--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 12:41:02 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/10res/moeZ/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/10res/moeZ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/moeZ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/10res/moeZ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1630.07 -1634.01 2 -1630.18 -1633.33 -------------------------------------- TOTAL -1630.12 -1633.73 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/10res/moeZ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/moeZ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/10res/moeZ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.886350 0.090995 0.313707 1.464717 0.846155 1399.91 1450.46 1.000 r(A<->C){all} 0.166602 0.019359 0.000015 0.443069 0.129544 200.26 248.00 1.000 r(A<->G){all} 0.156904 0.019495 0.000066 0.441588 0.119133 237.15 242.17 1.000 r(A<->T){all} 0.162146 0.019097 0.000041 0.441867 0.125892 149.45 175.95 1.000 r(C<->G){all} 0.196220 0.022234 0.000050 0.494530 0.164462 181.35 198.97 1.000 r(C<->T){all} 0.173860 0.022110 0.000057 0.475526 0.133785 219.54 286.27 1.000 r(G<->T){all} 0.144269 0.016140 0.000052 0.403269 0.107606 188.09 218.97 1.003 pi(A){all} 0.188647 0.000129 0.165935 0.210606 0.188189 1153.83 1266.02 1.000 pi(C){all} 0.273290 0.000164 0.247690 0.297529 0.273050 1038.51 1269.75 1.000 pi(G){all} 0.326650 0.000192 0.301876 0.354862 0.326555 1232.40 1234.21 1.000 pi(T){all} 0.211412 0.000141 0.189599 0.236282 0.211031 1318.82 1409.91 1.000 alpha{1,2} 0.340818 0.160711 0.000113 1.172909 0.207514 1074.71 1164.71 1.001 alpha{3} 0.408933 0.226332 0.000182 1.347731 0.239003 1181.28 1234.94 1.000 pinvar{all} 0.997276 0.000005 0.992676 0.999916 0.997880 1146.95 1263.35 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1551.710997 Model 2: PositiveSelection -1551.509208 Model 0: one-ratio -1551.509196 Model 7: beta -1551.710997 Model 8: beta&w>1 -1551.509208 Model 0 vs 1 0.40360199999986435 Model 2 vs 1 0.40357799999992494 Model 8 vs 7 0.40357799999992494
>C1 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY >C2 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY >C3 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY >C4 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY >C5 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY >C6 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM SYRTIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=395 C1 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV C2 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV C3 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV C4 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV C5 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV C6 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV ************************************************** C1 IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK C2 IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK C3 IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK C4 IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK C5 IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK C6 IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK ************************************************** C1 AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY C2 AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY C3 AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY C4 AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY C5 AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY C6 AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY ************************************************** C1 LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP C2 LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP C3 LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP C4 LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP C5 LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP C6 LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP ************************************************** C1 GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM C2 GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM C3 GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM C4 GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM C5 GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM C6 GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM ************************************************** C1 SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL C2 SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL C3 SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL C4 SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL C5 SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL C6 SYRTIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL *** ********************************************** C1 LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV C2 LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV C3 LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV C4 LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV C5 LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV C6 LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV ************************************************** C1 LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY C2 LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY C3 LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY C4 LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY C5 LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY C6 LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY ********************************************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 395 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 395 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11850] Library Relaxation: Multi_proc [96] Relaxation Summary: [11850]--->[11850] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.532 Mb, Max= 30.974 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV C2 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV C3 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV C4 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV C5 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV C6 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV ************************************************** C1 IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK C2 IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK C3 IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK C4 IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK C5 IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK C6 IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK ************************************************** C1 AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY C2 AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY C3 AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY C4 AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY C5 AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY C6 AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY ************************************************** C1 LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP C2 LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP C3 LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP C4 LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP C5 LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP C6 LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP ************************************************** C1 GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM C2 GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM C3 GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM C4 GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM C5 GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM C6 GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM ************************************************** C1 SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL C2 SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL C3 SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL C4 SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL C5 SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL C6 SYRTIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL *** ********************************************** C1 LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV C2 LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV C3 LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV C4 LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV C5 LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV C6 LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV ************************************************** C1 LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY C2 LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY C3 LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY C4 LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY C5 LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY C6 LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY ********************************************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 99.75 C1 C6 99.75 TOP 5 0 99.75 C6 C1 99.75 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 99.75 C2 C6 99.75 TOP 5 1 99.75 C6 C2 99.75 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 99.75 C3 C6 99.75 TOP 5 2 99.75 C6 C3 99.75 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 99.75 C4 C6 99.75 TOP 5 3 99.75 C6 C4 99.75 BOT 4 5 99.75 C5 C6 99.75 TOP 5 4 99.75 C6 C5 99.75 AVG 0 C1 * 99.95 AVG 1 C2 * 99.95 AVG 2 C3 * 99.95 AVG 3 C4 * 99.95 AVG 4 C5 * 99.95 AVG 5 C6 * 99.75 TOT TOT * 99.92 CLUSTAL W (1.83) multiple sequence alignment C1 ATGTCGACATCCTCGACATCACTGCCGCCGCTAGTTGAGCCTGCGGGCCA C2 ATGTCGACATCCTCGACATCACTGCCGCCGCTAGTTGAGCCTGCGGGCCA C3 ATGTCGACATCCTCGACATCACTGCCGCCGCTAGTTGAGCCTGCGGGCCA C4 ATGTCGACATCCTCGACATCACTGCCGCCGCTAGTTGAGCCTGCGGGCCA C5 ATGTCGACATCCTCGACATCACTGCCGCCGCTAGTTGAGCCTGCGGGCCA C6 ATGTCGACATCCTCGACATCACTGCCGCCGCTAGTTGAGCCTGCGGGCCA ************************************************** C1 GCTGAGCCGCGATGAGGTGATTCGATACAGCCGCCATTTGATCATTCCGG C2 GCTGAGCCGCGATGAGGTGATTCGATACAGCCGCCATTTGATCATTCCGG C3 GCTGAGCCGCGATGAGGTGATTCGATACAGCCGCCATTTGATCATTCCGG C4 GCTGAGCCGCGATGAGGTGATTCGATACAGCCGCCATTTGATCATTCCGG C5 GCTGAGCCGCGATGAGGTGATTCGATACAGCCGCCATTTGATCATTCCGG C6 GCTGAGCCGCGATGAGGTGATTCGATACAGCCGCCATTTGATCATTCCGG ************************************************** C1 ACATAGGCGTCGATGGGCAGATGCGGCTCAAGAGCGCGCGGGTATTGGTC C2 ACATAGGCGTCGATGGGCAGATGCGGCTCAAGAGCGCGCGGGTATTGGTC C3 ACATAGGCGTCGATGGGCAGATGCGGCTCAAGAGCGCGCGGGTATTGGTC C4 ACATAGGCGTCGATGGGCAGATGCGGCTCAAGAGCGCGCGGGTATTGGTC C5 ACATAGGCGTCGATGGGCAGATGCGGCTCAAGAGCGCGCGGGTATTGGTC C6 ACATAGGCGTCGATGGGCAGATGCGGCTCAAGAGCGCGCGGGTATTGGTC ************************************************** C1 ATCGGTGCGGGCGGGCTGGGCGCGCCGGTATTGCTGTATCTGGCCGCGGC C2 ATCGGTGCGGGCGGGCTGGGCGCGCCGGTATTGCTGTATCTGGCCGCGGC C3 ATCGGTGCGGGCGGGCTGGGCGCGCCGGTATTGCTGTATCTGGCCGCGGC C4 ATCGGTGCGGGCGGGCTGGGCGCGCCGGTATTGCTGTATCTGGCCGCGGC C5 ATCGGTGCGGGCGGGCTGGGCGCGCCGGTATTGCTGTATCTGGCCGCGGC C6 ATCGGTGCGGGCGGGCTGGGCGCGCCGGTATTGCTGTATCTGGCCGCGGC ************************************************** C1 CGGCGTCGGTACGATCGGCATCATCGATTTCGACGTCGTCGACGAGTCGA C2 CGGCGTCGGTACGATCGGCATCATCGATTTCGACGTCGTCGACGAGTCGA C3 CGGCGTCGGTACGATCGGCATCATCGATTTCGACGTCGTCGACGAGTCGA C4 CGGCGTCGGTACGATCGGCATCATCGATTTCGACGTCGTCGACGAGTCGA C5 CGGCGTCGGTACGATCGGCATCATCGATTTCGACGTCGTCGACGAGTCGA C6 CGGCGTCGGTACGATCGGCATCATCGATTTCGACGTCGTCGACGAGTCGA ************************************************** C1 ACCTGCAACGCCAGATTATTCATGGCGTAGCCGATGTTGGACGGTCCAAG C2 ACCTGCAACGCCAGATTATTCATGGCGTAGCCGATGTTGGACGGTCCAAG C3 ACCTGCAACGCCAGATTATTCATGGCGTAGCCGATGTTGGACGGTCCAAG C4 ACCTGCAACGCCAGATTATTCATGGCGTAGCCGATGTTGGACGGTCCAAG C5 ACCTGCAACGCCAGATTATTCATGGCGTAGCCGATGTTGGACGGTCCAAG C6 ACCTGCAACGCCAGATTATTCATGGCGTAGCCGATGTTGGACGGTCCAAG ************************************************** C1 GCCCAGTCAGCGCGCGACTCGATTGTCGCAATCAACCCGCTCGTCCAGGT C2 GCCCAGTCAGCGCGCGACTCGATTGTCGCAATCAACCCGCTCGTCCAGGT C3 GCCCAGTCAGCGCGCGACTCGATTGTCGCAATCAACCCGCTCGTCCAGGT C4 GCCCAGTCAGCGCGCGACTCGATTGTCGCAATCAACCCGCTCGTCCAGGT C5 GCCCAGTCAGCGCGCGACTCGATTGTCGCAATCAACCCGCTCGTCCAGGT C6 GCCCAGTCAGCGCGCGACTCGATTGTCGCAATCAACCCGCTCGTCCAGGT ************************************************** C1 GCGATTGCACGAGTTCAGGCTGGAGTCGAGTAATGTGGTTAACCTGTTCA C2 GCGATTGCACGAGTTCAGGCTGGAGTCGAGTAATGTGGTTAACCTGTTCA C3 GCGATTGCACGAGTTCAGGCTGGAGTCGAGTAATGTGGTTAACCTGTTCA C4 GCGATTGCACGAGTTCAGGCTGGAGTCGAGTAATGTGGTTAACCTGTTCA C5 GCGATTGCACGAGTTCAGGCTGGAGTCGAGTAATGTGGTTAACCTGTTCA C6 GCGATTGCACGAGTTCAGGCTGGAGTCGAGTAATGTGGTTAACCTGTTCA ************************************************** C1 AGCAGTACGATCTGATCGTCGATGGCACCGACAACTTCGCGACTCGGTAT C2 AGCAGTACGATCTGATCGTCGATGGCACCGACAACTTCGCGACTCGGTAT C3 AGCAGTACGATCTGATCGTCGATGGCACCGACAACTTCGCGACTCGGTAT C4 AGCAGTACGATCTGATCGTCGATGGCACCGACAACTTCGCGACTCGGTAT C5 AGCAGTACGATCTGATCGTCGATGGCACCGACAACTTCGCGACTCGGTAT C6 AGCAGTACGATCTGATCGTCGATGGCACCGACAACTTCGCGACTCGGTAT ************************************************** C1 TTGATCAACGACGCCGCGGTGCTGGCTAAAAAGCCGTATGTGTGGGGGTC C2 TTGATCAACGACGCCGCGGTGCTGGCTAAAAAGCCGTATGTGTGGGGGTC C3 TTGATCAACGACGCCGCGGTGCTGGCTAAAAAGCCGTATGTGTGGGGGTC C4 TTGATCAACGACGCCGCGGTGCTGGCTAAAAAGCCGTATGTGTGGGGGTC C5 TTGATCAACGACGCCGCGGTGCTGGCTAAAAAGCCGTATGTGTGGGGGTC C6 TTGATCAACGACGCCGCGGTGCTGGCTAAAAAGCCGTATGTGTGGGGGTC ************************************************** C1 GCTCTACCGCTTCGAAGGCCAGGTCTCAGTGTTTTGGGAGGATGCCCCCG C2 GCTCTACCGCTTCGAAGGCCAGGTCTCAGTGTTTTGGGAGGATGCCCCCG C3 GCTCTACCGCTTCGAAGGCCAGGTCTCAGTGTTTTGGGAGGATGCCCCCG C4 GCTCTACCGCTTCGAAGGCCAGGTCTCAGTGTTTTGGGAGGATGCCCCCG C5 GCTCTACCGCTTCGAAGGCCAGGTCTCAGTGTTTTGGGAGGATGCCCCCG C6 GCTCTACCGCTTCGAAGGCCAGGTCTCAGTGTTTTGGGAGGATGCCCCCG ************************************************** C1 ACGGGCTGGGCCTGAACTACCGCGATCTGTACCTGGAGCCACCGCCCCCT C2 ACGGGCTGGGCCTGAACTACCGCGATCTGTACCTGGAGCCACCGCCCCCT C3 ACGGGCTGGGCCTGAACTACCGCGATCTGTACCTGGAGCCACCGCCCCCT C4 ACGGGCTGGGCCTGAACTACCGCGATCTGTACCTGGAGCCACCGCCCCCT C5 ACGGGCTGGGCCTGAACTACCGCGATCTGTACCTGGAGCCACCGCCCCCT C6 ACGGGCTGGGCCTGAACTACCGCGATCTGTACCTGGAGCCACCGCCCCCT ************************************************** C1 GGCATGGTGCCATCCTGCGCAGAAGGCGGCGTGCTGGGCATCGTCTGTGC C2 GGCATGGTGCCATCCTGCGCAGAAGGCGGCGTGCTGGGCATCGTCTGTGC C3 GGCATGGTGCCATCCTGCGCAGAAGGCGGCGTGCTGGGCATCGTCTGTGC C4 GGCATGGTGCCATCCTGCGCAGAAGGCGGCGTGCTGGGCATCGTCTGTGC C5 GGCATGGTGCCATCCTGCGCAGAAGGCGGCGTGCTGGGCATCGTCTGTGC C6 GGCATGGTGCCATCCTGCGCAGAAGGCGGCGTGCTGGGCATCGTCTGTGC ************************************************** C1 CTCTATCGCGTCGGTGATGGGCACCGAGGCGATCAAACTGATCACCGGGA C2 CTCTATCGCGTCGGTGATGGGCACCGAGGCGATCAAACTGATCACCGGGA C3 CTCTATCGCGTCGGTGATGGGCACCGAGGCGATCAAACTGATCACCGGGA C4 CTCTATCGCGTCGGTGATGGGCACCGAGGCGATCAAACTGATCACCGGGA C5 CTCTATCGCGTCGGTGATGGGCACCGAGGCGATCAAACTGATCACCGGGA C6 CTCTATCGCGTCGGTGATGGGCACCGAGGCGATCAAACTGATCACCGGGA ************************************************** C1 TTGGTGCGCCGCTGCTCGGCCGGTTGATGATCTACAACGCGTTGGAGATG C2 TTGGTGCGCCGCTGCTCGGCCGGTTGATGATCTACAACGCGTTGGAGATG C3 TTGGTGCGCCGCTGCTCGGCCGGTTGATGATCTACAACGCGTTGGAGATG C4 TTGGTGCGCCGCTGCTCGGCCGGTTGATGATCTACAACGCGTTGGAGATG C5 TTGGTGCGCCGCTGCTCGGCCGGTTGATGATCTACAACGCGTTGGAGATG C6 TTGGTGCGCCGCTGCTCGGCCGGTTGATGATCTACAACGCGTTGGAGATG ************************************************** C1 AGCTACCGTAGGATCAGGATCCACAAGGACCCGTCCAGACCGAAAATCAC C2 AGCTACCGTAGGATCAGGATCCACAAGGACCCGTCCAGACCGAAAATCAC C3 AGCTACCGTAGGATCAGGATCCACAAGGACCCGTCCAGACCGAAAATCAC C4 AGCTACCGTAGGATCAGGATCCACAAGGACCCGTCCAGACCGAAAATCAC C5 AGCTACCGTAGGATCAGGATCCACAAGGACCCGTCCAGACCGAAAATCAC C6 AGCTACCGTACGATCAGGATCCACAAGGACCCGTCCAGACCGAAAATCAC ********** *************************************** C1 GGAGCTTACAGATTATCAGCAATTTTGCGGTGTGGTGTCTGACGATGCGG C2 GGAGCTTACAGATTATCAGCAATTTTGCGGTGTGGTGTCTGACGATGCGG C3 GGAGCTTACAGATTATCAGCAATTTTGCGGTGTGGTGTCTGACGATGCGG C4 GGAGCTTACAGATTATCAGCAATTTTGCGGTGTGGTGTCTGACGATGCGG C5 GGAGCTTACAGATTATCAGCAATTTTGCGGTGTGGTGTCTGACGATGCGG C6 GGAGCTTACAGATTATCAGCAATTTTGCGGTGTGGTGTCTGACGATGCGG ************************************************** C1 CCCAGGTGGCTACCGGCTCCATCGTTACGCCGCGGGAATTGCGCGAGTTG C2 CCCAGGTGGCTACCGGCTCCATCGTTACGCCGCGGGAATTGCGCGAGTTG C3 CCCAGGTGGCTACCGGCTCCATCGTTACGCCGCGGGAATTGCGCGAGTTG C4 CCCAGGTGGCTACCGGCTCCATCGTTACGCCGCGGGAATTGCGCGAGTTG C5 CCCAGGTGGCTACCGGCTCCATCGTTACGCCGCGGGAATTGCGCGAGTTG C6 CCCAGGTGGCTACCGGCTCCATCGTTACGCCGCGGGAATTGCGCGAGTTG ************************************************** C1 CTGGATTCCGGCAAGAAGCTGGCCTTGATAGATGTTCGTGAACCCGTCGA C2 CTGGATTCCGGCAAGAAGCTGGCCTTGATAGATGTTCGTGAACCCGTCGA C3 CTGGATTCCGGCAAGAAGCTGGCCTTGATAGATGTTCGTGAACCCGTCGA C4 CTGGATTCCGGCAAGAAGCTGGCCTTGATAGATGTTCGTGAACCCGTCGA C5 CTGGATTCCGGCAAGAAGCTGGCCTTGATAGATGTTCGTGAACCCGTCGA C6 CTGGATTCCGGCAAGAAGCTGGCCTTGATAGATGTTCGTGAACCCGTCGA ************************************************** C1 GTGGGACATCGTGCACATCGACGGCGCTCAGCTGATCCCGCGATCGTTGA C2 GTGGGACATCGTGCACATCGACGGCGCTCAGCTGATCCCGCGATCGTTGA C3 GTGGGACATCGTGCACATCGACGGCGCTCAGCTGATCCCGCGATCGTTGA C4 GTGGGACATCGTGCACATCGACGGCGCTCAGCTGATCCCGCGATCGTTGA C5 GTGGGACATCGTGCACATCGACGGCGCTCAGCTGATCCCGCGATCGTTGA C6 GTGGGACATCGTGCACATCGACGGCGCTCAGCTGATCCCGCGATCGTTGA ************************************************** C1 TCAACTCGGGTGAGGGTCTGGCAAAGCTGCCTCAGGACCGCATGTCGGTG C2 TCAACTCGGGTGAGGGTCTGGCAAAGCTGCCTCAGGACCGCATGTCGGTG C3 TCAACTCGGGTGAGGGTCTGGCAAAGCTGCCTCAGGACCGCATGTCGGTG C4 TCAACTCGGGTGAGGGTCTGGCAAAGCTGCCTCAGGACCGCATGTCGGTG C5 TCAACTCGGGTGAGGGTCTGGCAAAGCTGCCTCAGGACCGCATGTCGGTG C6 TCAACTCGGGTGAGGGTCTGGCAAAGCTGCCTCAGGACCGCATGTCGGTG ************************************************** C1 CTGTATTGCAAGACGGGCGTGCGCTCGGCCGAGACGTTGGCCACTGTGAA C2 CTGTATTGCAAGACGGGCGTGCGCTCGGCCGAGACGTTGGCCACTGTGAA C3 CTGTATTGCAAGACGGGCGTGCGCTCGGCCGAGACGTTGGCCACTGTGAA C4 CTGTATTGCAAGACGGGCGTGCGCTCGGCCGAGACGTTGGCCACTGTGAA C5 CTGTATTGCAAGACGGGCGTGCGCTCGGCCGAGACGTTGGCCACTGTGAA C6 CTGTATTGCAAGACGGGCGTGCGCTCGGCCGAGACGTTGGCCACTGTGAA ************************************************** C1 AAAGGCTGGTTTCTCCGACGCGGTGCACTTGCAGGGTGGAATTGTGGCAT C2 AAAGGCTGGTTTCTCCGACGCGGTGCACTTGCAGGGTGGAATTGTGGCAT C3 AAAGGCTGGTTTCTCCGACGCGGTGCACTTGCAGGGTGGAATTGTGGCAT C4 AAAGGCTGGTTTCTCCGACGCGGTGCACTTGCAGGGTGGAATTGTGGCAT C5 AAAGGCTGGTTTCTCCGACGCGGTGCACTTGCAGGGTGGAATTGTGGCAT C6 AAAGGCTGGTTTCTCCGACGCGGTGCACTTGCAGGGTGGAATTGTGGCAT ************************************************** C1 GGGCCAAGCAGGTGCAACCCGACATGGTGATCTAC C2 GGGCCAAGCAGGTGCAACCCGACATGGTGATCTAC C3 GGGCCAAGCAGGTGCAACCCGACATGGTGATCTAC C4 GGGCCAAGCAGGTGCAACCCGACATGGTGATCTAC C5 GGGCCAAGCAGGTGCAACCCGACATGGTGATCTAC C6 GGGCCAAGCAGGTGCAACCCGACATGGTGATCTAC *********************************** >C1 ATGTCGACATCCTCGACATCACTGCCGCCGCTAGTTGAGCCTGCGGGCCA GCTGAGCCGCGATGAGGTGATTCGATACAGCCGCCATTTGATCATTCCGG ACATAGGCGTCGATGGGCAGATGCGGCTCAAGAGCGCGCGGGTATTGGTC ATCGGTGCGGGCGGGCTGGGCGCGCCGGTATTGCTGTATCTGGCCGCGGC CGGCGTCGGTACGATCGGCATCATCGATTTCGACGTCGTCGACGAGTCGA ACCTGCAACGCCAGATTATTCATGGCGTAGCCGATGTTGGACGGTCCAAG GCCCAGTCAGCGCGCGACTCGATTGTCGCAATCAACCCGCTCGTCCAGGT GCGATTGCACGAGTTCAGGCTGGAGTCGAGTAATGTGGTTAACCTGTTCA AGCAGTACGATCTGATCGTCGATGGCACCGACAACTTCGCGACTCGGTAT TTGATCAACGACGCCGCGGTGCTGGCTAAAAAGCCGTATGTGTGGGGGTC GCTCTACCGCTTCGAAGGCCAGGTCTCAGTGTTTTGGGAGGATGCCCCCG ACGGGCTGGGCCTGAACTACCGCGATCTGTACCTGGAGCCACCGCCCCCT GGCATGGTGCCATCCTGCGCAGAAGGCGGCGTGCTGGGCATCGTCTGTGC CTCTATCGCGTCGGTGATGGGCACCGAGGCGATCAAACTGATCACCGGGA TTGGTGCGCCGCTGCTCGGCCGGTTGATGATCTACAACGCGTTGGAGATG AGCTACCGTAGGATCAGGATCCACAAGGACCCGTCCAGACCGAAAATCAC GGAGCTTACAGATTATCAGCAATTTTGCGGTGTGGTGTCTGACGATGCGG CCCAGGTGGCTACCGGCTCCATCGTTACGCCGCGGGAATTGCGCGAGTTG CTGGATTCCGGCAAGAAGCTGGCCTTGATAGATGTTCGTGAACCCGTCGA GTGGGACATCGTGCACATCGACGGCGCTCAGCTGATCCCGCGATCGTTGA TCAACTCGGGTGAGGGTCTGGCAAAGCTGCCTCAGGACCGCATGTCGGTG CTGTATTGCAAGACGGGCGTGCGCTCGGCCGAGACGTTGGCCACTGTGAA AAAGGCTGGTTTCTCCGACGCGGTGCACTTGCAGGGTGGAATTGTGGCAT GGGCCAAGCAGGTGCAACCCGACATGGTGATCTAC >C2 ATGTCGACATCCTCGACATCACTGCCGCCGCTAGTTGAGCCTGCGGGCCA GCTGAGCCGCGATGAGGTGATTCGATACAGCCGCCATTTGATCATTCCGG ACATAGGCGTCGATGGGCAGATGCGGCTCAAGAGCGCGCGGGTATTGGTC ATCGGTGCGGGCGGGCTGGGCGCGCCGGTATTGCTGTATCTGGCCGCGGC CGGCGTCGGTACGATCGGCATCATCGATTTCGACGTCGTCGACGAGTCGA ACCTGCAACGCCAGATTATTCATGGCGTAGCCGATGTTGGACGGTCCAAG GCCCAGTCAGCGCGCGACTCGATTGTCGCAATCAACCCGCTCGTCCAGGT GCGATTGCACGAGTTCAGGCTGGAGTCGAGTAATGTGGTTAACCTGTTCA AGCAGTACGATCTGATCGTCGATGGCACCGACAACTTCGCGACTCGGTAT TTGATCAACGACGCCGCGGTGCTGGCTAAAAAGCCGTATGTGTGGGGGTC GCTCTACCGCTTCGAAGGCCAGGTCTCAGTGTTTTGGGAGGATGCCCCCG ACGGGCTGGGCCTGAACTACCGCGATCTGTACCTGGAGCCACCGCCCCCT GGCATGGTGCCATCCTGCGCAGAAGGCGGCGTGCTGGGCATCGTCTGTGC CTCTATCGCGTCGGTGATGGGCACCGAGGCGATCAAACTGATCACCGGGA TTGGTGCGCCGCTGCTCGGCCGGTTGATGATCTACAACGCGTTGGAGATG AGCTACCGTAGGATCAGGATCCACAAGGACCCGTCCAGACCGAAAATCAC GGAGCTTACAGATTATCAGCAATTTTGCGGTGTGGTGTCTGACGATGCGG CCCAGGTGGCTACCGGCTCCATCGTTACGCCGCGGGAATTGCGCGAGTTG CTGGATTCCGGCAAGAAGCTGGCCTTGATAGATGTTCGTGAACCCGTCGA GTGGGACATCGTGCACATCGACGGCGCTCAGCTGATCCCGCGATCGTTGA TCAACTCGGGTGAGGGTCTGGCAAAGCTGCCTCAGGACCGCATGTCGGTG CTGTATTGCAAGACGGGCGTGCGCTCGGCCGAGACGTTGGCCACTGTGAA AAAGGCTGGTTTCTCCGACGCGGTGCACTTGCAGGGTGGAATTGTGGCAT GGGCCAAGCAGGTGCAACCCGACATGGTGATCTAC >C3 ATGTCGACATCCTCGACATCACTGCCGCCGCTAGTTGAGCCTGCGGGCCA GCTGAGCCGCGATGAGGTGATTCGATACAGCCGCCATTTGATCATTCCGG ACATAGGCGTCGATGGGCAGATGCGGCTCAAGAGCGCGCGGGTATTGGTC ATCGGTGCGGGCGGGCTGGGCGCGCCGGTATTGCTGTATCTGGCCGCGGC CGGCGTCGGTACGATCGGCATCATCGATTTCGACGTCGTCGACGAGTCGA ACCTGCAACGCCAGATTATTCATGGCGTAGCCGATGTTGGACGGTCCAAG GCCCAGTCAGCGCGCGACTCGATTGTCGCAATCAACCCGCTCGTCCAGGT GCGATTGCACGAGTTCAGGCTGGAGTCGAGTAATGTGGTTAACCTGTTCA AGCAGTACGATCTGATCGTCGATGGCACCGACAACTTCGCGACTCGGTAT TTGATCAACGACGCCGCGGTGCTGGCTAAAAAGCCGTATGTGTGGGGGTC GCTCTACCGCTTCGAAGGCCAGGTCTCAGTGTTTTGGGAGGATGCCCCCG ACGGGCTGGGCCTGAACTACCGCGATCTGTACCTGGAGCCACCGCCCCCT GGCATGGTGCCATCCTGCGCAGAAGGCGGCGTGCTGGGCATCGTCTGTGC CTCTATCGCGTCGGTGATGGGCACCGAGGCGATCAAACTGATCACCGGGA TTGGTGCGCCGCTGCTCGGCCGGTTGATGATCTACAACGCGTTGGAGATG AGCTACCGTAGGATCAGGATCCACAAGGACCCGTCCAGACCGAAAATCAC GGAGCTTACAGATTATCAGCAATTTTGCGGTGTGGTGTCTGACGATGCGG CCCAGGTGGCTACCGGCTCCATCGTTACGCCGCGGGAATTGCGCGAGTTG CTGGATTCCGGCAAGAAGCTGGCCTTGATAGATGTTCGTGAACCCGTCGA GTGGGACATCGTGCACATCGACGGCGCTCAGCTGATCCCGCGATCGTTGA TCAACTCGGGTGAGGGTCTGGCAAAGCTGCCTCAGGACCGCATGTCGGTG CTGTATTGCAAGACGGGCGTGCGCTCGGCCGAGACGTTGGCCACTGTGAA AAAGGCTGGTTTCTCCGACGCGGTGCACTTGCAGGGTGGAATTGTGGCAT GGGCCAAGCAGGTGCAACCCGACATGGTGATCTAC >C4 ATGTCGACATCCTCGACATCACTGCCGCCGCTAGTTGAGCCTGCGGGCCA GCTGAGCCGCGATGAGGTGATTCGATACAGCCGCCATTTGATCATTCCGG ACATAGGCGTCGATGGGCAGATGCGGCTCAAGAGCGCGCGGGTATTGGTC ATCGGTGCGGGCGGGCTGGGCGCGCCGGTATTGCTGTATCTGGCCGCGGC CGGCGTCGGTACGATCGGCATCATCGATTTCGACGTCGTCGACGAGTCGA ACCTGCAACGCCAGATTATTCATGGCGTAGCCGATGTTGGACGGTCCAAG GCCCAGTCAGCGCGCGACTCGATTGTCGCAATCAACCCGCTCGTCCAGGT GCGATTGCACGAGTTCAGGCTGGAGTCGAGTAATGTGGTTAACCTGTTCA AGCAGTACGATCTGATCGTCGATGGCACCGACAACTTCGCGACTCGGTAT TTGATCAACGACGCCGCGGTGCTGGCTAAAAAGCCGTATGTGTGGGGGTC GCTCTACCGCTTCGAAGGCCAGGTCTCAGTGTTTTGGGAGGATGCCCCCG ACGGGCTGGGCCTGAACTACCGCGATCTGTACCTGGAGCCACCGCCCCCT GGCATGGTGCCATCCTGCGCAGAAGGCGGCGTGCTGGGCATCGTCTGTGC CTCTATCGCGTCGGTGATGGGCACCGAGGCGATCAAACTGATCACCGGGA TTGGTGCGCCGCTGCTCGGCCGGTTGATGATCTACAACGCGTTGGAGATG AGCTACCGTAGGATCAGGATCCACAAGGACCCGTCCAGACCGAAAATCAC GGAGCTTACAGATTATCAGCAATTTTGCGGTGTGGTGTCTGACGATGCGG CCCAGGTGGCTACCGGCTCCATCGTTACGCCGCGGGAATTGCGCGAGTTG CTGGATTCCGGCAAGAAGCTGGCCTTGATAGATGTTCGTGAACCCGTCGA GTGGGACATCGTGCACATCGACGGCGCTCAGCTGATCCCGCGATCGTTGA TCAACTCGGGTGAGGGTCTGGCAAAGCTGCCTCAGGACCGCATGTCGGTG CTGTATTGCAAGACGGGCGTGCGCTCGGCCGAGACGTTGGCCACTGTGAA AAAGGCTGGTTTCTCCGACGCGGTGCACTTGCAGGGTGGAATTGTGGCAT GGGCCAAGCAGGTGCAACCCGACATGGTGATCTAC >C5 ATGTCGACATCCTCGACATCACTGCCGCCGCTAGTTGAGCCTGCGGGCCA GCTGAGCCGCGATGAGGTGATTCGATACAGCCGCCATTTGATCATTCCGG ACATAGGCGTCGATGGGCAGATGCGGCTCAAGAGCGCGCGGGTATTGGTC ATCGGTGCGGGCGGGCTGGGCGCGCCGGTATTGCTGTATCTGGCCGCGGC CGGCGTCGGTACGATCGGCATCATCGATTTCGACGTCGTCGACGAGTCGA ACCTGCAACGCCAGATTATTCATGGCGTAGCCGATGTTGGACGGTCCAAG GCCCAGTCAGCGCGCGACTCGATTGTCGCAATCAACCCGCTCGTCCAGGT GCGATTGCACGAGTTCAGGCTGGAGTCGAGTAATGTGGTTAACCTGTTCA AGCAGTACGATCTGATCGTCGATGGCACCGACAACTTCGCGACTCGGTAT TTGATCAACGACGCCGCGGTGCTGGCTAAAAAGCCGTATGTGTGGGGGTC GCTCTACCGCTTCGAAGGCCAGGTCTCAGTGTTTTGGGAGGATGCCCCCG ACGGGCTGGGCCTGAACTACCGCGATCTGTACCTGGAGCCACCGCCCCCT GGCATGGTGCCATCCTGCGCAGAAGGCGGCGTGCTGGGCATCGTCTGTGC CTCTATCGCGTCGGTGATGGGCACCGAGGCGATCAAACTGATCACCGGGA TTGGTGCGCCGCTGCTCGGCCGGTTGATGATCTACAACGCGTTGGAGATG AGCTACCGTAGGATCAGGATCCACAAGGACCCGTCCAGACCGAAAATCAC GGAGCTTACAGATTATCAGCAATTTTGCGGTGTGGTGTCTGACGATGCGG CCCAGGTGGCTACCGGCTCCATCGTTACGCCGCGGGAATTGCGCGAGTTG CTGGATTCCGGCAAGAAGCTGGCCTTGATAGATGTTCGTGAACCCGTCGA GTGGGACATCGTGCACATCGACGGCGCTCAGCTGATCCCGCGATCGTTGA TCAACTCGGGTGAGGGTCTGGCAAAGCTGCCTCAGGACCGCATGTCGGTG CTGTATTGCAAGACGGGCGTGCGCTCGGCCGAGACGTTGGCCACTGTGAA AAAGGCTGGTTTCTCCGACGCGGTGCACTTGCAGGGTGGAATTGTGGCAT GGGCCAAGCAGGTGCAACCCGACATGGTGATCTAC >C6 ATGTCGACATCCTCGACATCACTGCCGCCGCTAGTTGAGCCTGCGGGCCA GCTGAGCCGCGATGAGGTGATTCGATACAGCCGCCATTTGATCATTCCGG ACATAGGCGTCGATGGGCAGATGCGGCTCAAGAGCGCGCGGGTATTGGTC ATCGGTGCGGGCGGGCTGGGCGCGCCGGTATTGCTGTATCTGGCCGCGGC CGGCGTCGGTACGATCGGCATCATCGATTTCGACGTCGTCGACGAGTCGA ACCTGCAACGCCAGATTATTCATGGCGTAGCCGATGTTGGACGGTCCAAG GCCCAGTCAGCGCGCGACTCGATTGTCGCAATCAACCCGCTCGTCCAGGT GCGATTGCACGAGTTCAGGCTGGAGTCGAGTAATGTGGTTAACCTGTTCA AGCAGTACGATCTGATCGTCGATGGCACCGACAACTTCGCGACTCGGTAT TTGATCAACGACGCCGCGGTGCTGGCTAAAAAGCCGTATGTGTGGGGGTC GCTCTACCGCTTCGAAGGCCAGGTCTCAGTGTTTTGGGAGGATGCCCCCG ACGGGCTGGGCCTGAACTACCGCGATCTGTACCTGGAGCCACCGCCCCCT GGCATGGTGCCATCCTGCGCAGAAGGCGGCGTGCTGGGCATCGTCTGTGC CTCTATCGCGTCGGTGATGGGCACCGAGGCGATCAAACTGATCACCGGGA TTGGTGCGCCGCTGCTCGGCCGGTTGATGATCTACAACGCGTTGGAGATG AGCTACCGTACGATCAGGATCCACAAGGACCCGTCCAGACCGAAAATCAC GGAGCTTACAGATTATCAGCAATTTTGCGGTGTGGTGTCTGACGATGCGG CCCAGGTGGCTACCGGCTCCATCGTTACGCCGCGGGAATTGCGCGAGTTG CTGGATTCCGGCAAGAAGCTGGCCTTGATAGATGTTCGTGAACCCGTCGA GTGGGACATCGTGCACATCGACGGCGCTCAGCTGATCCCGCGATCGTTGA TCAACTCGGGTGAGGGTCTGGCAAAGCTGCCTCAGGACCGCATGTCGGTG CTGTATTGCAAGACGGGCGTGCGCTCGGCCGAGACGTTGGCCACTGTGAA AAAGGCTGGTTTCTCCGACGCGGTGCACTTGCAGGGTGGAATTGTGGCAT GGGCCAAGCAGGTGCAACCCGACATGGTGATCTAC >C1 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY >C2 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY >C3 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY >C4 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY >C5 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM SYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY >C6 MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLV IGAGGLGAPVLLYLAAAGVGTIGIIDFDVVDESNLQRQIIHGVADVGRSK AQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRY LINDAAVLAKKPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPP GMVPSCAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLGRLMIYNALEM SYRTIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELREL LDSGKKLALIDVREPVEWDIVHIDGAQLIPRSLINSGEGLAKLPQDRMSV LYCKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/10res/moeZ/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1185 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579783174 Setting output file names to "/data/10res/moeZ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1817959372 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9411331108 Seed = 378418686 Swapseed = 1579783174 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 5 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2655.489667 -- -24.965149 Chain 2 -- -2655.487965 -- -24.965149 Chain 3 -- -2655.489198 -- -24.965149 Chain 4 -- -2655.487965 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2655.488118 -- -24.965149 Chain 2 -- -2655.489514 -- -24.965149 Chain 3 -- -2655.489668 -- -24.965149 Chain 4 -- -2655.489667 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2655.490] (-2655.488) (-2655.489) (-2655.488) * [-2655.488] (-2655.490) (-2655.490) (-2655.490) 500 -- (-1645.250) (-1645.928) [-1634.201] (-1632.619) * (-1648.002) (-1652.260) (-1641.362) [-1636.739] -- 0:00:00 1000 -- (-1639.238) (-1641.026) [-1634.192] (-1633.568) * (-1638.320) (-1652.753) [-1632.206] (-1648.325) -- 0:00:00 1500 -- (-1633.277) (-1639.482) [-1631.681] (-1635.087) * (-1631.032) (-1636.612) [-1632.798] (-1639.040) -- 0:00:00 2000 -- [-1631.241] (-1635.959) (-1638.284) (-1634.837) * (-1634.807) [-1637.380] (-1638.707) (-1633.958) -- 0:00:00 2500 -- [-1636.096] (-1633.150) (-1631.330) (-1635.560) * [-1629.122] (-1635.740) (-1636.494) (-1639.504) -- 0:00:00 3000 -- (-1646.487) (-1633.719) (-1633.884) [-1629.702] * (-1632.288) (-1637.969) (-1641.377) [-1636.730] -- 0:00:00 3500 -- (-1642.857) (-1638.837) (-1639.613) [-1630.879] * (-1638.523) (-1637.351) [-1637.342] (-1632.050) -- 0:00:00 4000 -- [-1637.159] (-1638.893) (-1636.922) (-1631.575) * (-1639.904) [-1639.806] (-1645.664) (-1637.225) -- 0:00:00 4500 -- (-1631.478) [-1634.210] (-1633.542) (-1636.944) * (-1629.705) (-1633.681) (-1635.652) [-1639.968] -- 0:00:00 5000 -- (-1634.135) (-1635.068) [-1637.060] (-1634.876) * [-1637.609] (-1632.398) (-1637.863) (-1640.098) -- 0:00:00 Average standard deviation of split frequencies: 0.071425 5500 -- (-1633.923) (-1643.415) [-1636.165] (-1633.623) * (-1633.428) (-1639.618) [-1633.216] (-1635.737) -- 0:00:00 6000 -- (-1635.159) [-1638.869] (-1631.770) (-1628.120) * (-1630.808) (-1638.538) (-1645.729) [-1638.277] -- 0:00:00 6500 -- (-1637.912) (-1632.424) (-1631.830) [-1632.537] * [-1633.521] (-1637.740) (-1639.267) (-1639.142) -- 0:02:32 7000 -- (-1648.526) (-1637.745) [-1637.689] (-1631.454) * (-1641.935) (-1632.765) (-1637.809) [-1634.185] -- 0:02:21 7500 -- [-1634.474] (-1631.148) (-1637.368) (-1630.537) * (-1633.812) (-1640.388) [-1638.684] (-1632.233) -- 0:02:12 8000 -- (-1634.530) (-1640.470) (-1633.193) [-1640.009] * [-1632.537] (-1641.698) (-1640.338) (-1636.272) -- 0:02:04 8500 -- (-1633.265) (-1645.550) [-1633.017] (-1634.599) * (-1641.258) [-1633.147] (-1637.792) (-1633.598) -- 0:01:56 9000 -- (-1642.171) (-1634.292) [-1635.141] (-1637.070) * (-1641.069) [-1634.102] (-1635.972) (-1643.368) -- 0:01:50 9500 -- [-1630.852] (-1634.678) (-1642.057) (-1633.665) * (-1635.137) [-1633.606] (-1634.478) (-1633.029) -- 0:01:44 10000 -- (-1639.707) (-1633.594) (-1641.491) [-1634.167] * [-1634.569] (-1635.285) (-1638.015) (-1634.344) -- 0:01:39 Average standard deviation of split frequencies: 0.064082 10500 -- (-1638.625) [-1638.315] (-1633.583) (-1641.696) * (-1632.247) (-1638.902) (-1640.513) [-1634.834] -- 0:01:34 11000 -- (-1633.577) (-1633.982) [-1630.281] (-1639.705) * (-1635.844) [-1635.866] (-1632.079) (-1633.550) -- 0:01:29 11500 -- [-1632.516] (-1642.475) (-1640.008) (-1642.476) * (-1641.309) [-1632.019] (-1635.198) (-1635.058) -- 0:01:25 12000 -- (-1636.567) (-1644.397) (-1637.067) [-1633.458] * (-1638.303) (-1645.650) (-1635.773) [-1632.983] -- 0:01:22 12500 -- [-1639.603] (-1639.703) (-1632.362) (-1634.184) * [-1633.238] (-1634.424) (-1633.990) (-1637.815) -- 0:01:19 13000 -- (-1647.895) [-1645.805] (-1638.550) (-1629.797) * (-1642.317) (-1642.816) (-1639.510) [-1635.581] -- 0:01:15 13500 -- (-1635.271) (-1640.319) [-1633.092] (-1635.721) * (-1635.783) (-1636.777) [-1634.821] (-1630.579) -- 0:01:13 14000 -- (-1637.041) [-1630.793] (-1630.783) (-1628.723) * (-1636.816) (-1641.582) (-1635.859) [-1636.703] -- 0:01:10 14500 -- (-1631.183) (-1636.652) (-1633.455) [-1635.221] * (-1635.583) [-1634.195] (-1640.359) (-1632.487) -- 0:01:07 15000 -- (-1636.754) (-1635.535) [-1636.859] (-1636.608) * (-1637.397) (-1635.570) (-1637.335) [-1632.334] -- 0:01:05 Average standard deviation of split frequencies: 0.052378 15500 -- (-1639.388) (-1636.412) [-1640.864] (-1632.487) * (-1635.252) [-1633.914] (-1634.102) (-1633.426) -- 0:01:03 16000 -- (-1636.719) [-1633.362] (-1628.857) (-1632.863) * (-1636.562) (-1636.999) [-1629.821] (-1634.618) -- 0:01:01 16500 -- (-1629.999) (-1643.066) (-1637.864) [-1639.418] * (-1633.821) (-1632.632) (-1633.654) [-1635.091] -- 0:00:59 17000 -- (-1640.672) (-1636.921) [-1640.118] (-1634.620) * (-1635.544) (-1634.895) [-1634.414] (-1635.249) -- 0:00:57 17500 -- [-1634.400] (-1631.551) (-1636.669) (-1635.196) * [-1635.561] (-1645.260) (-1635.938) (-1636.137) -- 0:00:56 18000 -- [-1634.296] (-1637.464) (-1633.411) (-1634.692) * [-1632.679] (-1631.395) (-1633.779) (-1636.702) -- 0:00:54 18500 -- (-1634.993) (-1638.265) [-1634.482] (-1638.845) * (-1640.675) [-1635.402] (-1637.643) (-1640.367) -- 0:00:53 19000 -- (-1637.525) (-1633.975) [-1631.514] (-1633.446) * [-1630.446] (-1647.095) (-1643.532) (-1640.709) -- 0:00:51 19500 -- (-1636.185) (-1635.937) [-1630.844] (-1640.994) * (-1632.301) [-1635.953] (-1639.255) (-1637.224) -- 0:00:50 20000 -- [-1632.187] (-1632.290) (-1634.197) (-1630.921) * (-1635.077) (-1642.617) (-1640.997) [-1628.070] -- 0:00:49 Average standard deviation of split frequencies: 0.042769 20500 -- (-1634.637) [-1633.184] (-1629.867) (-1631.255) * (-1650.661) [-1630.499] (-1636.675) (-1635.992) -- 0:00:47 21000 -- (-1640.297) (-1635.654) (-1634.976) [-1632.934] * [-1632.897] (-1638.623) (-1639.960) (-1631.521) -- 0:01:33 21500 -- [-1631.602] (-1633.223) (-1634.865) (-1640.571) * (-1636.310) (-1635.861) (-1635.639) [-1639.485] -- 0:01:31 22000 -- [-1638.975] (-1632.348) (-1633.666) (-1639.671) * (-1636.758) [-1631.604] (-1636.333) (-1633.135) -- 0:01:28 22500 -- [-1633.293] (-1636.749) (-1631.279) (-1631.395) * (-1640.312) [-1638.552] (-1632.854) (-1635.693) -- 0:01:26 23000 -- (-1635.165) (-1643.132) [-1634.696] (-1642.230) * [-1633.135] (-1638.958) (-1632.250) (-1634.723) -- 0:01:24 23500 -- (-1644.557) [-1631.081] (-1638.206) (-1632.241) * (-1637.611) (-1642.852) (-1639.960) [-1634.764] -- 0:01:23 24000 -- (-1635.566) [-1634.032] (-1629.180) (-1631.674) * (-1643.477) (-1638.043) [-1634.311] (-1633.618) -- 0:01:21 24500 -- (-1633.357) [-1634.410] (-1639.144) (-1636.616) * (-1631.173) [-1636.899] (-1633.377) (-1639.155) -- 0:01:19 25000 -- (-1633.617) (-1631.956) [-1636.345] (-1637.767) * (-1634.596) (-1632.622) (-1637.834) [-1646.088] -- 0:01:18 Average standard deviation of split frequencies: 0.040383 25500 -- (-1634.910) (-1640.214) (-1642.862) [-1628.744] * (-1635.627) (-1643.536) (-1636.872) [-1629.726] -- 0:01:16 26000 -- (-1631.505) (-1636.949) (-1628.503) [-1633.449] * [-1634.497] (-1632.083) (-1634.407) (-1630.637) -- 0:01:14 26500 -- (-1632.419) (-1642.340) [-1636.293] (-1634.280) * (-1637.878) (-1630.258) [-1632.887] (-1629.419) -- 0:01:13 27000 -- (-1634.304) [-1634.882] (-1635.197) (-1642.082) * (-1640.868) [-1633.981] (-1636.994) (-1632.553) -- 0:01:12 27500 -- (-1633.734) [-1629.961] (-1635.102) (-1633.856) * [-1631.945] (-1638.670) (-1632.902) (-1635.769) -- 0:01:10 28000 -- (-1631.146) [-1635.872] (-1638.066) (-1633.869) * (-1637.626) [-1634.245] (-1641.396) (-1630.467) -- 0:01:09 28500 -- (-1630.920) [-1639.622] (-1631.201) (-1635.627) * [-1633.379] (-1634.243) (-1637.746) (-1635.485) -- 0:01:08 29000 -- (-1631.466) (-1643.445) [-1638.551] (-1634.259) * [-1633.703] (-1635.024) (-1643.755) (-1636.514) -- 0:01:06 29500 -- (-1632.511) (-1632.648) (-1634.016) [-1636.844] * (-1638.298) (-1631.513) [-1635.124] (-1630.525) -- 0:01:05 30000 -- (-1633.724) (-1629.068) (-1631.478) [-1634.064] * [-1636.392] (-1633.807) (-1638.849) (-1632.584) -- 0:01:04 Average standard deviation of split frequencies: 0.038064 30500 -- (-1632.377) (-1634.778) (-1637.920) [-1639.050] * (-1637.726) [-1639.278] (-1642.216) (-1633.208) -- 0:01:03 31000 -- (-1631.394) (-1630.331) (-1631.649) [-1634.621] * (-1640.090) [-1641.552] (-1633.176) (-1632.148) -- 0:01:02 31500 -- (-1630.581) (-1629.057) [-1633.701] (-1635.820) * [-1640.498] (-1635.407) (-1632.404) (-1632.422) -- 0:01:01 32000 -- (-1630.671) [-1632.310] (-1633.728) (-1635.745) * (-1633.245) [-1635.918] (-1631.279) (-1632.807) -- 0:01:00 32500 -- (-1633.171) (-1629.443) (-1631.707) [-1630.575] * (-1640.605) (-1641.242) (-1633.458) [-1634.154] -- 0:00:59 33000 -- (-1631.440) (-1631.023) [-1630.321] (-1633.195) * (-1638.441) [-1638.086] (-1635.734) (-1632.341) -- 0:00:58 33500 -- (-1632.435) (-1631.785) (-1629.817) [-1633.413] * (-1632.134) [-1633.376] (-1634.516) (-1637.670) -- 0:00:57 34000 -- [-1630.752] (-1629.982) (-1633.384) (-1645.245) * (-1638.482) [-1630.151] (-1631.267) (-1634.301) -- 0:00:56 34500 -- [-1631.745] (-1630.002) (-1631.229) (-1632.734) * (-1631.795) (-1633.574) [-1633.848] (-1635.302) -- 0:00:55 35000 -- (-1632.382) (-1631.629) (-1630.579) [-1634.770] * (-1640.572) (-1648.327) (-1633.681) [-1631.404] -- 0:00:55 Average standard deviation of split frequencies: 0.028257 35500 -- (-1634.435) (-1630.353) [-1631.682] (-1641.018) * (-1642.084) (-1633.636) [-1633.449] (-1632.799) -- 0:01:21 36000 -- (-1632.313) (-1633.920) (-1632.378) [-1634.580] * (-1632.497) (-1649.589) (-1632.515) [-1632.055] -- 0:01:20 36500 -- (-1630.691) (-1630.033) (-1630.772) [-1632.192] * (-1633.772) [-1640.047] (-1631.947) (-1636.848) -- 0:01:19 37000 -- (-1630.718) [-1631.001] (-1630.511) (-1634.942) * [-1638.330] (-1635.953) (-1632.138) (-1631.333) -- 0:01:18 37500 -- (-1630.814) (-1634.642) (-1632.112) [-1633.402] * (-1635.908) (-1640.814) (-1630.133) [-1630.330] -- 0:01:17 38000 -- (-1631.753) [-1632.607] (-1629.278) (-1642.331) * (-1638.940) [-1635.371] (-1630.713) (-1629.771) -- 0:01:15 38500 -- (-1630.244) (-1631.793) (-1630.849) [-1633.088] * (-1643.409) [-1631.983] (-1634.390) (-1631.709) -- 0:01:14 39000 -- (-1628.593) (-1631.177) [-1630.383] (-1637.635) * (-1640.214) [-1630.704] (-1632.317) (-1631.628) -- 0:01:13 39500 -- (-1629.193) (-1631.732) [-1629.714] (-1633.244) * [-1631.816] (-1639.096) (-1638.980) (-1635.328) -- 0:01:12 40000 -- (-1635.351) (-1632.197) (-1629.987) [-1637.077] * (-1632.859) (-1632.966) [-1630.562] (-1633.532) -- 0:01:12 Average standard deviation of split frequencies: 0.031556 40500 -- (-1629.673) (-1631.729) (-1630.818) [-1634.315] * (-1639.288) [-1631.890] (-1630.885) (-1629.258) -- 0:01:11 41000 -- (-1630.207) [-1630.141] (-1632.033) (-1642.603) * [-1635.068] (-1630.723) (-1632.461) (-1631.794) -- 0:01:10 41500 -- (-1629.818) (-1630.387) [-1630.056] (-1630.603) * (-1635.598) [-1636.948] (-1633.023) (-1633.398) -- 0:01:09 42000 -- (-1629.420) (-1631.941) (-1635.116) [-1630.892] * (-1639.315) [-1631.937] (-1631.303) (-1630.298) -- 0:01:08 42500 -- (-1628.698) [-1634.914] (-1630.826) (-1631.237) * [-1634.524] (-1635.169) (-1631.581) (-1631.730) -- 0:01:07 43000 -- [-1630.994] (-1635.176) (-1630.519) (-1630.994) * (-1636.670) (-1631.679) (-1630.302) [-1632.469] -- 0:01:06 43500 -- (-1631.192) [-1632.764] (-1631.021) (-1631.107) * [-1631.837] (-1631.329) (-1630.806) (-1631.831) -- 0:01:05 44000 -- (-1631.880) (-1630.651) (-1631.352) [-1629.531] * [-1638.234] (-1629.684) (-1631.455) (-1632.556) -- 0:01:05 44500 -- [-1629.979] (-1633.040) (-1633.412) (-1630.014) * [-1632.520] (-1629.842) (-1631.883) (-1630.200) -- 0:01:04 45000 -- (-1629.843) [-1632.195] (-1636.238) (-1629.562) * (-1630.772) [-1632.571] (-1629.899) (-1629.001) -- 0:01:03 Average standard deviation of split frequencies: 0.022936 45500 -- (-1629.625) (-1631.024) [-1632.289] (-1631.564) * (-1637.415) (-1631.235) (-1630.296) [-1628.916] -- 0:01:02 46000 -- (-1631.340) (-1638.613) [-1633.014] (-1632.383) * [-1633.680] (-1629.672) (-1631.624) (-1631.990) -- 0:01:02 46500 -- (-1633.438) (-1633.156) [-1630.154] (-1630.583) * (-1640.605) [-1631.793] (-1630.868) (-1630.622) -- 0:01:01 47000 -- [-1633.086] (-1629.653) (-1630.485) (-1628.377) * (-1632.517) (-1633.094) (-1632.108) [-1629.413] -- 0:01:00 47500 -- (-1632.388) (-1631.863) (-1630.998) [-1630.169] * [-1634.589] (-1632.361) (-1635.630) (-1631.087) -- 0:01:00 48000 -- (-1630.501) [-1627.982] (-1630.700) (-1632.377) * (-1638.728) [-1630.745] (-1629.962) (-1630.173) -- 0:00:59 48500 -- [-1630.826] (-1631.773) (-1637.310) (-1630.450) * (-1638.528) (-1630.748) (-1630.507) [-1630.319] -- 0:00:58 49000 -- [-1628.414] (-1632.098) (-1633.851) (-1630.584) * (-1640.923) (-1630.908) (-1630.812) [-1631.844] -- 0:00:58 49500 -- (-1630.218) (-1631.940) (-1629.767) [-1631.643] * [-1634.516] (-1633.600) (-1631.794) (-1631.013) -- 0:00:57 50000 -- (-1630.675) (-1634.551) (-1628.457) [-1631.386] * [-1632.997] (-1631.876) (-1630.410) (-1633.227) -- 0:00:57 Average standard deviation of split frequencies: 0.023015 50500 -- (-1630.820) [-1630.960] (-1631.362) (-1628.895) * (-1633.767) (-1631.480) (-1630.372) [-1629.962] -- 0:01:15 51000 -- [-1633.663] (-1631.524) (-1630.549) (-1630.657) * (-1633.808) (-1630.155) [-1630.345] (-1633.110) -- 0:01:14 51500 -- [-1631.851] (-1630.636) (-1630.657) (-1630.664) * [-1633.070] (-1631.280) (-1630.984) (-1628.647) -- 0:01:13 52000 -- (-1630.665) [-1629.164] (-1636.611) (-1628.839) * [-1640.411] (-1632.949) (-1632.719) (-1631.767) -- 0:01:12 52500 -- [-1629.627] (-1630.721) (-1633.835) (-1630.343) * [-1633.144] (-1630.622) (-1632.352) (-1631.885) -- 0:01:12 53000 -- (-1628.943) (-1631.061) (-1631.527) [-1631.700] * (-1631.093) [-1629.786] (-1632.156) (-1632.205) -- 0:01:11 53500 -- (-1631.872) (-1631.404) [-1628.462] (-1633.388) * (-1640.809) (-1631.014) (-1631.087) [-1631.449] -- 0:01:10 54000 -- (-1633.724) (-1634.283) [-1631.151] (-1634.228) * [-1634.876] (-1631.197) (-1631.231) (-1630.913) -- 0:01:10 54500 -- (-1631.207) (-1632.989) (-1631.057) [-1630.151] * (-1636.155) (-1631.385) (-1631.338) [-1631.261] -- 0:01:09 55000 -- (-1631.979) [-1631.006] (-1628.822) (-1630.679) * (-1636.119) [-1629.583] (-1633.782) (-1632.087) -- 0:01:08 Average standard deviation of split frequencies: 0.019937 55500 -- (-1636.905) (-1634.181) [-1628.067] (-1629.763) * (-1633.134) (-1631.032) [-1632.061] (-1630.577) -- 0:01:08 56000 -- (-1629.924) [-1630.331] (-1628.632) (-1629.592) * [-1633.170] (-1628.736) (-1632.915) (-1630.381) -- 0:01:07 56500 -- (-1629.280) [-1629.858] (-1629.563) (-1629.956) * (-1636.059) [-1628.948] (-1631.612) (-1630.845) -- 0:01:06 57000 -- (-1629.105) (-1629.772) [-1634.455] (-1631.488) * (-1631.078) (-1632.105) (-1631.100) [-1631.143] -- 0:01:06 57500 -- (-1631.814) (-1630.080) [-1634.163] (-1632.742) * [-1632.936] (-1632.886) (-1631.266) (-1630.287) -- 0:01:05 58000 -- (-1631.303) (-1630.744) [-1633.349] (-1631.080) * [-1628.830] (-1636.638) (-1631.248) (-1630.522) -- 0:01:04 58500 -- [-1631.160] (-1634.038) (-1632.904) (-1630.048) * (-1627.886) (-1632.720) [-1632.516] (-1630.356) -- 0:01:04 59000 -- (-1629.340) (-1635.810) [-1632.529] (-1632.563) * (-1630.074) (-1633.481) (-1631.099) [-1630.896] -- 0:01:03 59500 -- (-1628.891) (-1631.232) [-1633.649] (-1631.196) * [-1629.443] (-1631.064) (-1631.585) (-1633.771) -- 0:01:03 60000 -- [-1631.574] (-1631.236) (-1631.328) (-1630.346) * [-1630.733] (-1629.460) (-1636.034) (-1631.073) -- 0:01:02 Average standard deviation of split frequencies: 0.018740 60500 -- (-1630.246) [-1632.025] (-1630.461) (-1628.882) * (-1629.910) (-1629.529) [-1630.107] (-1632.843) -- 0:01:02 61000 -- [-1631.405] (-1629.971) (-1631.386) (-1631.003) * [-1630.457] (-1631.906) (-1632.157) (-1632.188) -- 0:01:01 61500 -- (-1632.903) (-1631.616) (-1631.641) [-1629.439] * (-1629.009) [-1630.087] (-1630.749) (-1631.574) -- 0:01:01 62000 -- (-1632.877) (-1634.352) [-1628.887] (-1629.054) * (-1629.019) (-1628.110) [-1632.752] (-1633.154) -- 0:01:00 62500 -- (-1631.584) (-1636.077) (-1629.470) [-1630.949] * [-1629.785] (-1630.125) (-1630.286) (-1631.013) -- 0:01:00 63000 -- [-1629.301] (-1632.146) (-1628.066) (-1633.392) * [-1633.844] (-1630.756) (-1630.679) (-1631.682) -- 0:00:59 63500 -- [-1628.611] (-1631.064) (-1630.086) (-1633.965) * [-1629.263] (-1633.677) (-1632.039) (-1631.837) -- 0:00:58 64000 -- [-1628.456] (-1632.471) (-1630.450) (-1633.112) * (-1631.322) (-1633.777) [-1631.989] (-1631.664) -- 0:00:58 64500 -- (-1635.657) [-1631.330] (-1629.670) (-1632.532) * (-1634.216) (-1632.698) [-1633.347] (-1630.927) -- 0:01:12 65000 -- (-1629.268) [-1630.774] (-1631.512) (-1631.568) * (-1630.339) [-1632.228] (-1631.620) (-1630.720) -- 0:01:11 Average standard deviation of split frequencies: 0.021087 65500 -- [-1630.380] (-1630.172) (-1631.170) (-1630.737) * [-1631.036] (-1631.151) (-1632.749) (-1632.913) -- 0:01:11 66000 -- (-1629.466) [-1628.756] (-1628.523) (-1633.102) * (-1630.677) [-1631.334] (-1631.439) (-1630.462) -- 0:01:10 66500 -- (-1631.115) (-1629.096) [-1628.569] (-1633.282) * (-1629.502) (-1637.035) (-1632.891) [-1628.485] -- 0:01:10 67000 -- (-1631.854) (-1631.602) (-1635.339) [-1633.509] * (-1632.304) (-1630.190) (-1636.753) [-1630.883] -- 0:01:09 67500 -- (-1635.225) [-1631.461] (-1632.282) (-1629.679) * [-1633.118] (-1629.771) (-1633.045) (-1635.934) -- 0:01:09 68000 -- (-1631.186) (-1633.100) (-1632.995) [-1630.696] * (-1628.888) (-1634.084) (-1632.589) [-1629.776] -- 0:01:08 68500 -- (-1629.611) (-1629.553) (-1633.365) [-1629.384] * (-1632.854) (-1631.783) [-1633.793] (-1634.242) -- 0:01:07 69000 -- [-1629.469] (-1630.153) (-1631.723) (-1632.374) * (-1636.852) (-1631.898) (-1631.323) [-1632.800] -- 0:01:07 69500 -- (-1631.192) (-1633.164) (-1632.788) [-1632.547] * (-1630.095) [-1637.268] (-1630.336) (-1635.292) -- 0:01:06 70000 -- [-1630.177] (-1634.015) (-1632.010) (-1630.953) * [-1629.154] (-1637.874) (-1629.606) (-1635.838) -- 0:01:06 Average standard deviation of split frequencies: 0.024015 70500 -- (-1631.588) (-1633.200) [-1630.543] (-1630.110) * [-1629.372] (-1629.892) (-1633.060) (-1633.066) -- 0:01:05 71000 -- (-1631.097) (-1630.465) (-1630.759) [-1630.928] * (-1632.248) [-1632.293] (-1634.091) (-1631.583) -- 0:01:05 71500 -- [-1632.146] (-1632.752) (-1630.568) (-1631.157) * (-1628.519) (-1631.065) (-1630.480) [-1630.085] -- 0:01:04 72000 -- (-1633.430) (-1631.734) (-1630.531) [-1630.944] * [-1629.783] (-1633.388) (-1632.579) (-1631.626) -- 0:01:04 72500 -- (-1633.516) (-1631.856) [-1630.025] (-1629.693) * (-1632.825) (-1631.444) [-1631.575] (-1637.079) -- 0:01:03 73000 -- [-1630.082] (-1633.556) (-1631.325) (-1629.836) * (-1630.956) (-1629.619) (-1635.219) [-1635.222] -- 0:01:03 73500 -- (-1630.452) (-1629.743) (-1631.034) [-1630.673] * (-1631.394) (-1629.457) [-1629.001] (-1633.458) -- 0:01:03 74000 -- (-1631.214) (-1629.666) [-1631.963] (-1629.911) * [-1630.152] (-1629.349) (-1628.797) (-1631.950) -- 0:01:02 74500 -- (-1630.667) (-1629.997) (-1632.388) [-1630.525] * [-1633.428] (-1633.770) (-1629.545) (-1632.620) -- 0:01:02 75000 -- (-1632.367) [-1629.839] (-1632.470) (-1630.370) * [-1634.089] (-1633.469) (-1631.189) (-1631.549) -- 0:01:01 Average standard deviation of split frequencies: 0.024484 75500 -- (-1632.604) (-1629.941) [-1629.266] (-1631.933) * (-1632.776) [-1629.261] (-1630.487) (-1632.438) -- 0:01:01 76000 -- (-1633.586) (-1631.505) (-1628.537) [-1631.762] * [-1629.692] (-1630.033) (-1639.019) (-1634.635) -- 0:01:00 76500 -- (-1630.141) (-1629.858) [-1629.485] (-1631.738) * (-1629.279) (-1630.959) [-1639.388] (-1631.448) -- 0:01:00 77000 -- (-1629.779) (-1632.056) [-1629.631] (-1630.499) * (-1631.755) (-1630.601) (-1630.462) [-1632.629] -- 0:00:59 77500 -- (-1630.216) (-1633.397) (-1631.368) [-1630.388] * (-1631.582) (-1634.710) [-1631.418] (-1630.531) -- 0:00:59 78000 -- [-1629.623] (-1631.493) (-1629.424) (-1631.040) * (-1631.230) (-1634.310) [-1628.773] (-1630.991) -- 0:00:59 78500 -- (-1629.164) [-1630.744] (-1632.030) (-1630.888) * (-1633.660) (-1630.238) (-1631.381) [-1630.439] -- 0:00:58 79000 -- (-1633.433) (-1630.730) [-1630.843] (-1635.151) * (-1634.102) [-1630.132] (-1632.223) (-1631.424) -- 0:01:09 79500 -- (-1632.429) [-1633.508] (-1632.348) (-1630.915) * (-1629.932) [-1631.287] (-1629.904) (-1630.814) -- 0:01:09 80000 -- (-1632.124) [-1633.683] (-1629.060) (-1630.510) * (-1629.217) (-1630.113) [-1630.379] (-1631.372) -- 0:01:09 Average standard deviation of split frequencies: 0.026947 80500 -- [-1631.346] (-1632.261) (-1629.713) (-1631.954) * (-1630.587) (-1629.108) [-1628.966] (-1630.618) -- 0:01:08 81000 -- [-1633.224] (-1630.544) (-1631.118) (-1633.235) * (-1630.313) (-1630.567) (-1630.397) [-1629.795] -- 0:01:08 81500 -- (-1632.550) [-1631.826] (-1630.122) (-1634.046) * (-1630.697) (-1630.487) (-1638.072) [-1629.838] -- 0:01:07 82000 -- (-1630.580) [-1634.029] (-1630.689) (-1632.125) * (-1632.088) (-1629.635) (-1632.658) [-1629.671] -- 0:01:07 82500 -- (-1634.661) (-1632.635) [-1630.595] (-1631.551) * [-1633.033] (-1632.255) (-1628.911) (-1630.618) -- 0:01:06 83000 -- (-1631.554) [-1629.263] (-1631.972) (-1630.873) * (-1630.923) (-1633.031) (-1630.335) [-1633.467] -- 0:01:06 83500 -- [-1633.437] (-1632.090) (-1629.329) (-1635.628) * [-1633.888] (-1633.153) (-1632.957) (-1633.554) -- 0:01:05 84000 -- (-1629.275) [-1631.515] (-1630.180) (-1634.935) * [-1631.466] (-1634.812) (-1632.481) (-1630.671) -- 0:01:05 84500 -- [-1629.601] (-1630.329) (-1628.905) (-1629.532) * (-1634.482) [-1631.148] (-1633.002) (-1632.056) -- 0:01:05 85000 -- (-1629.528) (-1630.236) [-1631.443] (-1631.305) * (-1630.705) [-1630.043] (-1632.073) (-1638.081) -- 0:01:04 Average standard deviation of split frequencies: 0.024118 85500 -- (-1630.404) [-1630.488] (-1631.932) (-1631.547) * (-1636.105) [-1629.700] (-1634.509) (-1637.499) -- 0:01:04 86000 -- (-1630.361) (-1629.360) [-1630.724] (-1632.469) * [-1630.797] (-1633.488) (-1636.782) (-1633.215) -- 0:01:03 86500 -- (-1630.406) [-1632.472] (-1633.953) (-1632.271) * (-1633.641) (-1630.188) [-1631.738] (-1631.371) -- 0:01:03 87000 -- (-1634.595) (-1633.791) [-1632.676] (-1630.764) * (-1630.646) [-1631.198] (-1631.716) (-1629.323) -- 0:01:02 87500 -- (-1630.429) [-1630.853] (-1632.392) (-1631.021) * (-1630.527) [-1629.910] (-1632.326) (-1632.953) -- 0:01:02 88000 -- (-1633.896) [-1631.084] (-1631.879) (-1635.025) * (-1629.898) (-1630.963) [-1631.248] (-1630.958) -- 0:01:02 88500 -- (-1631.336) [-1630.722] (-1631.190) (-1632.566) * (-1633.209) (-1630.490) (-1631.451) [-1631.098] -- 0:01:01 89000 -- (-1636.955) (-1630.062) [-1629.793] (-1633.060) * (-1631.713) [-1629.710] (-1632.085) (-1631.049) -- 0:01:01 89500 -- (-1634.935) [-1629.386] (-1632.271) (-1635.548) * (-1632.132) [-1627.890] (-1634.442) (-1632.467) -- 0:01:01 90000 -- (-1636.699) (-1629.800) (-1630.722) [-1631.513] * [-1635.858] (-1629.030) (-1634.871) (-1632.541) -- 0:01:00 Average standard deviation of split frequencies: 0.025449 90500 -- (-1636.614) (-1632.610) [-1630.877] (-1629.963) * [-1631.877] (-1630.638) (-1632.111) (-1632.740) -- 0:01:00 91000 -- (-1632.870) (-1630.633) (-1628.492) [-1631.162] * (-1633.134) (-1630.131) (-1632.966) [-1635.576] -- 0:00:59 91500 -- (-1631.396) [-1629.692] (-1628.287) (-1631.709) * [-1632.856] (-1630.296) (-1634.043) (-1634.053) -- 0:00:59 92000 -- (-1630.038) (-1631.866) [-1629.651] (-1632.813) * (-1632.762) (-1629.952) [-1634.565] (-1631.691) -- 0:00:59 92500 -- (-1632.195) (-1632.011) [-1629.706] (-1636.054) * [-1631.834] (-1635.886) (-1632.387) (-1630.252) -- 0:00:58 93000 -- (-1629.480) (-1629.483) [-1628.639] (-1629.299) * (-1634.815) [-1629.914] (-1631.773) (-1637.209) -- 0:00:58 93500 -- (-1627.676) (-1631.523) [-1628.100] (-1630.538) * [-1633.935] (-1629.953) (-1630.274) (-1629.394) -- 0:01:07 94000 -- (-1630.963) (-1631.510) [-1630.554] (-1630.564) * (-1631.954) (-1630.176) (-1631.086) [-1631.691] -- 0:01:07 94500 -- (-1630.446) (-1629.583) [-1630.157] (-1631.105) * (-1633.620) [-1630.346] (-1631.016) (-1629.508) -- 0:01:07 95000 -- (-1635.134) [-1630.870] (-1631.339) (-1632.110) * (-1631.708) (-1631.899) [-1631.597] (-1630.635) -- 0:01:06 Average standard deviation of split frequencies: 0.023851 95500 -- (-1635.135) (-1630.098) [-1630.912] (-1631.962) * (-1632.000) (-1633.670) (-1631.865) [-1630.721] -- 0:01:06 96000 -- [-1630.218] (-1629.418) (-1631.341) (-1631.794) * (-1629.529) (-1628.273) [-1629.922] (-1631.189) -- 0:01:05 96500 -- (-1630.135) (-1630.134) [-1632.429] (-1632.713) * (-1630.473) (-1630.819) [-1632.959] (-1631.437) -- 0:01:05 97000 -- (-1631.069) (-1629.857) [-1642.460] (-1630.960) * [-1633.532] (-1629.206) (-1630.096) (-1631.141) -- 0:01:05 97500 -- (-1635.453) (-1631.604) (-1639.225) [-1631.483] * [-1631.748] (-1628.258) (-1630.872) (-1630.163) -- 0:01:04 98000 -- [-1633.878] (-1629.710) (-1630.774) (-1631.043) * (-1630.148) [-1631.279] (-1631.352) (-1637.391) -- 0:01:04 98500 -- [-1631.692] (-1627.081) (-1629.864) (-1629.939) * [-1628.106] (-1629.212) (-1631.137) (-1631.598) -- 0:01:04 99000 -- (-1631.247) [-1630.837] (-1628.371) (-1630.042) * (-1632.404) [-1633.309] (-1637.813) (-1631.649) -- 0:01:03 99500 -- (-1638.347) (-1633.909) [-1631.414] (-1630.179) * (-1629.730) [-1630.108] (-1641.864) (-1630.447) -- 0:01:03 100000 -- (-1630.264) [-1630.189] (-1632.143) (-1634.131) * (-1628.524) [-1630.639] (-1632.513) (-1630.081) -- 0:01:02 Average standard deviation of split frequencies: 0.024117 100500 -- [-1630.981] (-1632.635) (-1631.274) (-1630.603) * (-1630.984) (-1630.940) [-1630.215] (-1631.199) -- 0:01:02 101000 -- (-1631.042) [-1629.969] (-1631.377) (-1629.840) * [-1631.421] (-1629.653) (-1630.295) (-1631.786) -- 0:01:02 101500 -- (-1631.365) (-1630.139) [-1630.048] (-1629.750) * (-1629.971) (-1634.137) (-1630.141) [-1630.974] -- 0:01:01 102000 -- (-1632.868) [-1629.674] (-1631.799) (-1630.409) * [-1630.209] (-1632.125) (-1630.163) (-1631.724) -- 0:01:01 102500 -- (-1631.831) (-1630.930) [-1630.974] (-1630.133) * [-1629.828] (-1635.831) (-1630.354) (-1634.133) -- 0:01:01 103000 -- (-1630.259) (-1633.847) (-1631.716) [-1630.500] * (-1630.994) [-1630.692] (-1629.216) (-1630.195) -- 0:01:00 103500 -- [-1630.327] (-1633.301) (-1630.060) (-1632.294) * (-1630.934) (-1630.449) (-1630.537) [-1635.899] -- 0:01:00 104000 -- [-1635.554] (-1630.975) (-1629.183) (-1636.061) * (-1630.794) [-1631.438] (-1630.539) (-1637.685) -- 0:01:00 104500 -- (-1631.935) (-1631.717) [-1632.204] (-1631.658) * [-1631.992] (-1632.570) (-1629.878) (-1631.629) -- 0:00:59 105000 -- (-1630.921) (-1630.652) (-1635.586) [-1630.017] * (-1631.639) (-1631.510) [-1630.842] (-1633.286) -- 0:00:59 Average standard deviation of split frequencies: 0.022871 105500 -- (-1630.333) [-1633.108] (-1630.824) (-1631.210) * (-1633.651) [-1631.363] (-1631.705) (-1634.930) -- 0:00:59 106000 -- (-1641.677) (-1629.825) (-1629.491) [-1629.234] * (-1633.445) (-1631.924) (-1631.503) [-1633.049] -- 0:00:59 106500 -- (-1635.468) (-1629.707) [-1629.966] (-1630.255) * [-1629.465] (-1632.542) (-1630.856) (-1632.945) -- 0:00:58 107000 -- [-1631.143] (-1629.905) (-1631.503) (-1631.558) * (-1630.398) [-1630.481] (-1629.976) (-1631.759) -- 0:00:58 107500 -- (-1629.026) [-1630.305] (-1631.696) (-1629.966) * (-1631.177) (-1630.142) (-1633.953) [-1629.319] -- 0:00:58 108000 -- (-1632.675) (-1632.406) [-1629.623] (-1631.862) * (-1631.318) (-1632.277) [-1629.673] (-1630.840) -- 0:00:57 108500 -- [-1632.466] (-1630.932) (-1630.981) (-1630.564) * (-1633.767) (-1630.868) (-1632.130) [-1633.642] -- 0:01:05 109000 -- (-1633.832) (-1631.019) [-1629.436] (-1632.057) * [-1634.463] (-1631.056) (-1630.466) (-1631.837) -- 0:01:05 109500 -- (-1631.211) (-1631.210) [-1632.523] (-1633.480) * [-1631.190] (-1631.159) (-1631.454) (-1630.797) -- 0:01:05 110000 -- (-1632.053) (-1638.241) [-1631.155] (-1636.437) * (-1637.855) [-1633.652] (-1630.933) (-1635.372) -- 0:01:04 Average standard deviation of split frequencies: 0.022921 110500 -- (-1629.395) [-1630.053] (-1631.127) (-1634.194) * (-1634.150) (-1630.544) [-1630.106] (-1631.550) -- 0:01:04 111000 -- [-1629.022] (-1631.848) (-1631.915) (-1634.741) * (-1630.889) (-1630.401) [-1633.035] (-1636.887) -- 0:01:04 111500 -- (-1630.758) (-1631.743) [-1630.196] (-1630.228) * (-1631.146) (-1634.108) [-1634.330] (-1632.043) -- 0:01:03 112000 -- (-1630.818) (-1630.691) [-1629.742] (-1630.190) * (-1631.043) (-1631.359) [-1630.964] (-1631.721) -- 0:01:03 112500 -- (-1628.759) (-1631.690) [-1634.608] (-1631.092) * (-1637.883) [-1630.579] (-1631.231) (-1631.715) -- 0:01:03 113000 -- [-1628.840] (-1630.496) (-1631.672) (-1631.893) * (-1630.339) (-1629.968) [-1629.104] (-1630.906) -- 0:01:02 113500 -- (-1631.820) [-1630.835] (-1630.386) (-1630.542) * (-1632.800) [-1630.319] (-1630.722) (-1629.605) -- 0:01:02 114000 -- (-1629.354) [-1631.227] (-1633.614) (-1630.289) * (-1632.325) (-1630.285) (-1631.145) [-1629.623] -- 0:01:02 114500 -- (-1628.163) (-1632.940) (-1629.866) [-1631.452] * (-1629.529) (-1631.682) (-1629.893) [-1629.758] -- 0:01:01 115000 -- (-1628.007) [-1631.329] (-1632.639) (-1631.069) * (-1632.371) (-1630.022) [-1632.136] (-1628.725) -- 0:01:01 Average standard deviation of split frequencies: 0.022554 115500 -- (-1631.543) [-1630.291] (-1633.972) (-1634.204) * (-1632.609) (-1627.364) (-1631.001) [-1628.641] -- 0:01:01 116000 -- (-1634.214) [-1630.175] (-1631.616) (-1631.639) * (-1630.687) [-1628.503] (-1630.529) (-1628.679) -- 0:01:00 116500 -- [-1630.680] (-1632.001) (-1631.160) (-1632.686) * (-1630.621) [-1630.691] (-1631.763) (-1630.349) -- 0:01:00 117000 -- (-1629.913) (-1632.725) (-1632.005) [-1630.765] * (-1631.618) [-1629.909] (-1632.418) (-1633.179) -- 0:01:00 117500 -- (-1631.191) (-1630.756) (-1630.348) [-1630.301] * [-1629.640] (-1630.740) (-1633.888) (-1633.360) -- 0:01:00 118000 -- [-1630.225] (-1631.627) (-1630.235) (-1629.523) * (-1630.991) (-1634.820) (-1635.685) [-1631.180] -- 0:00:59 118500 -- [-1629.863] (-1636.699) (-1630.767) (-1631.384) * [-1630.067] (-1632.184) (-1636.372) (-1633.564) -- 0:00:59 119000 -- (-1634.240) (-1637.562) (-1629.972) [-1630.842] * (-1630.457) (-1630.134) [-1628.422] (-1631.567) -- 0:00:59 119500 -- (-1630.021) [-1631.986] (-1635.823) (-1629.715) * (-1631.890) [-1630.316] (-1633.003) (-1631.017) -- 0:00:58 120000 -- (-1629.260) (-1631.863) (-1634.479) [-1630.168] * [-1629.885] (-1631.492) (-1634.257) (-1630.269) -- 0:00:58 Average standard deviation of split frequencies: 0.022268 120500 -- (-1631.898) [-1630.507] (-1631.779) (-1628.379) * (-1629.564) [-1627.975] (-1635.070) (-1635.323) -- 0:00:58 121000 -- [-1628.494] (-1630.719) (-1633.789) (-1631.014) * (-1630.664) (-1630.645) (-1630.194) [-1633.548] -- 0:00:58 121500 -- [-1631.730] (-1633.018) (-1632.058) (-1632.061) * (-1632.620) (-1630.290) [-1628.796] (-1632.988) -- 0:00:57 122000 -- [-1630.751] (-1630.595) (-1630.006) (-1629.527) * (-1633.654) [-1631.633] (-1629.220) (-1633.184) -- 0:00:57 122500 -- (-1635.276) [-1631.135] (-1630.755) (-1630.996) * (-1637.530) (-1629.473) (-1632.285) [-1638.422] -- 0:00:57 123000 -- [-1629.587] (-1630.568) (-1632.262) (-1630.078) * (-1633.378) [-1629.414] (-1632.015) (-1629.977) -- 0:01:04 123500 -- (-1630.618) [-1630.045] (-1637.495) (-1630.554) * [-1629.836] (-1628.765) (-1629.732) (-1634.687) -- 0:01:03 124000 -- [-1630.140] (-1630.559) (-1634.820) (-1630.601) * (-1636.794) (-1630.217) [-1628.332] (-1632.751) -- 0:01:03 124500 -- (-1631.304) (-1632.482) [-1632.840] (-1633.798) * (-1632.672) (-1628.928) (-1628.126) [-1629.830] -- 0:01:03 125000 -- [-1630.095] (-1632.993) (-1633.352) (-1634.420) * (-1635.276) [-1628.490] (-1629.327) (-1633.338) -- 0:01:03 Average standard deviation of split frequencies: 0.024131 125500 -- (-1632.794) (-1633.274) [-1632.370] (-1630.542) * (-1631.077) (-1628.954) [-1629.922] (-1632.261) -- 0:01:02 126000 -- (-1630.550) (-1630.659) [-1631.222] (-1629.641) * (-1633.650) [-1630.405] (-1631.322) (-1632.173) -- 0:01:02 126500 -- (-1631.547) (-1632.279) [-1633.895] (-1629.826) * (-1630.301) [-1632.353] (-1630.728) (-1629.732) -- 0:01:02 127000 -- (-1631.429) (-1632.882) [-1628.664] (-1634.009) * (-1632.111) (-1629.523) (-1631.197) [-1631.171] -- 0:01:01 127500 -- (-1632.202) [-1632.370] (-1631.252) (-1632.379) * (-1630.924) (-1628.878) (-1630.314) [-1631.692] -- 0:01:01 128000 -- (-1631.544) [-1632.518] (-1628.919) (-1632.187) * (-1630.757) (-1629.109) [-1633.143] (-1632.580) -- 0:01:01 128500 -- (-1630.305) (-1630.363) (-1632.746) [-1630.103] * [-1630.019] (-1629.928) (-1636.053) (-1632.127) -- 0:01:01 129000 -- (-1630.217) [-1629.825] (-1632.424) (-1629.984) * (-1630.986) (-1630.202) (-1629.939) [-1632.263] -- 0:01:00 129500 -- (-1629.166) (-1629.868) (-1630.489) [-1630.086] * (-1632.008) (-1629.935) (-1633.206) [-1631.158] -- 0:01:00 130000 -- (-1629.981) (-1632.367) [-1631.192] (-1633.517) * (-1630.630) [-1629.888] (-1637.483) (-1631.199) -- 0:01:00 Average standard deviation of split frequencies: 0.022187 130500 -- (-1630.793) (-1632.784) [-1631.103] (-1634.984) * [-1633.166] (-1630.746) (-1630.868) (-1632.498) -- 0:00:59 131000 -- [-1631.565] (-1633.155) (-1631.663) (-1632.293) * (-1634.645) (-1631.354) [-1629.749] (-1629.238) -- 0:00:59 131500 -- (-1632.816) (-1633.640) [-1633.742] (-1630.176) * (-1631.269) [-1630.049] (-1631.801) (-1628.982) -- 0:00:59 132000 -- (-1630.448) [-1630.974] (-1633.028) (-1630.338) * [-1628.747] (-1630.784) (-1631.474) (-1631.486) -- 0:00:59 132500 -- [-1633.549] (-1632.272) (-1631.546) (-1630.737) * [-1629.055] (-1631.988) (-1632.192) (-1631.166) -- 0:00:58 133000 -- (-1631.029) [-1630.962] (-1631.891) (-1632.460) * (-1633.570) (-1634.177) [-1628.388] (-1629.874) -- 0:00:58 133500 -- (-1629.434) (-1632.067) [-1631.514] (-1630.391) * (-1632.583) [-1629.712] (-1629.495) (-1629.467) -- 0:00:58 134000 -- (-1631.192) (-1631.007) [-1630.608] (-1629.984) * (-1631.328) (-1633.956) [-1629.343] (-1630.979) -- 0:00:58 134500 -- (-1630.865) (-1630.950) (-1631.460) [-1629.964] * (-1633.145) (-1643.886) [-1630.423] (-1632.764) -- 0:00:57 135000 -- (-1630.743) [-1630.895] (-1630.228) (-1628.974) * (-1634.429) (-1630.626) (-1631.324) [-1630.514] -- 0:00:57 Average standard deviation of split frequencies: 0.020797 135500 -- [-1637.139] (-1631.150) (-1629.748) (-1630.633) * [-1636.184] (-1628.952) (-1631.922) (-1632.222) -- 0:00:57 136000 -- (-1629.629) (-1631.366) [-1630.178] (-1628.359) * (-1630.414) [-1630.217] (-1633.415) (-1633.467) -- 0:00:57 136500 -- (-1629.879) [-1630.721] (-1630.112) (-1629.673) * (-1633.155) (-1630.646) (-1631.668) [-1631.629] -- 0:00:56 137000 -- (-1631.669) (-1630.434) (-1630.105) [-1628.961] * (-1632.745) (-1629.547) (-1631.912) [-1631.524] -- 0:00:56 137500 -- (-1631.736) (-1629.962) (-1630.431) [-1630.594] * (-1639.950) (-1632.427) (-1631.930) [-1629.617] -- 0:00:56 138000 -- (-1633.432) (-1632.988) [-1629.280] (-1631.658) * (-1636.592) [-1630.984] (-1631.798) (-1629.420) -- 0:01:02 138500 -- (-1635.031) (-1632.249) [-1631.107] (-1633.572) * (-1632.711) (-1634.411) [-1631.631] (-1629.273) -- 0:01:02 139000 -- [-1632.017] (-1629.802) (-1629.433) (-1631.082) * (-1631.840) (-1634.337) (-1630.900) [-1630.438] -- 0:01:01 139500 -- [-1631.300] (-1628.831) (-1631.275) (-1631.041) * [-1630.432] (-1632.041) (-1630.900) (-1633.406) -- 0:01:01 140000 -- (-1635.508) (-1630.242) (-1630.983) [-1629.423] * (-1631.856) [-1631.411] (-1631.498) (-1635.499) -- 0:01:01 Average standard deviation of split frequencies: 0.019402 140500 -- [-1633.694] (-1630.018) (-1631.779) (-1631.590) * (-1629.766) [-1630.846] (-1631.567) (-1631.802) -- 0:01:01 141000 -- (-1632.229) [-1630.336] (-1631.153) (-1630.349) * (-1635.571) (-1633.132) [-1629.957] (-1629.542) -- 0:01:00 141500 -- (-1629.843) (-1631.539) (-1633.024) [-1631.098] * (-1637.636) (-1633.860) (-1632.095) [-1629.451] -- 0:01:00 142000 -- (-1630.495) (-1631.468) (-1632.870) [-1629.927] * (-1632.060) [-1633.159] (-1631.189) (-1631.500) -- 0:01:00 142500 -- (-1630.629) (-1632.367) (-1633.603) [-1631.207] * (-1631.426) [-1629.691] (-1632.626) (-1629.896) -- 0:01:00 143000 -- [-1630.297] (-1630.433) (-1631.831) (-1632.010) * [-1631.213] (-1629.704) (-1630.766) (-1632.884) -- 0:00:59 143500 -- (-1632.324) [-1632.562] (-1630.672) (-1630.197) * (-1631.253) (-1632.239) (-1631.608) [-1633.967] -- 0:00:59 144000 -- [-1631.706] (-1631.745) (-1631.613) (-1631.844) * (-1632.116) (-1630.560) [-1632.105] (-1631.189) -- 0:00:59 144500 -- [-1635.111] (-1633.092) (-1631.644) (-1632.599) * (-1631.257) [-1633.055] (-1631.410) (-1633.368) -- 0:00:59 145000 -- (-1628.471) (-1634.714) (-1633.519) [-1630.575] * (-1630.824) (-1632.152) [-1631.352] (-1633.368) -- 0:00:58 Average standard deviation of split frequencies: 0.019373 145500 -- (-1628.910) (-1630.446) [-1629.839] (-1634.751) * (-1630.977) [-1633.556] (-1634.625) (-1631.597) -- 0:00:58 146000 -- (-1631.321) (-1631.393) (-1629.028) [-1632.555] * (-1630.834) [-1631.991] (-1631.706) (-1630.390) -- 0:00:58 146500 -- (-1632.849) (-1630.828) [-1631.185] (-1632.372) * (-1638.438) (-1633.539) [-1630.744] (-1632.595) -- 0:00:58 147000 -- [-1631.115] (-1633.719) (-1628.296) (-1631.390) * (-1631.584) [-1633.733] (-1627.797) (-1629.950) -- 0:00:58 147500 -- (-1637.999) (-1631.622) [-1630.099] (-1629.844) * (-1634.502) [-1632.156] (-1631.460) (-1630.326) -- 0:00:57 148000 -- (-1635.592) (-1633.254) (-1630.346) [-1632.088] * (-1632.964) [-1630.606] (-1632.521) (-1630.868) -- 0:00:57 148500 -- (-1629.192) (-1633.069) [-1631.850] (-1630.953) * (-1630.924) (-1633.469) [-1631.795] (-1631.767) -- 0:00:57 149000 -- (-1629.739) (-1632.481) [-1631.960] (-1632.445) * (-1632.487) (-1630.588) [-1629.068] (-1630.202) -- 0:00:57 149500 -- (-1630.322) [-1631.821] (-1630.706) (-1637.590) * (-1633.793) (-1630.848) (-1633.383) [-1629.915] -- 0:00:56 150000 -- [-1629.692] (-1631.218) (-1631.547) (-1637.577) * (-1633.811) (-1633.833) (-1629.549) [-1632.190] -- 0:00:56 Average standard deviation of split frequencies: 0.022527 150500 -- (-1630.606) [-1630.356] (-1630.198) (-1633.830) * [-1630.572] (-1639.131) (-1629.620) (-1630.360) -- 0:00:56 151000 -- (-1634.970) (-1634.486) (-1629.614) [-1630.852] * (-1633.642) (-1632.334) [-1628.850] (-1632.722) -- 0:00:56 151500 -- (-1632.056) (-1631.601) [-1629.249] (-1631.058) * (-1634.547) (-1631.304) (-1632.002) [-1633.666] -- 0:00:56 152000 -- (-1630.848) [-1631.845] (-1630.138) (-1630.807) * [-1631.768] (-1630.709) (-1630.285) (-1632.168) -- 0:00:55 152500 -- (-1633.548) (-1631.684) [-1630.533] (-1632.793) * (-1630.438) [-1632.037] (-1632.843) (-1631.454) -- 0:01:01 153000 -- (-1631.973) [-1633.708] (-1630.459) (-1637.057) * (-1632.468) (-1630.269) (-1632.840) [-1631.631] -- 0:01:00 153500 -- (-1632.425) (-1630.264) (-1633.185) [-1632.871] * [-1628.526] (-1631.646) (-1633.993) (-1630.585) -- 0:01:00 154000 -- (-1633.268) [-1630.971] (-1635.207) (-1631.734) * (-1633.313) (-1633.987) (-1634.546) [-1628.755] -- 0:01:00 154500 -- [-1629.864] (-1631.725) (-1631.991) (-1631.668) * [-1632.158] (-1631.681) (-1634.570) (-1629.992) -- 0:01:00 155000 -- (-1631.396) (-1633.402) (-1635.069) [-1634.956] * [-1630.895] (-1632.119) (-1630.901) (-1630.641) -- 0:00:59 Average standard deviation of split frequencies: 0.022059 155500 -- (-1629.971) (-1631.782) [-1629.662] (-1632.968) * (-1632.130) (-1630.337) (-1631.320) [-1634.630] -- 0:00:59 156000 -- [-1630.144] (-1632.683) (-1630.254) (-1631.500) * (-1634.295) (-1630.415) (-1633.925) [-1628.764] -- 0:00:59 156500 -- (-1630.735) (-1631.697) (-1633.719) [-1631.666] * (-1634.259) (-1631.941) (-1632.132) [-1630.316] -- 0:00:59 157000 -- (-1631.079) (-1629.772) (-1632.995) [-1633.988] * [-1633.690] (-1630.424) (-1630.219) (-1631.980) -- 0:00:59 157500 -- (-1631.785) (-1629.219) [-1629.917] (-1630.054) * [-1630.470] (-1630.644) (-1633.034) (-1630.959) -- 0:00:58 158000 -- (-1636.984) (-1632.173) [-1629.581] (-1634.187) * [-1633.802] (-1629.093) (-1631.240) (-1632.954) -- 0:00:58 158500 -- (-1631.241) (-1632.141) [-1630.183] (-1636.140) * (-1633.083) [-1630.908] (-1634.736) (-1631.409) -- 0:00:58 159000 -- (-1630.915) [-1630.434] (-1631.300) (-1632.547) * (-1633.811) [-1631.126] (-1632.147) (-1634.123) -- 0:00:58 159500 -- (-1631.603) (-1629.964) [-1628.189] (-1631.437) * (-1631.987) [-1634.072] (-1631.339) (-1637.090) -- 0:00:57 160000 -- (-1635.840) [-1631.746] (-1630.150) (-1631.263) * (-1633.034) (-1633.409) [-1631.181] (-1631.914) -- 0:00:57 Average standard deviation of split frequencies: 0.023179 160500 -- (-1630.923) (-1630.867) [-1630.444] (-1632.083) * (-1634.866) (-1629.216) [-1633.201] (-1630.578) -- 0:00:57 161000 -- (-1633.135) [-1633.122] (-1631.273) (-1630.833) * (-1631.921) (-1629.944) (-1631.640) [-1630.358] -- 0:00:57 161500 -- (-1634.481) (-1634.116) (-1632.677) [-1631.089] * (-1630.274) (-1627.509) (-1632.265) [-1630.775] -- 0:00:57 162000 -- (-1631.937) [-1633.195] (-1639.983) (-1629.911) * (-1631.287) (-1629.228) (-1630.040) [-1631.293] -- 0:00:56 162500 -- (-1629.256) [-1629.835] (-1633.641) (-1631.097) * (-1631.900) (-1631.089) [-1634.252] (-1633.956) -- 0:00:56 163000 -- (-1630.424) [-1629.568] (-1631.545) (-1629.658) * (-1629.111) (-1635.149) (-1633.762) [-1630.890] -- 0:00:56 163500 -- [-1630.098] (-1631.916) (-1634.275) (-1633.789) * (-1631.383) (-1633.174) [-1630.291] (-1636.223) -- 0:00:56 164000 -- (-1629.789) (-1632.280) [-1631.400] (-1629.761) * (-1631.183) (-1632.062) (-1630.157) [-1630.930] -- 0:00:56 164500 -- (-1631.748) (-1633.802) [-1631.223] (-1630.254) * [-1630.696] (-1631.835) (-1632.837) (-1633.374) -- 0:00:55 165000 -- (-1629.945) (-1631.507) [-1631.717] (-1631.893) * (-1633.587) (-1632.811) [-1630.751] (-1637.279) -- 0:00:55 Average standard deviation of split frequencies: 0.022583 165500 -- (-1631.096) (-1631.182) (-1631.546) [-1629.742] * (-1635.398) [-1632.559] (-1631.085) (-1631.423) -- 0:00:55 166000 -- [-1633.529] (-1632.893) (-1630.494) (-1638.331) * (-1629.556) (-1631.017) [-1630.673] (-1630.433) -- 0:00:55 166500 -- (-1632.212) (-1630.745) [-1630.014] (-1634.521) * (-1629.562) (-1631.318) (-1635.096) [-1630.487] -- 0:00:55 167000 -- (-1631.477) [-1630.031] (-1629.321) (-1633.416) * (-1632.098) (-1629.684) (-1633.950) [-1630.080] -- 0:00:59 167500 -- (-1630.494) (-1631.435) [-1628.264] (-1632.693) * [-1630.688] (-1631.196) (-1631.760) (-1630.360) -- 0:00:59 168000 -- (-1631.022) (-1631.745) (-1629.995) [-1630.612] * (-1633.088) (-1630.445) [-1632.021] (-1632.241) -- 0:00:59 168500 -- [-1629.909] (-1631.013) (-1634.358) (-1630.032) * (-1631.364) (-1631.559) (-1632.898) [-1631.115] -- 0:00:59 169000 -- (-1630.634) (-1631.017) [-1628.574] (-1631.822) * (-1629.694) (-1630.263) (-1632.661) [-1629.914] -- 0:00:59 169500 -- (-1630.596) (-1630.391) (-1631.432) [-1630.475] * (-1630.282) (-1632.272) (-1630.858) [-1630.641] -- 0:00:58 170000 -- (-1633.876) (-1630.834) (-1628.400) [-1630.342] * [-1629.514] (-1635.390) (-1633.822) (-1633.741) -- 0:00:58 Average standard deviation of split frequencies: 0.021079 170500 -- (-1636.563) (-1630.220) [-1629.277] (-1632.261) * [-1630.162] (-1631.653) (-1631.316) (-1634.587) -- 0:00:58 171000 -- (-1633.231) [-1632.368] (-1631.231) (-1629.917) * (-1628.734) [-1630.878] (-1633.157) (-1634.462) -- 0:00:58 171500 -- (-1631.586) [-1631.742] (-1631.036) (-1630.725) * [-1630.432] (-1630.081) (-1630.272) (-1636.707) -- 0:00:57 172000 -- (-1634.877) (-1634.144) (-1630.437) [-1635.489] * (-1630.742) (-1630.829) [-1631.681] (-1631.329) -- 0:00:57 172500 -- (-1630.161) (-1633.843) [-1629.912] (-1634.105) * (-1630.671) (-1632.142) [-1632.282] (-1631.170) -- 0:00:57 173000 -- [-1632.721] (-1633.023) (-1630.949) (-1634.559) * (-1632.172) (-1633.635) (-1631.192) [-1630.670] -- 0:00:57 173500 -- (-1633.259) [-1631.053] (-1634.735) (-1632.732) * (-1633.912) (-1630.317) (-1632.188) [-1630.893] -- 0:00:57 174000 -- [-1630.663] (-1630.661) (-1632.546) (-1633.296) * [-1630.130] (-1632.313) (-1631.114) (-1630.390) -- 0:00:56 174500 -- (-1636.261) (-1631.069) [-1630.052] (-1631.851) * (-1630.421) (-1633.274) [-1629.787] (-1631.140) -- 0:00:56 175000 -- (-1634.015) [-1629.884] (-1633.883) (-1632.715) * [-1630.982] (-1634.474) (-1630.187) (-1631.580) -- 0:00:56 Average standard deviation of split frequencies: 0.021709 175500 -- (-1630.789) (-1631.729) (-1631.354) [-1631.749] * (-1631.172) (-1631.949) [-1630.997] (-1634.361) -- 0:00:56 176000 -- (-1634.551) (-1631.041) (-1630.097) [-1631.197] * (-1631.212) (-1631.545) [-1631.192] (-1633.209) -- 0:00:56 176500 -- (-1632.762) (-1633.143) (-1634.345) [-1630.708] * [-1628.916] (-1632.470) (-1634.256) (-1635.906) -- 0:00:55 177000 -- (-1630.376) [-1629.876] (-1630.448) (-1632.554) * (-1630.733) (-1630.497) [-1631.996] (-1631.458) -- 0:00:55 177500 -- (-1631.359) (-1629.414) (-1630.449) [-1632.335] * (-1631.681) (-1632.498) [-1632.118] (-1631.428) -- 0:00:55 178000 -- (-1630.810) (-1634.485) [-1630.415] (-1631.887) * (-1629.205) (-1632.203) (-1637.655) [-1630.766] -- 0:00:55 178500 -- (-1630.588) [-1629.127] (-1633.280) (-1631.011) * (-1627.963) (-1631.842) (-1632.840) [-1632.253] -- 0:00:55 179000 -- (-1629.987) (-1630.168) [-1632.564] (-1630.541) * (-1630.614) (-1631.436) (-1629.093) [-1633.818] -- 0:00:55 179500 -- (-1631.060) (-1631.165) [-1628.180] (-1630.288) * (-1629.133) (-1639.447) (-1632.071) [-1631.220] -- 0:00:54 180000 -- (-1629.893) [-1630.023] (-1630.732) (-1631.673) * (-1630.754) [-1628.972] (-1629.876) (-1631.035) -- 0:00:54 Average standard deviation of split frequencies: 0.021835 180500 -- [-1631.047] (-1629.234) (-1629.368) (-1633.959) * (-1629.298) [-1629.971] (-1631.463) (-1634.533) -- 0:00:54 181000 -- (-1633.201) [-1630.204] (-1629.124) (-1632.383) * [-1631.388] (-1628.096) (-1630.123) (-1632.204) -- 0:00:54 181500 -- (-1630.544) (-1628.973) (-1628.777) [-1631.514] * (-1631.351) (-1630.569) (-1632.359) [-1632.033] -- 0:00:54 182000 -- (-1630.536) (-1629.295) [-1629.013] (-1632.154) * [-1633.357] (-1630.406) (-1637.650) (-1631.642) -- 0:00:58 182500 -- (-1631.456) (-1629.416) [-1628.332] (-1633.066) * (-1631.885) [-1631.450] (-1631.856) (-1633.848) -- 0:00:58 183000 -- (-1631.351) (-1630.021) [-1632.600] (-1633.428) * (-1634.569) [-1631.403] (-1629.003) (-1630.725) -- 0:00:58 183500 -- [-1631.575] (-1635.611) (-1629.943) (-1631.168) * (-1635.050) (-1630.139) [-1630.426] (-1630.611) -- 0:00:57 184000 -- (-1632.394) (-1630.194) (-1631.048) [-1630.483] * (-1628.208) (-1635.227) [-1627.947] (-1630.179) -- 0:00:57 184500 -- (-1631.471) (-1632.584) (-1630.498) [-1631.836] * (-1629.923) [-1631.629] (-1629.830) (-1631.873) -- 0:00:57 185000 -- [-1630.776] (-1631.110) (-1630.203) (-1633.187) * (-1631.669) (-1630.218) [-1631.279] (-1631.427) -- 0:00:57 Average standard deviation of split frequencies: 0.023697 185500 -- (-1630.529) (-1634.603) (-1632.177) [-1632.221] * (-1631.037) (-1630.514) (-1627.526) [-1632.523] -- 0:00:57 186000 -- (-1630.106) (-1630.935) (-1634.901) [-1630.834] * (-1632.149) [-1631.504] (-1629.897) (-1632.078) -- 0:00:56 186500 -- [-1629.561] (-1628.262) (-1630.100) (-1630.150) * [-1631.421] (-1631.396) (-1631.427) (-1631.882) -- 0:00:56 187000 -- (-1629.508) [-1628.457] (-1630.736) (-1630.454) * (-1630.903) [-1630.889] (-1631.095) (-1630.150) -- 0:00:56 187500 -- [-1630.843] (-1629.932) (-1629.006) (-1629.916) * (-1630.200) [-1630.090] (-1630.818) (-1630.396) -- 0:00:56 188000 -- (-1630.765) [-1630.568] (-1634.502) (-1631.422) * (-1631.125) [-1631.212] (-1636.932) (-1631.546) -- 0:00:56 188500 -- [-1635.782] (-1633.050) (-1634.087) (-1630.521) * (-1631.492) (-1632.762) [-1630.375] (-1632.491) -- 0:00:55 189000 -- (-1629.466) (-1631.293) (-1630.399) [-1632.363] * (-1632.877) (-1633.895) [-1629.319] (-1630.043) -- 0:00:55 189500 -- [-1629.149] (-1628.114) (-1628.960) (-1631.790) * (-1631.392) [-1636.135] (-1631.302) (-1631.200) -- 0:00:55 190000 -- (-1631.669) [-1629.369] (-1633.677) (-1633.029) * (-1631.357) (-1633.813) [-1635.006] (-1631.644) -- 0:00:55 Average standard deviation of split frequencies: 0.022993 190500 -- (-1634.179) (-1629.948) [-1631.361] (-1631.652) * (-1633.021) [-1629.089] (-1631.299) (-1630.388) -- 0:00:55 191000 -- (-1631.921) [-1631.421] (-1630.997) (-1630.762) * (-1632.735) (-1629.896) [-1630.361] (-1630.145) -- 0:00:55 191500 -- [-1631.448] (-1628.752) (-1630.719) (-1631.683) * (-1630.115) (-1629.533) [-1631.752] (-1630.096) -- 0:00:54 192000 -- (-1630.819) (-1633.143) [-1632.792] (-1631.173) * (-1635.224) (-1631.769) (-1632.582) [-1633.965] -- 0:00:54 192500 -- (-1630.901) (-1634.964) (-1632.079) [-1632.396] * (-1631.525) (-1630.877) [-1633.011] (-1635.859) -- 0:00:54 193000 -- (-1632.261) (-1635.378) [-1630.342] (-1631.840) * [-1628.796] (-1631.739) (-1631.603) (-1631.663) -- 0:00:54 193500 -- (-1631.431) (-1631.420) (-1630.036) [-1631.261] * (-1630.312) (-1631.925) [-1629.073] (-1628.807) -- 0:00:54 194000 -- (-1629.450) (-1633.321) [-1631.160] (-1632.106) * (-1631.910) (-1629.651) (-1628.890) [-1634.180] -- 0:00:54 194500 -- (-1630.020) (-1631.089) (-1631.934) [-1630.116] * [-1632.976] (-1629.481) (-1631.732) (-1633.555) -- 0:00:53 195000 -- (-1629.761) (-1631.664) (-1630.883) [-1631.462] * (-1633.371) (-1630.575) [-1629.304] (-1632.897) -- 0:00:53 Average standard deviation of split frequencies: 0.022488 195500 -- (-1630.083) [-1631.219] (-1630.512) (-1633.037) * (-1635.718) (-1630.539) (-1632.663) [-1630.539] -- 0:00:53 196000 -- (-1630.971) (-1629.164) (-1630.963) [-1631.775] * (-1632.225) [-1627.460] (-1629.082) (-1630.599) -- 0:00:53 196500 -- (-1630.245) [-1630.244] (-1631.602) (-1631.384) * (-1629.365) [-1627.367] (-1627.408) (-1630.259) -- 0:00:57 197000 -- (-1631.766) (-1630.557) (-1631.776) [-1629.795] * (-1630.960) [-1627.778] (-1629.185) (-1633.487) -- 0:00:57 197500 -- (-1629.207) [-1629.640] (-1630.942) (-1632.505) * (-1630.287) [-1628.281] (-1629.035) (-1630.041) -- 0:00:56 198000 -- (-1632.084) (-1631.819) (-1631.867) [-1629.054] * (-1630.469) [-1630.365] (-1640.128) (-1631.160) -- 0:00:56 198500 -- (-1630.142) (-1629.060) [-1632.885] (-1631.414) * (-1631.798) (-1631.986) [-1628.187] (-1630.758) -- 0:00:56 199000 -- (-1629.821) (-1630.342) [-1633.189] (-1628.652) * [-1632.190] (-1630.410) (-1631.740) (-1630.023) -- 0:00:56 199500 -- (-1630.645) [-1629.687] (-1633.797) (-1629.671) * (-1631.104) [-1631.357] (-1632.074) (-1630.482) -- 0:00:56 200000 -- (-1629.630) [-1633.637] (-1632.997) (-1632.890) * (-1632.819) (-1631.966) [-1630.827] (-1633.282) -- 0:00:55 Average standard deviation of split frequencies: 0.022435 200500 -- (-1631.753) [-1631.596] (-1630.642) (-1631.467) * (-1631.299) (-1637.253) (-1631.989) [-1633.116] -- 0:00:55 201000 -- (-1629.923) (-1631.507) (-1632.048) [-1630.838] * (-1631.484) (-1633.558) (-1634.366) [-1630.184] -- 0:00:55 201500 -- (-1631.639) (-1632.518) [-1631.695] (-1630.326) * (-1631.284) (-1633.581) [-1630.128] (-1631.065) -- 0:00:55 202000 -- (-1634.651) (-1631.195) [-1629.582] (-1630.360) * (-1630.633) [-1632.557] (-1629.360) (-1631.299) -- 0:00:55 202500 -- (-1634.604) (-1630.329) [-1629.391] (-1630.243) * (-1630.192) [-1628.086] (-1632.248) (-1634.524) -- 0:00:55 203000 -- (-1633.381) [-1632.565] (-1628.778) (-1629.784) * (-1633.248) [-1627.942] (-1630.419) (-1631.096) -- 0:00:54 203500 -- (-1630.811) [-1631.053] (-1632.719) (-1633.508) * [-1631.642] (-1627.346) (-1630.332) (-1631.854) -- 0:00:54 204000 -- [-1630.854] (-1631.999) (-1629.584) (-1630.954) * [-1630.165] (-1630.254) (-1632.337) (-1632.328) -- 0:00:54 204500 -- (-1630.876) (-1632.514) [-1628.768] (-1632.346) * (-1631.585) [-1628.502] (-1630.328) (-1631.729) -- 0:00:54 205000 -- (-1634.196) (-1629.072) (-1630.337) [-1633.233] * [-1631.273] (-1631.398) (-1632.047) (-1632.578) -- 0:00:54 Average standard deviation of split frequencies: 0.023913 205500 -- (-1632.565) (-1629.798) [-1630.980] (-1634.383) * [-1630.739] (-1629.249) (-1633.030) (-1630.647) -- 0:00:54 206000 -- (-1631.735) [-1629.854] (-1638.558) (-1630.778) * (-1630.620) [-1630.666] (-1629.531) (-1632.889) -- 0:00:53 206500 -- [-1631.839] (-1630.063) (-1633.592) (-1632.833) * (-1629.820) [-1628.786] (-1632.771) (-1631.467) -- 0:00:53 207000 -- (-1629.757) (-1630.187) [-1630.728] (-1636.858) * (-1632.666) (-1631.166) (-1631.443) [-1630.382] -- 0:00:53 207500 -- [-1629.655] (-1630.122) (-1634.098) (-1632.719) * (-1635.297) [-1631.636] (-1631.197) (-1631.099) -- 0:00:53 208000 -- [-1630.274] (-1632.154) (-1633.412) (-1633.015) * [-1632.907] (-1629.995) (-1630.593) (-1630.648) -- 0:00:53 208500 -- [-1634.397] (-1632.328) (-1631.834) (-1630.298) * (-1630.045) (-1628.994) [-1629.703] (-1631.790) -- 0:00:53 209000 -- [-1632.175] (-1632.307) (-1630.313) (-1629.837) * (-1630.397) (-1629.153) [-1629.321] (-1632.105) -- 0:00:52 209500 -- (-1636.155) (-1630.911) (-1630.906) [-1629.560] * (-1630.262) (-1631.135) (-1630.869) [-1631.626] -- 0:00:52 210000 -- (-1631.253) (-1630.181) (-1632.061) [-1629.974] * [-1630.102] (-1630.390) (-1633.494) (-1630.786) -- 0:00:52 Average standard deviation of split frequencies: 0.023319 210500 -- (-1630.847) (-1631.508) (-1631.939) [-1629.664] * (-1630.020) [-1628.555] (-1633.026) (-1629.397) -- 0:00:52 211000 -- (-1630.950) (-1631.661) (-1630.225) [-1631.330] * [-1629.430] (-1632.265) (-1630.587) (-1629.759) -- 0:00:52 211500 -- [-1629.899] (-1628.333) (-1631.302) (-1630.519) * (-1629.128) [-1632.481] (-1630.111) (-1630.001) -- 0:00:55 212000 -- [-1630.789] (-1628.606) (-1632.203) (-1632.977) * (-1630.455) (-1631.006) [-1631.761] (-1631.375) -- 0:00:55 212500 -- (-1630.250) (-1633.444) (-1632.615) [-1629.621] * (-1629.947) (-1631.926) (-1631.111) [-1629.552] -- 0:00:55 213000 -- (-1635.306) (-1633.266) [-1630.978] (-1630.075) * (-1630.190) (-1629.349) (-1632.975) [-1630.978] -- 0:00:55 213500 -- [-1631.853] (-1631.444) (-1632.785) (-1631.653) * (-1630.907) (-1630.651) (-1631.083) [-1630.566] -- 0:00:55 214000 -- (-1632.299) (-1632.342) [-1629.919] (-1629.654) * (-1635.574) (-1631.824) [-1632.466] (-1631.097) -- 0:00:55 214500 -- (-1629.370) (-1632.157) [-1629.504] (-1634.737) * [-1631.724] (-1631.245) (-1633.000) (-1629.382) -- 0:00:54 215000 -- (-1630.191) [-1630.473] (-1630.032) (-1631.932) * (-1632.250) (-1631.439) (-1629.163) [-1630.077] -- 0:00:54 Average standard deviation of split frequencies: 0.022054 215500 -- (-1631.016) (-1632.970) [-1630.181] (-1631.294) * (-1632.011) (-1630.582) (-1631.300) [-1629.755] -- 0:00:54 216000 -- (-1630.323) (-1633.761) [-1629.143] (-1630.982) * (-1636.377) [-1630.062] (-1630.085) (-1633.156) -- 0:00:54 216500 -- (-1630.031) (-1630.789) [-1630.121] (-1632.584) * (-1633.032) [-1630.796] (-1628.991) (-1635.589) -- 0:00:54 217000 -- [-1628.923] (-1632.519) (-1629.466) (-1631.673) * (-1630.928) [-1629.728] (-1629.466) (-1632.142) -- 0:00:54 217500 -- [-1629.890] (-1629.017) (-1630.949) (-1630.580) * (-1629.793) [-1631.765] (-1631.205) (-1631.936) -- 0:00:53 218000 -- (-1632.177) (-1630.904) [-1628.864] (-1632.355) * [-1632.977] (-1635.862) (-1630.389) (-1630.944) -- 0:00:53 218500 -- (-1633.288) (-1633.510) [-1631.844] (-1629.844) * (-1632.451) (-1631.400) [-1631.002] (-1631.572) -- 0:00:53 219000 -- (-1631.155) (-1633.467) (-1629.537) [-1629.769] * (-1633.123) [-1631.350] (-1629.920) (-1634.095) -- 0:00:53 219500 -- (-1631.097) (-1630.853) (-1631.625) [-1631.359] * (-1631.381) (-1629.959) [-1629.272] (-1631.516) -- 0:00:53 220000 -- (-1630.833) (-1633.627) [-1633.750] (-1630.698) * [-1631.163] (-1637.415) (-1631.054) (-1633.360) -- 0:00:53 Average standard deviation of split frequencies: 0.019564 220500 -- (-1630.939) (-1632.334) (-1631.238) [-1631.684] * [-1629.695] (-1631.444) (-1631.717) (-1633.196) -- 0:00:53 221000 -- (-1631.473) (-1628.979) [-1631.913] (-1635.341) * [-1628.054] (-1630.301) (-1632.990) (-1638.327) -- 0:00:52 221500 -- (-1632.950) (-1633.608) [-1631.275] (-1630.768) * (-1632.678) (-1631.091) (-1630.366) [-1633.345] -- 0:00:52 222000 -- (-1631.428) [-1632.846] (-1632.224) (-1630.634) * (-1632.107) [-1631.151] (-1629.901) (-1631.042) -- 0:00:52 222500 -- (-1631.626) (-1631.907) (-1632.545) [-1630.156] * (-1630.611) (-1634.921) (-1632.175) [-1632.698] -- 0:00:52 223000 -- [-1630.646] (-1632.660) (-1632.693) (-1636.315) * (-1630.012) (-1633.482) [-1630.895] (-1630.370) -- 0:00:52 223500 -- (-1629.393) (-1629.295) [-1633.770] (-1637.741) * (-1629.322) (-1633.172) [-1628.649] (-1636.594) -- 0:00:52 224000 -- (-1628.842) (-1630.579) [-1633.029] (-1632.483) * (-1630.128) (-1633.878) [-1629.356] (-1633.674) -- 0:00:51 224500 -- (-1633.028) [-1634.674] (-1634.825) (-1635.265) * (-1630.023) (-1630.241) [-1630.353] (-1629.468) -- 0:00:51 225000 -- (-1632.172) (-1635.596) [-1635.519] (-1631.551) * (-1629.627) (-1630.159) (-1631.427) [-1630.226] -- 0:00:51 Average standard deviation of split frequencies: 0.020024 225500 -- (-1631.395) (-1634.271) [-1630.848] (-1631.473) * (-1629.505) [-1629.862] (-1629.765) (-1632.108) -- 0:00:51 226000 -- (-1633.635) (-1631.843) [-1631.197] (-1630.298) * (-1632.277) (-1630.067) [-1633.619] (-1632.956) -- 0:00:54 226500 -- [-1630.548] (-1630.648) (-1631.390) (-1629.338) * (-1630.967) (-1631.147) (-1631.514) [-1631.198] -- 0:00:54 227000 -- (-1634.872) (-1630.663) [-1632.537] (-1632.686) * [-1632.596] (-1630.359) (-1631.360) (-1635.241) -- 0:00:54 227500 -- (-1629.465) (-1632.040) (-1630.901) [-1632.793] * (-1630.939) (-1629.453) (-1631.723) [-1630.922] -- 0:00:54 228000 -- [-1629.769] (-1632.665) (-1631.787) (-1633.846) * (-1633.645) [-1632.810] (-1631.450) (-1630.002) -- 0:00:54 228500 -- [-1630.557] (-1633.326) (-1631.147) (-1633.688) * [-1634.318] (-1634.009) (-1630.905) (-1631.642) -- 0:00:54 229000 -- (-1631.953) (-1631.395) [-1631.444] (-1638.718) * (-1631.088) (-1631.533) [-1632.506] (-1631.542) -- 0:00:53 229500 -- (-1633.597) (-1630.443) (-1631.597) [-1632.504] * (-1631.245) [-1630.242] (-1631.751) (-1633.268) -- 0:00:53 230000 -- (-1631.998) [-1630.467] (-1630.703) (-1630.858) * (-1640.910) (-1632.983) [-1631.985] (-1632.166) -- 0:00:53 Average standard deviation of split frequencies: 0.020641 230500 -- (-1631.126) (-1629.162) (-1631.703) [-1631.083] * (-1635.616) (-1635.063) (-1634.992) [-1629.230] -- 0:00:53 231000 -- [-1631.194] (-1629.827) (-1635.134) (-1632.060) * [-1632.142] (-1631.733) (-1634.960) (-1632.428) -- 0:00:53 231500 -- (-1630.527) (-1629.792) (-1632.683) [-1632.999] * (-1632.755) (-1633.198) [-1630.946] (-1630.679) -- 0:00:53 232000 -- [-1632.102] (-1633.437) (-1631.832) (-1629.972) * (-1632.121) (-1631.974) [-1633.400] (-1635.417) -- 0:00:52 232500 -- (-1631.271) (-1630.577) (-1631.649) [-1629.286] * (-1630.658) [-1630.874] (-1635.033) (-1632.372) -- 0:00:52 233000 -- (-1630.648) (-1632.408) [-1632.712] (-1632.950) * (-1629.577) (-1632.916) [-1633.329] (-1633.126) -- 0:00:52 233500 -- (-1628.099) (-1632.449) (-1632.348) [-1633.967] * (-1631.376) (-1639.279) (-1629.404) [-1631.053] -- 0:00:52 234000 -- (-1630.495) (-1628.276) (-1632.681) [-1634.184] * (-1629.068) (-1634.330) (-1628.736) [-1630.364] -- 0:00:52 234500 -- (-1636.552) (-1630.344) [-1631.721] (-1633.080) * (-1629.680) (-1632.105) [-1628.725] (-1632.589) -- 0:00:52 235000 -- [-1636.020] (-1631.965) (-1631.281) (-1631.791) * (-1632.972) [-1630.022] (-1630.751) (-1631.601) -- 0:00:52 Average standard deviation of split frequencies: 0.019765 235500 -- (-1633.370) (-1628.916) (-1631.170) [-1629.951] * (-1634.472) (-1629.961) [-1629.916] (-1629.369) -- 0:00:51 236000 -- [-1634.250] (-1630.699) (-1632.708) (-1631.871) * (-1629.796) (-1632.645) (-1631.202) [-1628.679] -- 0:00:51 236500 -- (-1630.160) [-1630.257] (-1630.803) (-1631.265) * (-1630.587) [-1631.979] (-1628.647) (-1633.164) -- 0:00:51 237000 -- (-1630.462) (-1632.783) [-1629.420] (-1632.203) * (-1630.155) [-1632.727] (-1632.771) (-1630.302) -- 0:00:51 237500 -- [-1633.116] (-1636.616) (-1636.231) (-1633.416) * (-1632.273) [-1631.310] (-1631.633) (-1631.355) -- 0:00:51 238000 -- (-1629.530) (-1634.556) (-1632.964) [-1630.220] * (-1629.479) (-1630.298) [-1628.784] (-1634.540) -- 0:00:51 238500 -- (-1629.472) (-1631.616) (-1632.268) [-1630.057] * (-1630.297) (-1634.948) [-1629.291] (-1630.473) -- 0:00:51 239000 -- (-1629.899) (-1631.109) (-1633.605) [-1631.254] * (-1631.253) (-1631.613) (-1630.491) [-1631.279] -- 0:00:50 239500 -- (-1631.326) (-1629.515) [-1630.664] (-1630.541) * (-1629.805) (-1629.464) (-1630.760) [-1630.297] -- 0:00:50 240000 -- (-1631.924) [-1630.359] (-1628.193) (-1631.048) * (-1634.810) (-1628.772) (-1629.664) [-1632.050] -- 0:00:50 Average standard deviation of split frequencies: 0.020412 240500 -- [-1631.787] (-1631.162) (-1631.020) (-1631.430) * (-1630.168) (-1628.846) [-1630.242] (-1630.083) -- 0:00:50 241000 -- (-1632.027) (-1633.584) [-1630.861] (-1632.771) * [-1630.085] (-1628.958) (-1630.554) (-1631.221) -- 0:00:53 241500 -- (-1631.870) [-1637.872] (-1629.152) (-1630.607) * [-1627.974] (-1630.024) (-1630.889) (-1632.769) -- 0:00:53 242000 -- (-1629.150) (-1630.425) [-1628.413] (-1631.643) * (-1629.490) (-1632.459) [-1634.232] (-1631.183) -- 0:00:53 242500 -- (-1633.879) (-1630.185) [-1629.999] (-1628.783) * [-1630.518] (-1632.444) (-1632.700) (-1630.302) -- 0:00:53 243000 -- (-1630.971) (-1633.392) (-1631.360) [-1631.958] * [-1630.579] (-1633.687) (-1632.695) (-1630.658) -- 0:00:52 243500 -- (-1628.272) (-1632.555) (-1632.172) [-1629.837] * (-1631.330) (-1633.650) (-1634.418) [-1630.469] -- 0:00:52 244000 -- [-1630.431] (-1631.881) (-1630.920) (-1632.677) * [-1632.373] (-1633.921) (-1633.429) (-1632.205) -- 0:00:52 244500 -- [-1631.070] (-1630.175) (-1632.165) (-1629.013) * (-1630.061) (-1635.371) [-1629.792] (-1630.798) -- 0:00:52 245000 -- [-1631.185] (-1636.914) (-1630.366) (-1633.635) * (-1635.303) (-1631.755) [-1629.431] (-1633.387) -- 0:00:52 Average standard deviation of split frequencies: 0.020171 245500 -- (-1633.124) (-1630.872) [-1630.994] (-1632.347) * (-1631.234) [-1631.272] (-1636.131) (-1632.818) -- 0:00:52 246000 -- (-1630.877) (-1628.711) [-1636.726] (-1635.191) * [-1631.481] (-1635.074) (-1630.329) (-1629.781) -- 0:00:52 246500 -- (-1632.146) [-1629.748] (-1632.153) (-1629.020) * (-1630.284) (-1633.292) (-1632.696) [-1629.994] -- 0:00:51 247000 -- [-1632.020] (-1629.105) (-1631.618) (-1635.919) * [-1631.481] (-1634.173) (-1632.208) (-1634.669) -- 0:00:51 247500 -- (-1632.436) (-1630.404) [-1632.472] (-1632.692) * (-1630.213) (-1630.252) [-1629.415] (-1633.421) -- 0:00:51 248000 -- (-1634.643) (-1633.866) (-1631.735) [-1631.608] * (-1631.780) (-1630.735) (-1630.493) [-1630.128] -- 0:00:51 248500 -- (-1633.615) (-1629.227) (-1630.765) [-1633.952] * (-1632.624) (-1630.190) [-1630.557] (-1629.280) -- 0:00:51 249000 -- (-1639.992) [-1630.447] (-1632.226) (-1630.506) * (-1630.804) (-1630.938) (-1630.961) [-1630.952] -- 0:00:51 249500 -- (-1630.633) [-1630.584] (-1631.842) (-1629.679) * [-1632.487] (-1630.759) (-1628.997) (-1631.712) -- 0:00:51 250000 -- (-1630.920) [-1629.879] (-1634.698) (-1629.681) * [-1634.371] (-1632.211) (-1632.009) (-1631.909) -- 0:00:51 Average standard deviation of split frequencies: 0.019499 250500 -- (-1632.116) [-1633.191] (-1630.807) (-1630.570) * (-1629.858) (-1633.368) [-1631.115] (-1632.022) -- 0:00:50 251000 -- (-1634.036) (-1635.397) (-1631.767) [-1631.827] * (-1631.319) (-1631.656) (-1631.516) [-1633.212] -- 0:00:50 251500 -- (-1632.680) [-1631.129] (-1633.304) (-1630.340) * (-1632.499) (-1631.392) (-1630.246) [-1630.195] -- 0:00:50 252000 -- (-1632.893) [-1633.014] (-1635.960) (-1635.421) * (-1631.627) [-1630.051] (-1633.490) (-1632.149) -- 0:00:50 252500 -- (-1630.588) (-1629.167) [-1632.094] (-1629.567) * (-1631.937) [-1630.743] (-1629.868) (-1629.690) -- 0:00:50 253000 -- (-1631.310) (-1634.281) (-1634.577) [-1629.420] * (-1634.729) [-1631.891] (-1629.639) (-1630.700) -- 0:00:50 253500 -- (-1629.168) [-1635.523] (-1632.176) (-1629.848) * (-1635.791) (-1631.976) (-1629.958) [-1630.522] -- 0:00:50 254000 -- [-1631.525] (-1629.036) (-1630.137) (-1631.173) * (-1635.805) (-1632.582) [-1633.348] (-1632.460) -- 0:00:49 254500 -- [-1628.528] (-1630.724) (-1631.205) (-1632.649) * (-1634.321) (-1634.041) [-1633.033] (-1631.459) -- 0:00:49 255000 -- (-1630.710) (-1629.542) [-1631.657] (-1633.370) * (-1630.063) [-1632.277] (-1633.411) (-1637.100) -- 0:00:49 Average standard deviation of split frequencies: 0.018996 255500 -- (-1629.831) [-1631.380] (-1631.372) (-1628.954) * (-1629.544) [-1630.567] (-1632.507) (-1633.247) -- 0:00:52 256000 -- (-1634.225) (-1631.374) (-1631.321) [-1630.748] * (-1631.693) (-1630.156) [-1631.064] (-1632.470) -- 0:00:52 256500 -- (-1630.798) (-1630.534) (-1631.897) [-1629.990] * (-1632.373) (-1631.929) (-1628.947) [-1632.419] -- 0:00:52 257000 -- (-1630.452) (-1631.077) (-1633.678) [-1630.565] * [-1631.512] (-1631.905) (-1628.646) (-1630.361) -- 0:00:52 257500 -- (-1632.320) [-1632.931] (-1630.578) (-1629.708) * (-1633.513) (-1631.019) (-1629.871) [-1630.837] -- 0:00:51 258000 -- (-1629.281) (-1632.618) [-1636.219] (-1628.580) * (-1630.594) (-1631.352) (-1629.330) [-1631.316] -- 0:00:51 258500 -- (-1630.343) (-1631.945) (-1632.686) [-1629.178] * [-1630.973] (-1630.296) (-1630.358) (-1632.378) -- 0:00:51 259000 -- [-1629.735] (-1631.574) (-1632.455) (-1631.649) * (-1635.978) (-1630.606) (-1633.383) [-1629.974] -- 0:00:51 259500 -- (-1631.055) (-1632.387) (-1632.833) [-1631.954] * (-1636.656) [-1630.220] (-1633.377) (-1630.189) -- 0:00:51 260000 -- (-1632.128) [-1638.658] (-1630.116) (-1628.666) * [-1634.534] (-1631.742) (-1631.546) (-1634.648) -- 0:00:51 Average standard deviation of split frequencies: 0.017894 260500 -- (-1631.598) (-1632.028) (-1630.135) [-1632.548] * (-1632.668) (-1631.270) (-1629.490) [-1633.397] -- 0:00:51 261000 -- (-1632.907) (-1629.467) [-1630.084] (-1637.134) * (-1631.448) (-1631.965) (-1636.708) [-1630.511] -- 0:00:50 261500 -- [-1632.580] (-1631.020) (-1632.705) (-1630.522) * (-1631.434) (-1630.329) [-1630.896] (-1630.508) -- 0:00:50 262000 -- (-1637.628) (-1632.096) [-1630.913] (-1630.021) * [-1631.735] (-1632.356) (-1636.675) (-1630.286) -- 0:00:50 262500 -- [-1632.997] (-1633.047) (-1633.155) (-1632.924) * [-1630.151] (-1635.005) (-1632.778) (-1629.937) -- 0:00:50 263000 -- (-1632.886) (-1629.885) (-1633.982) [-1629.366] * (-1630.421) (-1632.353) (-1633.139) [-1633.608] -- 0:00:50 263500 -- [-1632.338] (-1628.769) (-1630.070) (-1630.314) * (-1632.135) (-1633.137) [-1630.942] (-1632.746) -- 0:00:50 264000 -- (-1630.618) (-1631.138) [-1630.244] (-1628.799) * (-1633.521) (-1632.948) [-1631.790] (-1630.425) -- 0:00:50 264500 -- [-1630.525] (-1628.978) (-1630.114) (-1628.139) * [-1633.080] (-1635.889) (-1630.388) (-1630.491) -- 0:00:50 265000 -- (-1631.064) (-1629.749) [-1631.754] (-1629.924) * (-1634.407) [-1634.234] (-1629.553) (-1632.462) -- 0:00:49 Average standard deviation of split frequencies: 0.016696 265500 -- [-1631.695] (-1632.155) (-1630.754) (-1632.282) * (-1631.704) (-1631.238) [-1633.034] (-1632.838) -- 0:00:49 266000 -- [-1628.605] (-1631.678) (-1630.039) (-1631.357) * (-1634.512) (-1630.633) [-1632.176] (-1634.626) -- 0:00:49 266500 -- (-1629.174) [-1630.791] (-1630.139) (-1630.905) * [-1630.690] (-1630.774) (-1631.067) (-1631.226) -- 0:00:49 267000 -- (-1630.244) (-1630.441) (-1631.092) [-1631.493] * (-1630.644) [-1630.593] (-1634.679) (-1631.463) -- 0:00:49 267500 -- [-1629.915] (-1630.629) (-1631.552) (-1631.041) * (-1633.068) (-1632.303) (-1634.552) [-1628.445] -- 0:00:49 268000 -- (-1634.790) (-1631.792) [-1630.157] (-1630.477) * (-1630.887) (-1630.524) [-1638.059] (-1628.782) -- 0:00:49 268500 -- [-1630.698] (-1631.005) (-1637.697) (-1632.221) * [-1631.497] (-1631.615) (-1632.576) (-1628.234) -- 0:00:49 269000 -- (-1631.680) (-1632.536) (-1631.573) [-1631.714] * (-1632.061) (-1630.412) [-1629.413] (-1631.539) -- 0:00:48 269500 -- (-1629.203) [-1628.296] (-1630.612) (-1631.136) * (-1630.600) (-1630.701) [-1630.172] (-1633.331) -- 0:00:48 270000 -- (-1633.843) (-1631.371) [-1633.461] (-1630.436) * (-1629.535) (-1630.012) [-1629.531] (-1633.395) -- 0:00:48 Average standard deviation of split frequencies: 0.017233 270500 -- (-1632.842) [-1630.458] (-1631.173) (-1635.357) * [-1630.445] (-1631.151) (-1630.314) (-1630.181) -- 0:00:51 271000 -- (-1630.553) (-1633.072) (-1635.299) [-1631.799] * (-1629.722) (-1629.198) (-1631.674) [-1627.609] -- 0:00:51 271500 -- (-1635.513) (-1629.040) (-1632.415) [-1632.265] * (-1632.214) (-1631.784) [-1630.570] (-1628.001) -- 0:00:50 272000 -- (-1633.262) (-1629.677) (-1630.175) [-1631.420] * (-1629.739) [-1630.560] (-1631.253) (-1629.015) -- 0:00:50 272500 -- (-1633.366) (-1632.748) [-1630.521] (-1629.603) * [-1630.534] (-1632.087) (-1634.660) (-1632.265) -- 0:00:50 273000 -- [-1632.218] (-1631.172) (-1630.096) (-1631.381) * [-1630.668] (-1630.155) (-1634.055) (-1632.656) -- 0:00:50 273500 -- (-1628.983) (-1630.921) [-1628.983] (-1630.315) * (-1631.096) (-1631.963) [-1631.320] (-1633.846) -- 0:00:50 274000 -- [-1630.069] (-1632.420) (-1630.545) (-1630.359) * [-1631.107] (-1632.837) (-1630.030) (-1630.303) -- 0:00:50 274500 -- [-1630.006] (-1633.433) (-1634.709) (-1630.762) * (-1630.805) (-1635.730) (-1633.107) [-1630.440] -- 0:00:50 275000 -- (-1630.635) (-1633.544) (-1637.253) [-1630.437] * (-1631.265) (-1632.424) [-1630.858] (-1631.163) -- 0:00:50 Average standard deviation of split frequencies: 0.016416 275500 -- [-1629.443] (-1633.065) (-1633.234) (-1630.005) * (-1629.931) [-1631.027] (-1629.831) (-1630.897) -- 0:00:49 276000 -- (-1632.478) (-1633.350) (-1631.330) [-1630.023] * (-1630.580) (-1630.691) (-1632.364) [-1630.743] -- 0:00:49 276500 -- (-1631.388) (-1633.228) (-1632.829) [-1630.088] * (-1630.411) (-1631.234) (-1632.177) [-1630.631] -- 0:00:49 277000 -- (-1629.962) (-1634.043) [-1631.076] (-1630.080) * (-1629.836) (-1632.376) (-1631.346) [-1630.761] -- 0:00:49 277500 -- (-1634.486) (-1629.685) (-1630.672) [-1630.538] * (-1630.042) [-1630.895] (-1631.879) (-1631.454) -- 0:00:49 278000 -- (-1631.332) (-1636.529) (-1630.019) [-1630.245] * (-1630.299) (-1634.500) (-1629.944) [-1632.724] -- 0:00:49 278500 -- [-1631.176] (-1630.157) (-1633.121) (-1632.466) * (-1630.168) (-1633.050) [-1633.894] (-1634.846) -- 0:00:49 279000 -- (-1630.418) (-1631.009) [-1628.255] (-1629.726) * [-1631.817] (-1631.767) (-1630.742) (-1632.627) -- 0:00:49 279500 -- (-1630.766) (-1631.316) [-1629.633] (-1629.147) * (-1630.872) (-1630.046) [-1632.196] (-1630.902) -- 0:00:48 280000 -- [-1631.262] (-1628.956) (-1632.763) (-1631.604) * (-1630.896) (-1631.718) [-1631.918] (-1630.870) -- 0:00:48 Average standard deviation of split frequencies: 0.016104 280500 -- (-1630.021) (-1630.748) (-1629.116) [-1629.786] * (-1633.309) (-1634.154) (-1631.004) [-1630.148] -- 0:00:48 281000 -- (-1630.055) (-1629.936) (-1630.983) [-1630.034] * (-1630.506) (-1631.777) (-1630.309) [-1633.064] -- 0:00:48 281500 -- (-1628.580) (-1630.426) [-1631.858] (-1630.607) * [-1629.072] (-1630.166) (-1632.626) (-1631.842) -- 0:00:48 282000 -- (-1632.713) (-1630.650) [-1629.668] (-1630.648) * [-1629.614] (-1630.562) (-1630.852) (-1630.335) -- 0:00:48 282500 -- (-1630.164) (-1630.913) (-1635.574) [-1636.277] * [-1631.539] (-1632.219) (-1629.515) (-1630.762) -- 0:00:48 283000 -- (-1631.805) (-1630.816) [-1630.318] (-1631.425) * (-1632.101) [-1631.348] (-1629.782) (-1632.292) -- 0:00:48 283500 -- [-1631.938] (-1630.104) (-1629.890) (-1630.159) * (-1633.077) (-1631.391) [-1629.889] (-1633.648) -- 0:00:48 284000 -- [-1629.457] (-1630.188) (-1628.166) (-1630.614) * (-1630.110) [-1630.232] (-1630.669) (-1633.975) -- 0:00:47 284500 -- (-1631.748) [-1631.327] (-1629.863) (-1630.665) * (-1631.075) (-1633.114) (-1631.848) [-1631.015] -- 0:00:47 285000 -- (-1630.093) (-1631.116) [-1628.190] (-1631.475) * (-1631.390) [-1630.701] (-1632.163) (-1630.806) -- 0:00:50 Average standard deviation of split frequencies: 0.016677 285500 -- [-1631.059] (-1636.018) (-1630.833) (-1631.530) * (-1630.077) [-1631.179] (-1631.506) (-1630.422) -- 0:00:50 286000 -- [-1629.891] (-1630.649) (-1629.005) (-1630.425) * (-1633.334) [-1631.651] (-1632.064) (-1631.791) -- 0:00:49 286500 -- (-1630.607) (-1631.204) (-1631.240) [-1629.595] * (-1630.022) (-1631.689) (-1632.122) [-1631.903] -- 0:00:49 287000 -- (-1629.329) (-1628.644) [-1631.404] (-1630.871) * (-1631.433) [-1631.481] (-1637.034) (-1633.054) -- 0:00:49 287500 -- [-1628.811] (-1633.708) (-1633.854) (-1630.181) * (-1630.837) (-1631.505) [-1631.482] (-1635.783) -- 0:00:49 288000 -- [-1628.825] (-1634.492) (-1629.954) (-1633.293) * (-1632.480) [-1634.018] (-1630.286) (-1630.921) -- 0:00:49 288500 -- (-1629.856) (-1632.251) [-1629.576] (-1633.314) * (-1629.995) [-1631.741] (-1630.275) (-1630.219) -- 0:00:49 289000 -- (-1631.244) (-1634.388) (-1634.246) [-1631.005] * (-1630.639) (-1635.867) (-1630.894) [-1629.870] -- 0:00:49 289500 -- [-1632.430] (-1634.559) (-1631.365) (-1629.980) * (-1630.613) [-1633.365] (-1631.003) (-1632.360) -- 0:00:49 290000 -- (-1629.572) (-1635.621) [-1632.762] (-1629.236) * (-1631.171) [-1632.496] (-1633.533) (-1631.556) -- 0:00:48 Average standard deviation of split frequencies: 0.016218 290500 -- (-1629.214) (-1630.650) [-1628.908] (-1633.095) * (-1629.653) [-1629.527] (-1633.706) (-1632.777) -- 0:00:48 291000 -- (-1630.577) (-1631.563) [-1630.176] (-1633.349) * [-1634.911] (-1632.055) (-1633.946) (-1632.244) -- 0:00:48 291500 -- (-1634.288) (-1633.507) [-1629.638] (-1632.829) * (-1631.771) (-1632.432) (-1636.922) [-1631.373] -- 0:00:48 292000 -- (-1634.970) (-1630.769) (-1629.280) [-1630.722] * (-1631.019) [-1629.799] (-1631.544) (-1630.159) -- 0:00:48 292500 -- [-1633.424] (-1632.855) (-1632.013) (-1631.609) * (-1633.516) (-1632.493) [-1632.048] (-1630.461) -- 0:00:48 293000 -- [-1630.246] (-1631.520) (-1631.322) (-1630.345) * [-1632.395] (-1630.279) (-1636.957) (-1631.211) -- 0:00:48 293500 -- [-1631.671] (-1631.116) (-1631.348) (-1632.514) * (-1633.478) (-1633.980) [-1630.921] (-1630.978) -- 0:00:48 294000 -- [-1631.688] (-1631.292) (-1630.889) (-1630.794) * (-1634.626) [-1630.463] (-1632.315) (-1632.944) -- 0:00:48 294500 -- (-1630.664) (-1632.422) (-1634.734) [-1630.056] * [-1629.512] (-1631.057) (-1633.205) (-1630.137) -- 0:00:47 295000 -- (-1634.590) (-1628.480) [-1635.514] (-1629.022) * [-1630.498] (-1633.772) (-1633.875) (-1629.677) -- 0:00:47 Average standard deviation of split frequencies: 0.018414 295500 -- [-1630.824] (-1628.745) (-1630.173) (-1630.794) * (-1632.327) (-1632.723) [-1630.608] (-1629.547) -- 0:00:47 296000 -- (-1634.237) (-1628.393) (-1630.466) [-1630.343] * (-1635.111) (-1630.878) [-1630.690] (-1637.086) -- 0:00:47 296500 -- (-1633.247) (-1629.640) (-1634.633) [-1631.706] * [-1633.345] (-1631.168) (-1631.820) (-1637.884) -- 0:00:47 297000 -- (-1632.512) (-1633.568) (-1637.471) [-1629.277] * (-1630.404) (-1633.514) [-1630.292] (-1635.555) -- 0:00:47 297500 -- (-1631.622) [-1633.190] (-1629.188) (-1629.839) * (-1631.382) [-1631.068] (-1631.205) (-1630.209) -- 0:00:47 298000 -- (-1632.284) (-1633.243) (-1634.323) [-1631.768] * [-1629.683] (-1630.353) (-1630.018) (-1630.167) -- 0:00:47 298500 -- [-1631.816] (-1630.564) (-1633.478) (-1630.926) * (-1631.700) (-1630.939) [-1630.754] (-1630.978) -- 0:00:47 299000 -- (-1630.092) (-1629.359) (-1633.583) [-1630.165] * (-1630.829) (-1632.666) (-1633.878) [-1631.827] -- 0:00:46 299500 -- (-1630.035) (-1635.615) [-1631.470] (-1634.773) * (-1633.558) [-1630.144] (-1630.830) (-1629.492) -- 0:00:46 300000 -- [-1629.502] (-1631.084) (-1634.685) (-1630.918) * (-1630.750) (-1631.688) (-1631.471) [-1629.865] -- 0:00:48 Average standard deviation of split frequencies: 0.015955 300500 -- (-1629.623) (-1631.272) [-1634.575] (-1631.281) * (-1630.680) (-1629.224) [-1630.222] (-1632.685) -- 0:00:48 301000 -- (-1628.522) (-1632.405) (-1639.556) [-1631.709] * [-1630.715] (-1635.937) (-1629.220) (-1630.606) -- 0:00:48 301500 -- [-1630.872] (-1629.968) (-1637.112) (-1631.883) * (-1633.125) [-1628.298] (-1629.981) (-1630.038) -- 0:00:48 302000 -- [-1630.427] (-1630.550) (-1630.591) (-1628.083) * (-1630.450) [-1630.441] (-1630.759) (-1629.951) -- 0:00:48 302500 -- [-1629.135] (-1630.439) (-1635.306) (-1633.531) * [-1630.937] (-1628.921) (-1631.724) (-1630.495) -- 0:00:48 303000 -- [-1631.140] (-1629.820) (-1633.397) (-1634.711) * (-1635.235) (-1630.706) [-1629.824] (-1630.488) -- 0:00:48 303500 -- (-1636.057) (-1629.672) [-1636.554] (-1640.089) * (-1632.518) (-1631.201) [-1631.958] (-1630.104) -- 0:00:48 304000 -- [-1631.015] (-1631.912) (-1632.002) (-1636.241) * (-1631.124) [-1631.046] (-1630.445) (-1631.909) -- 0:00:48 304500 -- (-1630.959) [-1628.896] (-1630.843) (-1632.471) * (-1630.767) (-1630.514) [-1632.408] (-1629.608) -- 0:00:47 305000 -- (-1631.564) (-1630.619) (-1630.352) [-1630.137] * (-1631.270) (-1630.049) [-1630.418] (-1633.660) -- 0:00:47 Average standard deviation of split frequencies: 0.015405 305500 -- (-1633.191) (-1630.306) [-1629.334] (-1630.361) * (-1630.262) [-1630.116] (-1628.888) (-1633.484) -- 0:00:47 306000 -- [-1630.957] (-1629.685) (-1631.423) (-1631.692) * [-1633.582] (-1629.937) (-1630.616) (-1633.648) -- 0:00:47 306500 -- (-1631.322) (-1630.063) (-1630.627) [-1630.348] * (-1631.012) (-1629.362) [-1631.744] (-1631.956) -- 0:00:47 307000 -- (-1630.377) [-1629.645] (-1633.911) (-1626.954) * (-1631.290) (-1634.272) [-1631.045] (-1631.074) -- 0:00:47 307500 -- [-1630.844] (-1629.492) (-1634.530) (-1632.821) * (-1629.570) (-1632.622) (-1631.765) [-1632.657] -- 0:00:47 308000 -- (-1634.327) (-1631.893) (-1630.745) [-1630.985] * (-1628.206) (-1630.141) [-1630.896] (-1627.986) -- 0:00:47 308500 -- [-1632.998] (-1628.940) (-1630.177) (-1629.574) * (-1635.747) (-1631.424) [-1631.455] (-1629.855) -- 0:00:47 309000 -- (-1629.686) (-1630.745) [-1635.410] (-1632.094) * (-1633.400) (-1633.031) [-1631.987] (-1631.054) -- 0:00:46 309500 -- (-1632.348) (-1630.501) (-1636.292) [-1630.686] * (-1631.287) (-1630.937) (-1630.938) [-1631.557] -- 0:00:46 310000 -- [-1630.860] (-1634.244) (-1631.110) (-1632.446) * (-1636.142) [-1632.315] (-1629.111) (-1629.065) -- 0:00:46 Average standard deviation of split frequencies: 0.015888 310500 -- (-1632.113) (-1631.851) (-1630.316) [-1633.110] * [-1633.106] (-1633.166) (-1630.862) (-1635.220) -- 0:00:46 311000 -- [-1628.087] (-1630.947) (-1633.763) (-1628.720) * [-1633.249] (-1633.517) (-1628.970) (-1630.363) -- 0:00:46 311500 -- [-1630.460] (-1630.751) (-1633.116) (-1628.615) * (-1633.083) (-1631.633) (-1630.974) [-1628.483] -- 0:00:46 312000 -- (-1636.763) (-1634.403) (-1634.508) [-1630.350] * (-1635.352) (-1632.395) (-1632.259) [-1628.970] -- 0:00:46 312500 -- (-1632.608) (-1631.673) [-1631.295] (-1629.119) * [-1631.567] (-1628.884) (-1630.550) (-1629.205) -- 0:00:46 313000 -- (-1634.400) [-1631.469] (-1631.753) (-1629.826) * (-1630.326) (-1630.338) [-1630.976] (-1629.127) -- 0:00:46 313500 -- (-1637.094) (-1631.691) [-1631.447] (-1629.752) * (-1630.969) [-1632.979] (-1632.381) (-1628.395) -- 0:00:45 314000 -- (-1633.983) [-1634.396] (-1631.397) (-1631.806) * (-1630.504) [-1632.646] (-1631.678) (-1630.930) -- 0:00:45 314500 -- (-1635.624) (-1629.966) [-1631.001] (-1629.989) * [-1631.083] (-1631.300) (-1632.088) (-1631.602) -- 0:00:47 315000 -- (-1630.290) (-1632.771) (-1629.774) [-1629.808] * [-1630.054] (-1631.494) (-1630.477) (-1628.963) -- 0:00:47 Average standard deviation of split frequencies: 0.016410 315500 -- [-1631.059] (-1631.143) (-1631.625) (-1630.919) * [-1631.614] (-1630.638) (-1630.926) (-1630.608) -- 0:00:47 316000 -- [-1630.591] (-1636.434) (-1633.531) (-1629.278) * (-1630.685) (-1627.787) [-1631.791] (-1629.562) -- 0:00:47 316500 -- (-1629.089) (-1631.826) [-1630.768] (-1631.866) * [-1630.597] (-1628.750) (-1630.284) (-1632.599) -- 0:00:47 317000 -- [-1629.716] (-1630.585) (-1631.321) (-1630.177) * [-1630.948] (-1632.372) (-1628.433) (-1629.174) -- 0:00:47 317500 -- (-1630.899) (-1630.726) [-1628.641] (-1633.622) * (-1629.189) (-1632.346) [-1629.343] (-1631.057) -- 0:00:47 318000 -- (-1630.324) (-1630.655) [-1630.619] (-1638.367) * (-1629.832) (-1630.152) [-1630.860] (-1631.553) -- 0:00:47 318500 -- [-1631.831] (-1630.549) (-1633.242) (-1632.362) * (-1629.792) (-1630.381) [-1630.651] (-1629.928) -- 0:00:47 319000 -- [-1629.964] (-1632.773) (-1632.431) (-1630.590) * (-1629.789) [-1630.940] (-1631.661) (-1629.564) -- 0:00:46 319500 -- [-1629.975] (-1630.505) (-1633.444) (-1633.273) * (-1630.020) (-1628.961) (-1632.701) [-1629.229] -- 0:00:46 320000 -- (-1632.829) [-1633.585] (-1633.401) (-1634.281) * (-1633.246) (-1629.718) (-1630.572) [-1629.154] -- 0:00:46 Average standard deviation of split frequencies: 0.014787 320500 -- (-1631.567) (-1632.400) [-1631.619] (-1635.527) * (-1630.664) [-1629.310] (-1628.626) (-1629.593) -- 0:00:46 321000 -- [-1631.609] (-1631.114) (-1631.493) (-1636.829) * (-1634.571) (-1632.110) (-1628.589) [-1630.398] -- 0:00:46 321500 -- [-1630.973] (-1631.359) (-1630.960) (-1632.995) * (-1633.136) [-1628.511] (-1628.391) (-1632.149) -- 0:00:46 322000 -- (-1634.129) (-1631.037) (-1630.954) [-1630.320] * (-1632.858) [-1629.972] (-1632.015) (-1631.466) -- 0:00:46 322500 -- (-1631.444) (-1632.015) (-1633.798) [-1630.829] * [-1631.065] (-1633.689) (-1627.885) (-1631.750) -- 0:00:46 323000 -- (-1632.427) [-1630.703] (-1629.150) (-1629.909) * (-1630.391) [-1629.994] (-1629.530) (-1630.895) -- 0:00:46 323500 -- (-1632.916) [-1630.586] (-1631.777) (-1634.959) * (-1631.010) (-1629.570) [-1629.506] (-1631.234) -- 0:00:46 324000 -- [-1633.104] (-1632.615) (-1635.065) (-1631.759) * (-1635.724) [-1631.212] (-1630.377) (-1629.078) -- 0:00:45 324500 -- [-1631.887] (-1632.047) (-1629.208) (-1632.028) * (-1631.327) (-1630.962) [-1627.811] (-1634.661) -- 0:00:45 325000 -- (-1630.429) (-1632.290) (-1635.293) [-1631.027] * (-1630.935) (-1632.312) [-1628.002] (-1631.303) -- 0:00:45 Average standard deviation of split frequencies: 0.014460 325500 -- (-1630.697) (-1630.185) (-1631.597) [-1630.650] * [-1630.556] (-1630.051) (-1629.744) (-1631.068) -- 0:00:45 326000 -- (-1629.842) [-1629.069] (-1630.020) (-1630.581) * (-1630.702) (-1638.220) (-1632.458) [-1633.835] -- 0:00:45 326500 -- (-1629.946) [-1629.634] (-1629.962) (-1630.661) * [-1632.438] (-1631.058) (-1631.190) (-1630.770) -- 0:00:45 327000 -- (-1630.325) [-1630.976] (-1629.832) (-1633.418) * (-1630.014) [-1631.633] (-1631.846) (-1633.780) -- 0:00:45 327500 -- (-1630.493) (-1631.450) (-1632.625) [-1628.918] * (-1629.281) [-1629.158] (-1630.446) (-1630.737) -- 0:00:45 328000 -- (-1631.729) (-1631.047) (-1633.317) [-1628.783] * [-1633.113] (-1631.552) (-1630.538) (-1633.656) -- 0:00:45 328500 -- (-1630.388) [-1629.584] (-1632.230) (-1632.976) * (-1633.131) (-1630.702) (-1630.097) [-1633.371] -- 0:00:44 329000 -- (-1630.881) [-1630.102] (-1631.393) (-1633.450) * [-1630.110] (-1629.326) (-1629.741) (-1631.066) -- 0:00:46 329500 -- (-1631.094) [-1630.542] (-1629.145) (-1632.931) * [-1630.520] (-1634.901) (-1630.648) (-1631.331) -- 0:00:46 330000 -- [-1631.165] (-1630.798) (-1630.646) (-1630.992) * (-1631.213) (-1631.412) (-1629.748) [-1630.850] -- 0:00:46 Average standard deviation of split frequencies: 0.013753 330500 -- (-1635.579) (-1630.546) [-1631.367] (-1632.467) * (-1628.788) (-1631.132) (-1632.477) [-1633.054] -- 0:00:46 331000 -- (-1632.711) (-1630.075) (-1631.877) [-1631.354] * (-1629.835) (-1634.164) [-1630.166] (-1629.820) -- 0:00:46 331500 -- [-1632.636] (-1631.560) (-1633.258) (-1630.181) * [-1629.445] (-1632.991) (-1631.112) (-1630.808) -- 0:00:46 332000 -- (-1632.614) (-1632.387) (-1629.918) [-1628.615] * [-1629.547] (-1632.264) (-1632.206) (-1632.070) -- 0:00:46 332500 -- (-1630.131) (-1629.575) [-1631.809] (-1628.304) * (-1629.653) [-1629.200] (-1630.789) (-1632.932) -- 0:00:46 333000 -- (-1631.930) [-1630.598] (-1630.244) (-1631.320) * (-1633.716) (-1631.003) (-1631.656) [-1632.760] -- 0:00:46 333500 -- (-1632.622) [-1631.049] (-1632.663) (-1630.364) * (-1630.299) (-1630.069) (-1629.874) [-1630.399] -- 0:00:45 334000 -- (-1632.606) [-1631.055] (-1631.898) (-1629.538) * (-1630.177) (-1628.714) (-1630.335) [-1628.649] -- 0:00:45 334500 -- (-1630.109) (-1631.073) (-1630.201) [-1630.846] * (-1631.813) (-1631.571) [-1631.762] (-1632.405) -- 0:00:45 335000 -- (-1632.420) (-1631.599) (-1630.668) [-1630.119] * (-1632.685) [-1633.005] (-1630.105) (-1632.281) -- 0:00:45 Average standard deviation of split frequencies: 0.014644 335500 -- (-1632.115) (-1632.472) (-1632.381) [-1630.254] * [-1629.264] (-1629.171) (-1632.268) (-1630.860) -- 0:00:45 336000 -- (-1633.450) [-1630.634] (-1633.600) (-1631.029) * (-1629.705) (-1631.957) [-1630.178] (-1630.234) -- 0:00:45 336500 -- (-1631.835) (-1632.672) (-1631.406) [-1628.959] * (-1630.644) (-1632.842) [-1630.523] (-1629.794) -- 0:00:45 337000 -- (-1630.549) (-1635.613) [-1628.601] (-1630.404) * (-1630.076) [-1631.873] (-1631.676) (-1630.150) -- 0:00:45 337500 -- (-1631.225) [-1632.060] (-1630.877) (-1628.968) * [-1631.621] (-1633.022) (-1632.361) (-1631.880) -- 0:00:45 338000 -- [-1630.069] (-1631.503) (-1628.558) (-1628.938) * (-1631.337) (-1627.659) (-1630.635) [-1633.265] -- 0:00:45 338500 -- (-1630.066) (-1629.409) [-1631.629] (-1632.074) * [-1629.550] (-1629.891) (-1630.164) (-1628.735) -- 0:00:44 339000 -- (-1630.246) (-1630.277) (-1630.247) [-1632.522] * (-1630.485) (-1629.848) (-1631.276) [-1629.054] -- 0:00:44 339500 -- (-1631.938) (-1633.150) [-1630.142] (-1634.490) * [-1630.097] (-1630.804) (-1632.559) (-1630.013) -- 0:00:44 340000 -- (-1631.783) (-1631.917) (-1629.025) [-1632.040] * (-1630.859) (-1631.085) (-1637.606) [-1629.773] -- 0:00:44 Average standard deviation of split frequencies: 0.013578 340500 -- (-1632.630) [-1630.115] (-1633.314) (-1634.675) * [-1631.090] (-1630.938) (-1632.109) (-1632.776) -- 0:00:44 341000 -- (-1631.202) (-1629.613) [-1632.628] (-1630.691) * (-1632.066) (-1632.828) (-1631.618) [-1629.133] -- 0:00:44 341500 -- (-1630.742) (-1631.362) (-1633.851) [-1631.574] * (-1631.152) [-1635.094] (-1633.297) (-1631.328) -- 0:00:44 342000 -- [-1629.561] (-1629.944) (-1634.784) (-1630.273) * (-1633.028) (-1630.380) (-1635.183) [-1631.111] -- 0:00:44 342500 -- (-1631.941) (-1628.051) [-1633.296] (-1629.724) * [-1631.992] (-1630.918) (-1633.357) (-1632.384) -- 0:00:44 343000 -- [-1632.618] (-1630.213) (-1631.932) (-1631.948) * [-1630.410] (-1633.337) (-1630.173) (-1632.212) -- 0:00:44 343500 -- (-1632.489) (-1634.581) (-1630.773) [-1630.739] * (-1635.873) (-1630.347) [-1629.864] (-1630.855) -- 0:00:45 344000 -- (-1634.123) [-1630.665] (-1631.619) (-1630.781) * (-1630.356) (-1629.965) [-1629.935] (-1630.462) -- 0:00:45 344500 -- (-1636.849) (-1630.548) (-1631.088) [-1629.092] * (-1630.356) [-1630.380] (-1630.084) (-1630.299) -- 0:00:45 345000 -- (-1632.168) (-1632.183) (-1631.544) [-1629.691] * (-1632.424) [-1632.999] (-1629.883) (-1632.416) -- 0:00:45 Average standard deviation of split frequencies: 0.012342 345500 -- [-1630.135] (-1637.089) (-1631.867) (-1630.492) * (-1629.823) [-1631.012] (-1631.292) (-1629.773) -- 0:00:45 346000 -- (-1630.514) (-1639.347) (-1631.174) [-1634.134] * (-1630.509) (-1633.156) (-1629.819) [-1630.984] -- 0:00:45 346500 -- [-1630.820] (-1630.098) (-1630.963) (-1634.512) * [-1630.026] (-1629.843) (-1631.355) (-1631.732) -- 0:00:45 347000 -- [-1631.557] (-1629.127) (-1631.154) (-1630.032) * (-1630.425) [-1632.279] (-1637.111) (-1635.578) -- 0:00:45 347500 -- (-1629.053) [-1629.989] (-1630.519) (-1630.255) * (-1630.714) (-1633.109) [-1636.561] (-1634.495) -- 0:00:45 348000 -- (-1629.431) (-1629.410) [-1631.175] (-1630.539) * [-1630.605] (-1631.045) (-1634.451) (-1632.746) -- 0:00:44 348500 -- (-1629.302) (-1631.101) [-1630.977] (-1631.491) * (-1631.929) (-1633.088) (-1633.248) [-1634.351] -- 0:00:44 349000 -- (-1628.919) (-1636.702) [-1631.860] (-1631.077) * (-1632.269) (-1633.936) [-1633.478] (-1632.042) -- 0:00:44 349500 -- (-1632.300) [-1628.906] (-1632.595) (-1633.261) * (-1631.065) (-1629.415) [-1629.998] (-1630.550) -- 0:00:44 350000 -- (-1628.967) [-1630.760] (-1632.405) (-1630.634) * (-1631.899) [-1633.112] (-1631.339) (-1631.329) -- 0:00:44 Average standard deviation of split frequencies: 0.012351 350500 -- (-1629.676) [-1629.725] (-1629.988) (-1631.333) * [-1631.093] (-1635.207) (-1631.650) (-1630.543) -- 0:00:44 351000 -- (-1632.606) [-1629.648] (-1629.051) (-1633.342) * [-1631.747] (-1634.279) (-1630.880) (-1629.796) -- 0:00:44 351500 -- (-1634.030) [-1633.983] (-1630.975) (-1632.928) * (-1631.903) (-1630.391) [-1630.022] (-1632.028) -- 0:00:44 352000 -- (-1631.792) [-1633.991] (-1633.067) (-1630.378) * [-1630.878] (-1629.015) (-1629.945) (-1633.055) -- 0:00:44 352500 -- (-1632.371) [-1631.831] (-1632.667) (-1635.581) * (-1630.896) (-1628.850) [-1629.136] (-1633.297) -- 0:00:44 353000 -- (-1632.017) (-1628.759) (-1630.986) [-1632.155] * (-1630.891) (-1628.926) (-1629.606) [-1630.648] -- 0:00:43 353500 -- [-1629.966] (-1631.354) (-1630.969) (-1637.503) * [-1632.803] (-1630.121) (-1630.066) (-1631.473) -- 0:00:43 354000 -- (-1631.042) (-1635.314) [-1630.147] (-1632.761) * (-1630.791) (-1630.772) (-1630.534) [-1630.907] -- 0:00:43 354500 -- [-1631.376] (-1633.336) (-1632.740) (-1632.680) * (-1630.079) (-1632.260) [-1632.069] (-1630.070) -- 0:00:43 355000 -- (-1631.625) (-1630.706) [-1631.739] (-1634.040) * (-1630.870) (-1634.483) [-1632.734] (-1632.721) -- 0:00:43 Average standard deviation of split frequencies: 0.012580 355500 -- (-1629.714) (-1629.827) [-1631.161] (-1634.821) * [-1630.059] (-1630.092) (-1629.949) (-1632.319) -- 0:00:43 356000 -- (-1629.913) (-1632.344) (-1632.727) [-1630.684] * (-1633.374) (-1632.644) (-1630.711) [-1629.711] -- 0:00:43 356500 -- (-1630.390) (-1634.607) [-1631.084] (-1632.326) * [-1634.128] (-1631.638) (-1630.030) (-1633.903) -- 0:00:43 357000 -- [-1630.348] (-1632.842) (-1628.035) (-1631.471) * (-1634.615) (-1630.855) [-1630.400] (-1631.971) -- 0:00:43 357500 -- [-1629.053] (-1629.578) (-1629.216) (-1634.776) * [-1632.071] (-1630.525) (-1633.966) (-1631.901) -- 0:00:43 358000 -- [-1633.553] (-1632.995) (-1637.013) (-1630.168) * (-1629.563) (-1629.110) (-1633.691) [-1630.327] -- 0:00:43 358500 -- [-1632.537] (-1630.904) (-1631.746) (-1634.635) * (-1632.280) (-1631.586) [-1630.027] (-1631.025) -- 0:00:44 359000 -- (-1630.830) (-1631.710) (-1633.013) [-1632.285] * (-1632.073) (-1630.653) (-1630.212) [-1630.978] -- 0:00:44 359500 -- [-1632.013] (-1632.238) (-1633.023) (-1634.810) * (-1631.224) (-1631.093) [-1633.406] (-1630.420) -- 0:00:44 360000 -- (-1630.431) [-1630.089] (-1632.712) (-1630.528) * [-1632.153] (-1633.000) (-1630.418) (-1630.258) -- 0:00:44 Average standard deviation of split frequencies: 0.012225 360500 -- (-1640.030) [-1632.565] (-1632.070) (-1630.162) * (-1631.781) [-1630.841] (-1630.809) (-1634.863) -- 0:00:44 361000 -- (-1629.605) [-1633.040] (-1632.627) (-1631.954) * (-1635.258) (-1630.309) (-1631.347) [-1636.743] -- 0:00:44 361500 -- (-1631.332) (-1630.072) [-1629.237] (-1633.134) * [-1632.665] (-1630.460) (-1631.312) (-1632.178) -- 0:00:44 362000 -- [-1629.169] (-1631.936) (-1630.366) (-1632.574) * (-1632.267) (-1631.866) (-1631.004) [-1628.983] -- 0:00:44 362500 -- (-1630.333) (-1629.300) [-1630.872] (-1630.946) * (-1631.251) [-1631.135] (-1632.867) (-1628.468) -- 0:00:43 363000 -- (-1630.405) (-1631.755) [-1631.156] (-1632.325) * (-1633.095) (-1630.235) (-1630.020) [-1629.847] -- 0:00:43 363500 -- (-1629.630) [-1629.419] (-1630.646) (-1630.312) * (-1636.759) (-1630.019) (-1629.469) [-1632.596] -- 0:00:43 364000 -- [-1631.171] (-1630.952) (-1633.521) (-1634.031) * [-1635.111] (-1628.705) (-1632.730) (-1631.010) -- 0:00:43 364500 -- (-1627.994) (-1631.297) [-1627.759] (-1630.220) * [-1631.574] (-1630.463) (-1632.582) (-1631.415) -- 0:00:43 365000 -- [-1628.835] (-1632.336) (-1630.111) (-1630.800) * (-1632.389) [-1630.671] (-1630.082) (-1631.186) -- 0:00:43 Average standard deviation of split frequencies: 0.012501 365500 -- (-1637.492) [-1633.555] (-1628.435) (-1631.303) * [-1631.806] (-1632.139) (-1633.850) (-1631.144) -- 0:00:43 366000 -- [-1632.950] (-1632.995) (-1632.206) (-1632.491) * (-1631.366) [-1629.517] (-1634.183) (-1630.357) -- 0:00:43 366500 -- (-1631.967) (-1633.192) [-1630.532] (-1632.752) * [-1630.281] (-1630.604) (-1633.777) (-1634.551) -- 0:00:43 367000 -- (-1632.935) (-1634.106) [-1629.272] (-1631.742) * (-1635.210) (-1631.027) [-1630.949] (-1634.076) -- 0:00:43 367500 -- (-1633.050) [-1629.901] (-1630.346) (-1630.240) * (-1632.234) (-1633.767) [-1628.462] (-1630.797) -- 0:00:43 368000 -- [-1633.712] (-1632.778) (-1633.453) (-1631.710) * (-1632.302) (-1631.702) (-1629.336) [-1634.715] -- 0:00:42 368500 -- [-1632.766] (-1633.119) (-1631.131) (-1631.862) * (-1629.712) (-1631.154) (-1630.856) [-1631.010] -- 0:00:42 369000 -- (-1630.250) (-1632.902) [-1631.770] (-1631.384) * (-1628.782) [-1628.745] (-1630.244) (-1632.405) -- 0:00:42 369500 -- (-1629.962) (-1632.780) [-1631.594] (-1630.532) * (-1630.466) (-1628.443) (-1632.131) [-1634.526] -- 0:00:42 370000 -- (-1631.564) [-1629.935] (-1631.419) (-1632.511) * [-1629.496] (-1633.626) (-1629.330) (-1631.387) -- 0:00:42 Average standard deviation of split frequencies: 0.012643 370500 -- [-1628.251] (-1630.776) (-1636.054) (-1632.294) * [-1630.289] (-1634.183) (-1630.312) (-1630.492) -- 0:00:42 371000 -- [-1629.676] (-1629.600) (-1632.791) (-1631.050) * (-1630.132) (-1633.644) [-1633.014] (-1632.475) -- 0:00:42 371500 -- [-1634.988] (-1630.709) (-1632.583) (-1631.583) * (-1634.685) [-1630.437] (-1630.393) (-1631.647) -- 0:00:42 372000 -- (-1630.176) (-1630.235) [-1629.518] (-1631.001) * (-1634.889) (-1630.739) (-1629.092) [-1629.729] -- 0:00:42 372500 -- (-1632.829) (-1631.944) (-1632.369) [-1630.239] * (-1633.850) [-1630.055] (-1631.144) (-1632.267) -- 0:00:42 373000 -- (-1633.888) (-1633.083) (-1630.843) [-1628.154] * [-1629.955] (-1634.560) (-1629.451) (-1636.929) -- 0:00:43 373500 -- (-1630.946) (-1633.319) (-1631.251) [-1629.217] * (-1630.580) (-1631.937) (-1628.372) [-1631.682] -- 0:00:43 374000 -- (-1632.787) (-1630.572) (-1631.322) [-1630.152] * (-1632.259) [-1631.697] (-1630.383) (-1634.541) -- 0:00:43 374500 -- (-1630.763) (-1637.406) (-1635.861) [-1631.145] * (-1636.213) (-1634.518) (-1633.179) [-1633.418] -- 0:00:43 375000 -- (-1632.133) (-1635.423) (-1630.604) [-1630.446] * (-1630.946) (-1634.161) (-1634.039) [-1633.719] -- 0:00:43 Average standard deviation of split frequencies: 0.013201 375500 -- (-1630.216) (-1631.992) (-1632.776) [-1631.983] * [-1631.316] (-1634.178) (-1633.408) (-1631.038) -- 0:00:43 376000 -- (-1634.335) [-1631.396] (-1632.634) (-1631.685) * (-1631.010) (-1633.848) [-1630.422] (-1629.136) -- 0:00:43 376500 -- (-1632.789) [-1631.866] (-1630.573) (-1632.166) * (-1629.240) (-1630.602) [-1630.832] (-1629.947) -- 0:00:43 377000 -- (-1632.248) [-1632.649] (-1632.798) (-1638.648) * [-1629.152] (-1630.976) (-1631.278) (-1632.387) -- 0:00:42 377500 -- (-1630.325) (-1632.433) [-1630.107] (-1633.468) * (-1631.883) (-1631.708) [-1628.907] (-1635.751) -- 0:00:42 378000 -- [-1629.078] (-1631.481) (-1632.947) (-1631.955) * (-1631.607) (-1630.772) (-1629.323) [-1632.462] -- 0:00:42 378500 -- (-1631.476) [-1632.308] (-1632.006) (-1630.298) * [-1632.557] (-1630.866) (-1629.925) (-1630.362) -- 0:00:42 379000 -- (-1630.272) [-1634.519] (-1631.622) (-1629.227) * (-1630.543) (-1630.774) (-1632.232) [-1632.699] -- 0:00:42 379500 -- (-1630.184) (-1630.848) (-1631.254) [-1631.006] * (-1630.669) (-1629.419) (-1632.537) [-1630.715] -- 0:00:42 380000 -- [-1631.486] (-1630.327) (-1634.135) (-1629.465) * (-1631.730) [-1630.421] (-1632.212) (-1633.752) -- 0:00:42 Average standard deviation of split frequencies: 0.013003 380500 -- [-1630.527] (-1631.123) (-1634.130) (-1629.070) * [-1630.027] (-1632.548) (-1632.988) (-1633.365) -- 0:00:42 381000 -- (-1632.731) (-1630.090) [-1631.241] (-1630.315) * (-1633.103) (-1632.515) [-1631.484] (-1633.232) -- 0:00:42 381500 -- (-1630.653) [-1634.899] (-1628.796) (-1629.806) * (-1630.632) (-1631.876) (-1630.398) [-1629.277] -- 0:00:42 382000 -- [-1629.066] (-1632.226) (-1628.906) (-1633.778) * (-1630.160) (-1629.997) (-1632.490) [-1631.286] -- 0:00:42 382500 -- (-1633.039) [-1634.107] (-1629.994) (-1630.602) * (-1630.386) (-1631.234) (-1631.532) [-1630.075] -- 0:00:41 383000 -- [-1629.131] (-1633.417) (-1631.205) (-1629.511) * (-1629.781) [-1630.440] (-1633.131) (-1630.388) -- 0:00:41 383500 -- [-1628.999] (-1632.253) (-1630.019) (-1632.288) * (-1631.293) [-1630.823] (-1630.337) (-1630.061) -- 0:00:41 384000 -- (-1630.799) (-1633.997) (-1633.188) [-1630.752] * (-1630.102) (-1629.820) [-1630.933] (-1629.117) -- 0:00:41 384500 -- [-1630.691] (-1634.456) (-1633.544) (-1632.595) * (-1632.661) (-1633.781) [-1630.206] (-1631.109) -- 0:00:41 385000 -- [-1631.884] (-1635.921) (-1633.228) (-1632.963) * (-1631.930) (-1632.463) [-1630.499] (-1631.017) -- 0:00:41 Average standard deviation of split frequencies: 0.013434 385500 -- (-1632.327) (-1639.102) (-1631.482) [-1631.386] * (-1630.908) (-1634.340) (-1630.776) [-1632.607] -- 0:00:41 386000 -- (-1629.178) [-1629.676] (-1631.716) (-1637.695) * [-1631.988] (-1630.270) (-1631.322) (-1629.667) -- 0:00:41 386500 -- (-1630.112) (-1632.290) [-1630.822] (-1631.738) * (-1631.742) (-1631.552) [-1630.611] (-1629.218) -- 0:00:41 387000 -- (-1629.860) (-1633.104) (-1631.983) [-1627.530] * (-1632.884) [-1631.362] (-1631.579) (-1629.922) -- 0:00:41 387500 -- (-1631.477) (-1630.931) (-1629.825) [-1630.339] * (-1634.086) [-1631.661] (-1634.130) (-1634.619) -- 0:00:41 388000 -- (-1630.772) (-1631.722) [-1631.244] (-1628.837) * (-1629.622) (-1629.840) (-1632.200) [-1632.047] -- 0:00:42 388500 -- (-1632.366) (-1635.389) (-1631.428) [-1629.625] * (-1632.095) (-1631.096) [-1631.024] (-1631.811) -- 0:00:42 389000 -- (-1637.817) [-1631.193] (-1630.869) (-1633.127) * (-1634.464) (-1633.825) [-1629.904] (-1633.187) -- 0:00:42 389500 -- (-1631.256) [-1632.126] (-1633.487) (-1632.668) * [-1632.411] (-1630.380) (-1628.605) (-1630.539) -- 0:00:42 390000 -- [-1633.299] (-1630.452) (-1634.553) (-1634.355) * (-1631.862) (-1630.216) [-1632.369] (-1632.900) -- 0:00:42 Average standard deviation of split frequencies: 0.012670 390500 -- (-1633.218) (-1632.021) [-1633.371] (-1631.952) * (-1632.712) (-1629.648) (-1630.142) [-1631.428] -- 0:00:42 391000 -- (-1630.779) (-1634.477) [-1628.953] (-1630.015) * (-1630.963) (-1632.049) (-1633.253) [-1631.066] -- 0:00:42 391500 -- (-1632.429) (-1634.571) [-1633.681] (-1635.216) * (-1630.632) (-1632.097) (-1628.755) [-1630.630] -- 0:00:41 392000 -- (-1631.297) (-1631.210) [-1634.979] (-1632.033) * (-1631.169) (-1633.736) (-1631.038) [-1631.894] -- 0:00:41 392500 -- (-1629.616) (-1633.352) (-1635.516) [-1632.487] * (-1632.245) (-1633.523) [-1630.413] (-1629.198) -- 0:00:41 393000 -- (-1630.184) (-1632.735) (-1628.806) [-1631.283] * [-1634.225] (-1630.237) (-1632.211) (-1628.334) -- 0:00:41 393500 -- [-1628.779] (-1631.720) (-1629.198) (-1633.021) * (-1636.099) (-1633.079) [-1631.098] (-1629.465) -- 0:00:41 394000 -- (-1630.118) (-1630.791) [-1629.883] (-1637.920) * (-1631.242) [-1630.923] (-1630.120) (-1630.634) -- 0:00:41 394500 -- [-1631.918] (-1630.466) (-1633.363) (-1629.094) * (-1631.747) (-1631.163) (-1630.555) [-1631.131] -- 0:00:41 395000 -- (-1633.349) (-1636.687) (-1634.244) [-1629.937] * (-1633.059) (-1631.459) [-1629.939] (-1629.294) -- 0:00:41 Average standard deviation of split frequencies: 0.011904 395500 -- (-1629.752) (-1631.302) [-1631.563] (-1631.385) * (-1633.799) (-1632.742) (-1629.958) [-1628.790] -- 0:00:41 396000 -- [-1629.791] (-1630.286) (-1634.581) (-1631.267) * (-1631.645) (-1631.731) (-1630.031) [-1630.080] -- 0:00:41 396500 -- [-1629.259] (-1629.004) (-1629.641) (-1631.045) * (-1633.315) (-1631.695) (-1632.232) [-1628.235] -- 0:00:41 397000 -- (-1629.573) [-1631.599] (-1630.947) (-1629.647) * [-1632.873] (-1631.473) (-1629.240) (-1629.564) -- 0:00:41 397500 -- [-1627.851] (-1631.168) (-1629.553) (-1633.111) * (-1633.753) [-1630.070] (-1631.662) (-1630.358) -- 0:00:40 398000 -- (-1631.338) [-1629.661] (-1631.703) (-1631.691) * (-1632.421) (-1633.745) (-1631.420) [-1631.363] -- 0:00:40 398500 -- (-1629.820) [-1629.538] (-1628.751) (-1631.488) * (-1633.069) (-1632.482) (-1632.838) [-1629.645] -- 0:00:40 399000 -- (-1631.163) [-1630.343] (-1627.889) (-1630.097) * [-1632.384] (-1629.919) (-1634.579) (-1627.745) -- 0:00:40 399500 -- (-1630.643) [-1633.051] (-1633.299) (-1630.798) * (-1629.821) (-1630.639) (-1632.444) [-1630.047] -- 0:00:40 400000 -- (-1630.905) [-1632.280] (-1633.943) (-1630.038) * [-1630.485] (-1631.041) (-1631.152) (-1631.145) -- 0:00:40 Average standard deviation of split frequencies: 0.012427 400500 -- (-1631.406) (-1628.574) (-1629.473) [-1631.438] * (-1630.578) [-1632.568] (-1628.916) (-1630.399) -- 0:00:40 401000 -- [-1630.106] (-1633.063) (-1632.498) (-1634.664) * (-1632.505) [-1633.828] (-1633.134) (-1629.508) -- 0:00:40 401500 -- (-1633.410) (-1633.000) (-1628.555) [-1631.192] * (-1631.126) (-1630.847) [-1629.051] (-1633.610) -- 0:00:40 402000 -- (-1638.631) (-1633.403) [-1628.593] (-1632.544) * (-1629.867) [-1630.915] (-1629.187) (-1632.513) -- 0:00:40 402500 -- (-1632.534) [-1631.418] (-1631.743) (-1629.260) * [-1630.131] (-1634.121) (-1633.303) (-1633.389) -- 0:00:41 403000 -- (-1632.557) (-1632.106) [-1632.559] (-1629.230) * (-1630.078) [-1629.394] (-1634.226) (-1631.383) -- 0:00:41 403500 -- [-1633.160] (-1632.950) (-1631.977) (-1629.836) * (-1630.852) (-1631.544) [-1633.376] (-1631.753) -- 0:00:41 404000 -- (-1632.466) (-1633.141) [-1630.981] (-1630.160) * (-1632.242) (-1633.692) (-1630.725) [-1630.697] -- 0:00:41 404500 -- (-1632.654) (-1630.661) [-1630.392] (-1629.432) * (-1630.013) (-1629.951) [-1628.955] (-1632.585) -- 0:00:41 405000 -- (-1630.847) (-1631.447) (-1629.461) [-1633.502] * (-1633.828) (-1629.951) (-1629.418) [-1629.091] -- 0:00:41 Average standard deviation of split frequencies: 0.012528 405500 -- (-1632.170) (-1630.936) (-1633.000) [-1629.094] * (-1630.351) (-1631.443) [-1628.805] (-1630.281) -- 0:00:41 406000 -- (-1629.793) (-1631.469) [-1632.161] (-1630.467) * (-1631.298) (-1632.547) (-1635.739) [-1630.970] -- 0:00:40 406500 -- (-1631.177) (-1630.599) [-1630.786] (-1629.868) * (-1632.154) (-1630.340) (-1631.125) [-1630.305] -- 0:00:40 407000 -- (-1633.927) (-1632.749) [-1631.442] (-1632.567) * (-1632.846) (-1631.069) [-1632.291] (-1631.102) -- 0:00:40 407500 -- (-1631.414) (-1629.999) (-1630.142) [-1630.377] * (-1630.548) (-1633.169) (-1631.864) [-1632.552] -- 0:00:40 408000 -- (-1631.354) [-1629.995] (-1631.255) (-1629.957) * (-1631.896) (-1630.300) [-1630.933] (-1635.276) -- 0:00:40 408500 -- (-1629.489) (-1630.205) (-1631.124) [-1631.115] * [-1631.983] (-1630.272) (-1631.815) (-1631.221) -- 0:00:40 409000 -- (-1627.876) (-1630.453) (-1631.049) [-1632.603] * (-1632.917) (-1635.753) (-1627.374) [-1627.799] -- 0:00:40 409500 -- (-1630.644) (-1631.057) (-1629.864) [-1627.521] * [-1631.602] (-1634.052) (-1635.414) (-1630.572) -- 0:00:40 410000 -- [-1629.725] (-1630.310) (-1630.204) (-1629.456) * (-1632.138) (-1631.088) (-1633.378) [-1630.420] -- 0:00:40 Average standard deviation of split frequencies: 0.012627 410500 -- (-1628.746) (-1632.629) (-1629.729) [-1631.109] * (-1627.934) (-1634.052) [-1631.650] (-1632.504) -- 0:00:40 411000 -- (-1628.800) (-1630.560) (-1633.207) [-1627.770] * (-1629.846) [-1631.972] (-1630.720) (-1632.478) -- 0:00:40 411500 -- [-1631.175] (-1633.355) (-1631.787) (-1629.559) * (-1632.580) (-1631.673) (-1633.583) [-1631.478] -- 0:00:40 412000 -- (-1630.097) (-1630.830) (-1631.424) [-1631.371] * (-1635.746) (-1630.656) [-1631.453] (-1631.198) -- 0:00:39 412500 -- [-1630.955] (-1632.882) (-1632.895) (-1628.210) * (-1632.078) (-1631.432) [-1631.005] (-1630.976) -- 0:00:39 413000 -- [-1632.450] (-1630.705) (-1631.228) (-1631.008) * (-1632.955) [-1632.363] (-1632.410) (-1631.020) -- 0:00:39 413500 -- (-1632.990) [-1631.759] (-1633.169) (-1631.517) * (-1634.578) [-1630.710] (-1632.627) (-1632.465) -- 0:00:39 414000 -- (-1633.190) (-1628.258) [-1630.390] (-1632.076) * (-1634.375) [-1632.776] (-1630.900) (-1631.797) -- 0:00:39 414500 -- (-1634.880) [-1630.483] (-1629.714) (-1628.782) * [-1634.421] (-1632.015) (-1634.126) (-1630.684) -- 0:00:39 415000 -- (-1633.519) [-1631.026] (-1631.444) (-1632.671) * [-1633.833] (-1631.185) (-1630.818) (-1628.962) -- 0:00:39 Average standard deviation of split frequencies: 0.012265 415500 -- (-1631.091) (-1633.773) [-1633.189] (-1637.598) * (-1635.677) (-1631.085) (-1633.419) [-1629.906] -- 0:00:39 416000 -- (-1628.580) [-1631.363] (-1631.648) (-1633.484) * [-1631.968] (-1632.790) (-1631.493) (-1632.780) -- 0:00:39 416500 -- (-1630.109) (-1630.293) (-1629.952) [-1632.361] * (-1636.219) (-1631.163) (-1629.275) [-1634.908] -- 0:00:39 417000 -- (-1628.551) [-1628.496] (-1631.324) (-1629.051) * [-1634.811] (-1630.861) (-1631.120) (-1632.586) -- 0:00:40 417500 -- [-1629.775] (-1631.692) (-1632.107) (-1632.283) * (-1632.124) [-1631.581] (-1631.073) (-1630.697) -- 0:00:40 418000 -- (-1629.424) [-1637.580] (-1634.521) (-1631.667) * [-1630.314] (-1633.474) (-1630.982) (-1631.507) -- 0:00:40 418500 -- (-1630.486) (-1630.945) [-1632.780] (-1631.763) * [-1629.895] (-1632.393) (-1631.791) (-1631.657) -- 0:00:40 419000 -- (-1630.710) (-1632.412) [-1629.421] (-1634.658) * (-1630.533) (-1631.121) [-1633.279] (-1630.044) -- 0:00:40 419500 -- (-1632.794) (-1630.304) [-1630.962] (-1633.704) * [-1630.944] (-1635.490) (-1634.077) (-1633.199) -- 0:00:40 420000 -- [-1629.969] (-1633.124) (-1629.849) (-1636.308) * (-1635.707) (-1632.640) [-1631.298] (-1635.274) -- 0:00:40 Average standard deviation of split frequencies: 0.012327 420500 -- (-1629.265) [-1630.851] (-1630.491) (-1630.834) * (-1630.907) (-1632.471) [-1632.601] (-1632.165) -- 0:00:39 421000 -- (-1630.745) (-1632.408) (-1630.241) [-1629.678] * (-1630.283) [-1630.607] (-1635.716) (-1631.542) -- 0:00:39 421500 -- (-1631.244) (-1630.802) [-1630.159] (-1630.860) * (-1631.900) (-1632.991) [-1632.898] (-1630.933) -- 0:00:39 422000 -- (-1629.532) (-1629.589) [-1630.586] (-1631.040) * [-1634.821] (-1633.435) (-1632.562) (-1631.299) -- 0:00:39 422500 -- (-1630.231) (-1629.853) (-1630.990) [-1634.514] * (-1630.117) [-1631.838] (-1629.143) (-1631.469) -- 0:00:39 423000 -- (-1637.846) (-1633.787) (-1631.278) [-1632.771] * [-1630.790] (-1633.088) (-1633.293) (-1630.267) -- 0:00:39 423500 -- (-1629.994) (-1632.620) (-1635.163) [-1630.956] * (-1631.921) (-1633.182) [-1629.870] (-1629.566) -- 0:00:39 424000 -- [-1628.601] (-1630.702) (-1630.467) (-1631.078) * (-1632.749) (-1633.165) (-1632.207) [-1630.589] -- 0:00:39 424500 -- (-1631.926) (-1632.047) (-1630.998) [-1629.967] * (-1634.049) [-1631.362] (-1629.067) (-1630.476) -- 0:00:39 425000 -- [-1630.658] (-1630.512) (-1630.119) (-1630.179) * (-1633.129) (-1630.730) [-1631.291] (-1631.064) -- 0:00:39 Average standard deviation of split frequencies: 0.012693 425500 -- (-1629.063) (-1631.043) [-1630.879] (-1629.873) * [-1630.515] (-1630.451) (-1632.098) (-1636.526) -- 0:00:39 426000 -- (-1629.048) (-1629.098) [-1631.039] (-1629.664) * (-1633.737) [-1633.440] (-1632.295) (-1631.383) -- 0:00:39 426500 -- (-1631.080) [-1629.583] (-1629.554) (-1629.129) * (-1632.917) (-1634.755) (-1628.378) [-1629.093] -- 0:00:38 427000 -- (-1632.336) (-1630.322) (-1631.066) [-1628.098] * (-1631.153) (-1634.241) [-1630.566] (-1631.953) -- 0:00:38 427500 -- (-1633.170) [-1633.294] (-1629.638) (-1634.806) * (-1630.578) (-1631.018) (-1631.201) [-1633.454] -- 0:00:38 428000 -- (-1635.342) (-1631.833) [-1630.159] (-1631.915) * (-1629.970) (-1630.345) [-1630.193] (-1634.655) -- 0:00:38 428500 -- (-1633.926) (-1631.114) [-1630.966] (-1635.218) * (-1633.009) [-1629.934] (-1630.237) (-1630.308) -- 0:00:38 429000 -- (-1631.667) (-1628.144) [-1630.674] (-1628.973) * (-1630.469) [-1628.181] (-1630.149) (-1630.467) -- 0:00:38 429500 -- (-1631.826) (-1629.799) (-1632.526) [-1629.247] * (-1629.786) [-1632.897] (-1630.925) (-1630.522) -- 0:00:38 430000 -- (-1632.015) (-1631.266) (-1632.802) [-1632.276] * (-1632.595) (-1635.751) (-1633.410) [-1628.150] -- 0:00:38 Average standard deviation of split frequencies: 0.011976 430500 -- (-1630.435) [-1630.687] (-1631.262) (-1630.289) * (-1632.375) (-1629.601) (-1634.625) [-1630.100] -- 0:00:38 431000 -- (-1630.034) (-1630.508) (-1633.489) [-1629.907] * (-1632.639) (-1629.195) [-1629.652] (-1633.484) -- 0:00:38 431500 -- [-1631.839] (-1630.700) (-1628.598) (-1632.262) * (-1631.858) (-1628.582) (-1631.407) [-1629.886] -- 0:00:39 432000 -- (-1630.984) (-1631.156) (-1627.753) [-1631.023] * [-1631.494] (-1632.987) (-1630.270) (-1634.607) -- 0:00:39 432500 -- (-1629.831) [-1630.568] (-1632.422) (-1639.468) * [-1630.301] (-1629.952) (-1631.587) (-1628.477) -- 0:00:39 433000 -- (-1629.766) [-1630.742] (-1632.241) (-1633.570) * [-1631.940] (-1631.262) (-1629.306) (-1628.894) -- 0:00:39 433500 -- (-1629.732) [-1631.762] (-1632.507) (-1631.555) * (-1631.934) (-1631.485) (-1629.796) [-1633.848] -- 0:00:39 434000 -- [-1633.044] (-1632.026) (-1630.012) (-1632.514) * (-1631.955) (-1628.450) (-1631.107) [-1630.546] -- 0:00:39 434500 -- (-1631.237) (-1631.064) [-1632.154] (-1628.280) * (-1631.164) [-1630.898] (-1631.030) (-1629.544) -- 0:00:39 435000 -- (-1630.680) (-1630.209) [-1632.580] (-1630.522) * (-1630.242) (-1632.532) (-1628.831) [-1629.448] -- 0:00:38 Average standard deviation of split frequencies: 0.011893 435500 -- (-1631.868) (-1633.069) [-1628.624] (-1632.435) * (-1634.730) (-1634.035) (-1630.676) [-1629.896] -- 0:00:38 436000 -- (-1631.549) (-1630.742) [-1630.770] (-1632.324) * (-1633.627) [-1629.347] (-1631.790) (-1634.228) -- 0:00:38 436500 -- (-1633.292) (-1630.200) [-1630.586] (-1631.530) * [-1631.979] (-1629.843) (-1636.603) (-1632.168) -- 0:00:38 437000 -- (-1635.616) (-1631.094) [-1630.300] (-1634.716) * [-1630.270] (-1629.026) (-1632.964) (-1632.074) -- 0:00:38 437500 -- (-1629.948) (-1631.455) (-1632.401) [-1632.997] * [-1628.909] (-1633.200) (-1636.904) (-1632.302) -- 0:00:38 438000 -- (-1633.525) (-1632.827) [-1631.672] (-1630.569) * [-1629.703] (-1633.313) (-1634.655) (-1634.334) -- 0:00:38 438500 -- (-1630.440) (-1632.910) (-1634.651) [-1633.127] * (-1628.582) (-1632.426) (-1631.871) [-1631.023] -- 0:00:38 439000 -- (-1632.003) (-1633.039) [-1631.727] (-1634.572) * (-1630.415) [-1631.735] (-1634.346) (-1633.084) -- 0:00:38 439500 -- (-1631.004) (-1629.519) [-1629.968] (-1630.404) * [-1630.599] (-1631.049) (-1636.932) (-1633.889) -- 0:00:38 440000 -- (-1633.272) [-1628.927] (-1629.072) (-1631.657) * [-1630.861] (-1631.319) (-1633.198) (-1630.994) -- 0:00:38 Average standard deviation of split frequencies: 0.012208 440500 -- [-1631.495] (-1632.532) (-1632.037) (-1633.215) * (-1631.138) (-1629.512) [-1628.369] (-1633.890) -- 0:00:38 441000 -- (-1629.952) (-1632.455) [-1630.720] (-1631.215) * (-1632.416) [-1631.022] (-1629.220) (-1633.547) -- 0:00:38 441500 -- [-1630.673] (-1629.984) (-1627.743) (-1633.867) * [-1630.190] (-1630.000) (-1628.682) (-1638.769) -- 0:00:37 442000 -- (-1629.965) (-1632.114) [-1629.640] (-1631.866) * [-1631.439] (-1631.321) (-1630.634) (-1638.308) -- 0:00:37 442500 -- (-1631.263) (-1632.052) [-1629.756] (-1633.150) * (-1630.200) (-1630.744) [-1628.985] (-1631.885) -- 0:00:37 443000 -- [-1631.272] (-1631.027) (-1631.196) (-1635.474) * (-1629.069) [-1630.470] (-1631.209) (-1629.331) -- 0:00:37 443500 -- (-1632.946) (-1636.324) (-1630.718) [-1632.305] * (-1628.157) (-1631.133) (-1630.336) [-1632.961] -- 0:00:37 444000 -- (-1638.028) [-1630.388] (-1632.342) (-1630.325) * (-1629.307) (-1630.996) [-1630.712] (-1634.356) -- 0:00:37 444500 -- (-1635.639) [-1630.397] (-1632.138) (-1630.005) * (-1631.276) (-1630.220) [-1630.348] (-1630.872) -- 0:00:37 445000 -- (-1634.181) [-1634.995] (-1632.091) (-1635.653) * (-1628.920) (-1630.708) (-1633.159) [-1630.106] -- 0:00:37 Average standard deviation of split frequencies: 0.012331 445500 -- (-1631.570) (-1632.202) (-1632.068) [-1632.322] * (-1630.406) (-1635.940) [-1632.568] (-1634.546) -- 0:00:37 446000 -- (-1629.357) (-1635.015) [-1630.493] (-1631.144) * [-1630.979] (-1631.269) (-1631.949) (-1634.028) -- 0:00:38 446500 -- (-1629.848) (-1633.481) (-1629.551) [-1630.313] * (-1630.179) [-1630.640] (-1632.081) (-1635.883) -- 0:00:38 447000 -- (-1633.747) [-1631.722] (-1632.999) (-1629.501) * (-1631.153) (-1632.582) (-1634.240) [-1633.386] -- 0:00:38 447500 -- (-1632.322) (-1630.218) (-1633.534) [-1629.092] * (-1633.594) [-1631.678] (-1635.481) (-1635.659) -- 0:00:38 448000 -- [-1633.437] (-1631.962) (-1629.771) (-1634.592) * [-1631.665] (-1632.397) (-1632.734) (-1635.421) -- 0:00:38 448500 -- (-1632.800) [-1632.164] (-1629.046) (-1632.668) * (-1633.098) (-1635.311) (-1630.859) [-1630.407] -- 0:00:38 449000 -- (-1631.560) [-1629.235] (-1630.946) (-1630.070) * (-1628.692) (-1633.980) [-1631.425] (-1631.618) -- 0:00:38 449500 -- (-1630.669) (-1630.099) [-1628.866] (-1630.967) * [-1630.923] (-1632.027) (-1633.136) (-1632.051) -- 0:00:37 450000 -- [-1634.958] (-1630.458) (-1633.892) (-1631.630) * (-1629.628) (-1633.187) (-162