 3/9 5 h-m-p 0.0000 0.0000 553.7571 ++ 1137.082048 m 0.0000 75 | 4/9 6 h-m-p 0.0160 8.0000 1.7400 -------------.. | 4/9 7 h-m-p 0.0000 0.0000 495.3339 ++ 1131.861858 m 0.0000 110 | 5/9 8 h-m-p 0.0160 8.0000 1.4895 -------------.. | 5/9 9 h-m-p 0.0000 0.0000 430.4159 ++ 1127.984386 m 0.0000 145 | 6/9 10 h-m-p 0.0160 8.0000 1.2098 -------------.. | 6/9 11 h-m-p 0.0000 0.0000 352.6728 ++ 1125.023596 m 0.0000 180 | 7/9 12 h-m-p 0.0160 8.0000 0.8600 -------------.. | 7/9 13 h-m-p 0.0000 0.0000 250.9269 ++ 1124.719587 m 0.0000 217 | 8/9 14 h-m-p 0.4885 8.0000 0.0000 Y 1124.719587 0 0.4885 229 | 8/9 15 h-m-p 1.6000 8.0000 0.0000 N 1124.719587 0 1.6000 242 Out.. lnL = -1124.719587 243 lfun, 2673 eigenQcodon, 14580 P(t) Time used: 0:08 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 initial w for M8:NSbetaw>1 reset. 0.011270 0.019879 0.064964 0.093517 0.016185 0.016736 0.000100 0.900000 0.929783 1.410794 2.113235 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 13.040508 np = 11 lnL0 = -1181.828979 Iterating by ming2 Initial: fx= 1181.828979 x= 0.01127 0.01988 0.06496 0.09352 0.01619 0.01674 0.00011 0.90000 0.92978 1.41079 2.11323 1 h-m-p 0.0000 0.0000 588.6523 ++ 1181.064499 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0007 172.8818 ++++ 1162.595860 m 0.0007 32 | 2/11 3 h-m-p 0.0000 0.0000 769.8481 ++ 1156.389380 m 0.0000 46 | 3/11 4 h-m-p 0.0002 0.0008 47.5093 ++ 1155.149365 m 0.0008 60 | 4/11 5 h-m-p 0.0000 0.0000 442.5048 ++ 1152.530901 m 0.0000 74 | 5/11 6 h-m-p 0.0001 0.0031 232.8163 +++ 1126.163232 m 0.0031 89 | 6/11 7 h-m-p 0.0000 0.0000 2604.0376 ++ 1124.720009 m 0.0000 103 | 7/11 8 h-m-p 1.6000 8.0000 0.0003 ++ 1124.720007 m 8.0000 117 | 7/11 9 h-m-p 0.0113 1.4687 0.1921 ------------Y 1124.720007 0 0.0000 147 | 7/11 10 h-m-p 0.0100 4.9909 0.0114 +++++ 1124.719937 m 4.9909 168 | 8/11 11 h-m-p 0.2712 1.7175 0.1772 ++ 1124.719587 m 1.7175 186 | 9/11 12 h-m-p 1.6000 8.0000 0.0000 ++ 1124.719587 m 8.0000 203 | 9/11 13 h-m-p 0.0566 8.0000 0.0033 ---Y 1124.719587 0 0.0002 222 | 9/11 14 h-m-p 0.0123 6.1306 17.7198 --------N 1124.719587 0 0.0000 246 | 9/11 15 h-m-p 0.7676 8.0000 0.0000 Y 1124.719587 0 0.1919 260 | 9/11 16 h-m-p 1.6000 8.0000 0.0000 Y 1124.719587 0 0.4000 276 Out.. lnL = -1124.719587 277 lfun, 3324 eigenQcodon, 18282 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1124.833448 S = -1124.721389 -0.050491 Calculating f(w|X), posterior probabilities of site classes. did 10 / 57 patterns 0:13 did 20 / 57 patterns 0:13 did 30 / 57 patterns 0:13 did 40 / 57 patterns 0:13 did 50 / 57 patterns 0:13 did 57 / 57 patterns 0:13 Time used: 0:13 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=286 NC_011896_1_WP_010908600_1_2024_MLBR_RS09605 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA NC_002677_1_NP_302279_1_1151_mmaA1 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA ************************************************** NC_011896_1_WP_010908600_1_2024_MLBR_RS09605 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA NC_002677_1_NP_302279_1_1151_mmaA1 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695 KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA ************************************************** NC_011896_1_WP_010908600_1_2024_MLBR_RS09605 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF NC_002677_1_NP_302279_1_1151_mmaA1 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695 RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ************************************************** NC_011896_1_WP_010908600_1_2024_MLBR_RS09605 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP NC_002677_1_NP_302279_1_1151_mmaA1 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695 ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP ************************************************** NC_011896_1_WP_010908600_1_2024_MLBR_RS09605 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL NC_002677_1_NP_302279_1_1151_mmaA1 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695 GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL ************************************************** NC_011896_1_WP_010908600_1_2024_MLBR_RS09605 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK NC_002677_1_NP_302279_1_1151_mmaA1 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695 AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK ************************************
>NC_011896_1_WP_010908600_1_2024_MLBR_RS09605 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC TGACAAAA >NC_002677_1_NP_302279_1_1151_mmaA1 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC TGACAAAA >NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC TGACAAAA >NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC TGACAAAA >NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC TGACAAAA >NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695 ATGGCCAAACTGAGGCCATACTACGAAGAGTCGCAATCGGCATACGACAT CTCGGACGACTTTTTCGCCCTTTTCCTTGACCCCACCTGGGTTTACACCT GCGCATATTTCGAGCGCGACGACATGACCCTCGAAGAGGCCCAACTAGCA AAATTAGACCTAGCCCTGGACAAGCTGAACCTCGCACCCGGGATGACGTT GCTCGACGTAGGTTGCGGCTGGGGCGGGGCGCTGGTCCGGGCGGTTGAGA AGTACGACGTCAACGTCATCGGCCTCACCCTCAGCCGCAACCATTGCGCG CGCAGCAAAGCCAGACTCGCCGAAATCCTGACGAAGCGGCACGCCGAGGC TCGACTGCAAGGCTGGGAAGAATTCGAAGAGAAGGTCGACCGGATCGTTA GCTTTGAGGCGCTCGATGCCTTTAAGAAGGAGCGGTATCCCGCCTTCTTC GAACGCTCATATAACATCCTCCCCGATGACGGTCGAATGCTGCTGCACAG CTTATTCACGTATGACCGGCGATGGCTGCACGAGCAAGGCATTCCGCTGA CAATGGGGGACCTGCGGTTCCTGAAATTCCTGCGCGAGTCGATTTTCCCG GGCGGCGAACTCCCTTCCCAACCCGACATTGTCGACAATGCCGAAGCTGC GGGGTTCTCCGTCGAGCAAATCCAGCTAATGCAGCCACATTACGCGCGAA CCTTGGATATGTGGGCAACCAACTTAGCTGCCGCCCGGGATCACGCCCTC GCTATACAGCCCGAAGAGATCTATGACAACTTCATGCACTACTTGACTGG GTGTGCGGACCGCTTCCGCCGGGGGCTCATCAACGTGGCCCAGTTCACGC TGACAAAA
>NC_011896_1_WP_010908600_1_2024_MLBR_RS09605 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >NC_002677_1_NP_302279_1_1151_mmaA1 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK >NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695 MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLA KLDLALDKLNLAPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHCA RSKARLAEILTKRHAEARLQGWEEFEEKVDRIVSFEALDAFKKERYPAFF ERSYNILPDDGRMLLHSLFTYDRRWLHEQGIPLTMGDLRFLKFLRESIFP GGELPSQPDIVDNAEAAGFSVEQIQLMQPHYARTLDMWATNLAAARDHAL AIQPEEIYDNFMHYLTGCADRFRRGLINVAQFTLTK
#NEXUS [ID: 9770657971] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908600_1_2024_MLBR_RS09605 NC_002677_1_NP_302279_1_1151_mmaA1 NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590 NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920 NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420 NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695 ; end; begin trees; translate 1 NC_011896_1_WP_010908600_1_2024_MLBR_RS09605, 2 NC_002677_1_NP_302279_1_1151_mmaA1, 3 NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590, 4 NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920, 5 NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420, 6 NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.07066291,2:0.07024778,3:0.0690441,4:0.06988018,5:0.07051274,6:0.06829851); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.07066291,2:0.07024778,3:0.0690441,4:0.06988018,5:0.07051274,6:0.06829851); end;
Estimated marginal likelihoods for runs sampled in files "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1178.51 -1184.13 2 -1178.50 -1182.30 -------------------------------------- TOTAL -1178.50 -1183.58 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/10res/mmaA1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.905452 0.094808 0.356476 1.519429 0.867081 1465.60 1483.30 1.000 r(A<->C){all} 0.169669 0.020159 0.000136 0.461478 0.133191 192.46 225.71 1.003 r(A<->G){all} 0.166236 0.020571 0.000033 0.457779 0.128493 194.55 209.56 1.000 r(A<->T){all} 0.167918 0.019109 0.000033 0.443459 0.134105 167.09 189.00 1.001 r(C<->G){all} 0.169471 0.019703 0.000073 0.458198 0.134536 149.15 209.13 1.001 r(C<->T){all} 0.158770 0.017565 0.000156 0.430053 0.126714 175.49 181.17 1.001 r(G<->T){all} 0.167935 0.019048 0.000011 0.438642 0.133907 204.27 267.00 1.000 pi(A){all} 0.226681 0.000202 0.199648 0.255317 0.226341 1318.79 1338.82 1.000 pi(C){all} 0.305590 0.000236 0.277730 0.338775 0.305417 1373.16 1427.49 1.000 pi(G){all} 0.272672 0.000231 0.243215 0.302381 0.272589 1287.38 1316.64 1.000 pi(T){all} 0.195057 0.000181 0.168997 0.221741 0.194641 1146.54 1266.23 1.001 alpha{1,2} 0.433590 0.237180 0.000274 1.428154 0.260938 792.76 840.56 1.000 alpha{3} 0.461069 0.245521 0.000113 1.412858 0.295526 1192.78 1249.30 1.001 pinvar{all} 0.998195 0.000005 0.994021 0.999999 0.998879 1196.19 1252.25 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/mmaA1/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 286 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 5 5 5 5 5 5 | Cys TGT 1 1 1 1 1 1 TTC 14 14 14 14 14 14 | TCC 2 2 2 2 2 2 | TAC 7 7 7 7 7 7 | TGC 3 3 3 3 3 3 Leu TTA 3 3 3 3 3 3 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 3 3 3 3 3 3 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 2 2 2 2 2 2 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 0 0 0 0 0 0 CTC 11 11 11 11 11 11 | CCC 6 6 6 6 6 6 | CAC 5 5 5 5 5 5 | CGC 7 7 7 7 7 7 CTA 3 3 3 3 3 3 | CCA 2 2 2 2 2 2 | Gln CAA 6 6 6 6 6 6 | CGA 4 4 4 4 4 4 CTG 14 14 14 14 14 14 | CCG 2 2 2 2 2 2 | CAG 4 4 4 4 4 4 | CGG 8 8 8 8 8 8 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 3 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0 ATC 8 8 8 8 8 8 | ACC 6 6 6 6 6 6 | AAC 7 7 7 7 7 7 | AGC 4 4 4 4 4 4 ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 5 5 5 5 5 5 | Arg AGA 1 1 1 1 1 1 Met ATG 8 8 8 8 8 8 | ACG 4 4 4 4 4 4 | AAG 6 6 6 6 6 6 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 3 3 3 3 3 3 | Ala GCT 4 4 4 4 4 4 | Asp GAT 4 4 4 4 4 4 | Gly GGT 2 2 2 2 2 2 GTC 6 6 6 6 6 6 | GCC 14 14 14 14 14 14 | GAC 18 18 18 18 18 18 | GGC 7 7 7 7 7 7 GTA 1 1 1 1 1 1 | GCA 5 5 5 5 5 5 | Glu GAA 10 10 10 10 10 10 | GGA 0 0 0 0 0 0 GTG 1 1 1 1 1 1 | GCG 7 7 7 7 7 7 | GAG 12 12 12 12 12 12 | GGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908600_1_2024_MLBR_RS09605 position 1: T:0.17832 C:0.26923 A:0.20280 G:0.34965 position 2: T:0.29371 C:0.21329 A:0.32168 G:0.17133 position 3: T:0.11189 C:0.43706 A:0.15385 G:0.29720 Average T:0.19464 C:0.30653 A:0.22611 G:0.27273 #2: NC_002677_1_NP_302279_1_1151_mmaA1 position 1: T:0.17832 C:0.26923 A:0.20280 G:0.34965 position 2: T:0.29371 C:0.21329 A:0.32168 G:0.17133 position 3: T:0.11189 C:0.43706 A:0.15385 G:0.29720 Average T:0.19464 C:0.30653 A:0.22611 G:0.27273 #3: NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590 position 1: T:0.17832 C:0.26923 A:0.20280 G:0.34965 position 2: T:0.29371 C:0.21329 A:0.32168 G:0.17133 position 3: T:0.11189 C:0.43706 A:0.15385 G:0.29720 Average T:0.19464 C:0.30653 A:0.22611 G:0.27273 #4: NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920 position 1: T:0.17832 C:0.26923 A:0.20280 G:0.34965 position 2: T:0.29371 C:0.21329 A:0.32168 G:0.17133 position 3: T:0.11189 C:0.43706 A:0.15385 G:0.29720 Average T:0.19464 C:0.30653 A:0.22611 G:0.27273 #5: NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420 position 1: T:0.17832 C:0.26923 A:0.20280 G:0.34965 position 2: T:0.29371 C:0.21329 A:0.32168 G:0.17133 position 3: T:0.11189 C:0.43706 A:0.15385 G:0.29720 Average T:0.19464 C:0.30653 A:0.22611 G:0.27273 #6: NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695 position 1: T:0.17832 C:0.26923 A:0.20280 G:0.34965 position 2: T:0.29371 C:0.21329 A:0.32168 G:0.17133 position 3: T:0.11189 C:0.43706 A:0.15385 G:0.29720 Average T:0.19464 C:0.30653 A:0.22611 G:0.27273 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 30 | Cys C TGT 6 TTC 84 | TCC 12 | TAC 42 | TGC 18 Leu L TTA 18 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 18 | TCG 24 | TAG 0 | Trp W TGG 30 ------------------------------------------------------------------------------ Leu L CTT 12 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 0 CTC 66 | CCC 36 | CAC 30 | CGC 42 CTA 18 | CCA 12 | Gln Q CAA 36 | CGA 24 CTG 84 | CCG 12 | CAG 24 | CGG 48 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 0 ATC 48 | ACC 36 | AAC 42 | AGC 24 ATA 6 | ACA 12 | Lys K AAA 30 | Arg R AGA 6 Met M ATG 48 | ACG 24 | AAG 36 | AGG 6 ------------------------------------------------------------------------------ Val V GTT 18 | Ala A GCT 24 | Asp D GAT 24 | Gly G GGT 12 GTC 36 | GCC 84 | GAC 108 | GGC 42 GTA 6 | GCA 30 | Glu E GAA 60 | GGA 0 GTG 6 | GCG 42 | GAG 72 | GGG 36 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.17832 C:0.26923 A:0.20280 G:0.34965 position 2: T:0.29371 C:0.21329 A:0.32168 G:0.17133 position 3: T:0.11189 C:0.43706 A:0.15385 G:0.29720 Average T:0.19464 C:0.30653 A:0.22611 G:0.27273 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1124.719741 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.241828 0.000100 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908600_1_2024_MLBR_RS09605: 0.000004, NC_002677_1_NP_302279_1_1151_mmaA1: 0.000004, NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590: 0.000004, NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920: 0.000004, NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420: 0.000004, NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.24183 omega (dN/dS) = 0.00010 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 711.4 146.6 0.0001 0.0000 0.0000 0.0 0.0 7..2 0.000 711.4 146.6 0.0001 0.0000 0.0000 0.0 0.0 7..3 0.000 711.4 146.6 0.0001 0.0000 0.0000 0.0 0.0 7..4 0.000 711.4 146.6 0.0001 0.0000 0.0000 0.0 0.0 7..5 0.000 711.4 146.6 0.0001 0.0000 0.0000 0.0 0.0 7..6 0.000 711.4 146.6 0.0001 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1124.719587 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908600_1_2024_MLBR_RS09605: 0.000004, NC_002677_1_NP_302279_1_1151_mmaA1: 0.000004, NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590: 0.000004, NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920: 0.000004, NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420: 0.000004, NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1124.719587 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908600_1_2024_MLBR_RS09605: 0.000004, NC_002677_1_NP_302279_1_1151_mmaA1: 0.000004, NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590: 0.000004, NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920: 0.000004, NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420: 0.000004, NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 1.00000 0.00000 0.00000 w: 0.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908600_1_2024_MLBR_RS09605) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099 w2: 0.105 0.104 0.103 0.102 0.100 0.099 0.098 0.097 0.096 0.095 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.009 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 0.009 0.009 0.009 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.011 0.011 sum of density on p0-p1 = 1.000000 Time used: 0:04 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1124.719587 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.750030 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908600_1_2024_MLBR_RS09605: 0.000004, NC_002677_1_NP_302279_1_1151_mmaA1: 0.000004, NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590: 0.000004, NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920: 0.000004, NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420: 0.000004, NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.75003 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:08 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1124.719587 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.847715 2.532148 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908600_1_2024_MLBR_RS09605: 0.000004, NC_002677_1_NP_302279_1_1151_mmaA1: 0.000004, NZ_LVXE01000028_1_WP_010908600_1_1148_A3216_RS08590: 0.000004, NZ_LYPH01000031_1_WP_010908600_1_1230_A8144_RS05920: 0.000004, NZ_CP029543_1_WP_010908600_1_2048_DIJ64_RS10420: 0.000004, NZ_AP014567_1_WP_010908600_1_2103_JK2ML_RS10695: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.84771 (p1 = 0.00001) w = 2.53215 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.53215 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 720.4 137.6 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908600_1_2024_MLBR_RS09605) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.092 0.093 0.095 0.097 0.099 0.101 0.103 0.105 0.107 0.109 p : 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.108 0.106 0.104 0.102 0.101 0.099 0.097 0.096 0.094 0.092 Time used: 0:13
Model 1: NearlyNeutral -1124.719587 Model 2: PositiveSelection -1124.719587 Model 0: one-ratio -1124.719741 Model 7: beta -1124.719587 Model 8: beta&w>1 -1124.719587 Model 0 vs 1 3.0800000013186946E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0