--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 12:42:39 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/mraY/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1471.93         -1476.61
2      -1471.94         -1475.50
--------------------------------------
TOTAL    -1471.94         -1476.20
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.862235    0.088601    0.328010    1.451642    0.829720   1329.41   1415.20    1.000
r(A<->C){all}   0.139220    0.015641    0.000044    0.397418    0.104641    143.27    267.58    1.004
r(A<->G){all}   0.217931    0.023879    0.000365    0.518513    0.190113    193.27    230.41    1.013
r(A<->T){all}   0.127084    0.013909    0.000032    0.371709    0.091967    261.72    299.87    1.000
r(C<->G){all}   0.183699    0.022835    0.000082    0.479258    0.145010    203.70    216.76    1.006
r(C<->T){all}   0.163129    0.018741    0.000019    0.439634    0.128715    248.96    261.33    1.004
r(G<->T){all}   0.168937    0.019484    0.000081    0.447223    0.134151    220.94    277.37    1.008
pi(A){all}      0.153916    0.000119    0.131051    0.174148    0.153735   1308.64   1329.93    1.000
pi(C){all}      0.270048    0.000184    0.244318    0.296899    0.269784   1166.58   1258.01    1.000
pi(G){all}      0.323632    0.000202    0.295318    0.351491    0.323711   1118.89   1244.66    1.000
pi(T){all}      0.252403    0.000169    0.225014    0.275572    0.252343   1351.95   1426.48    1.000
alpha{1,2}      0.189123    0.040844    0.016292    0.445431    0.138513   1101.91   1207.37    1.000
alpha{3}        0.399753    0.206909    0.000111    1.364910    0.229912    580.77    972.74    1.000
pinvar{all}     0.996610    0.000007    0.991545    0.999892    0.997278   1253.46   1345.92    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1414.753975
Model 2: PositiveSelection	-1414.383027
Model 0: one-ratio	-1414.382899
Model 7: beta	-1414.753971
Model 8: beta&w>1	-1414.38313


Model 0 vs 1	0.7421520000002602

Model 2 vs 1	0.741895999999997

Model 8 vs 7	0.7416820000003099
>C1
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKVFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C2
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C3
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C4
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C5
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C6
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=359 

C1              MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C2              MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C3              MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C4              MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C5              MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C6              MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
                **************************************************

C1              SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C2              SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C3              SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C4              SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C5              SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C6              SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
                **************************************************

C1              DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C2              DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C3              DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C4              DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C5              DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C6              DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
                **************************************************

C1              SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C2              SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C3              SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C4              SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C5              SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C6              SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
                **************************************************

C1              AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C2              AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C3              AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C4              AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C5              AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C6              AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
                **************************************************

C1              APAKVFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C2              APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C3              APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C4              APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C5              APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C6              APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
                ****:*********************************************

C1              LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C2              LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C3              LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C4              LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C5              LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C6              LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
                **************************************************

C1              GEWLATIGA
C2              GEWLATIGA
C3              GEWLATIGA
C4              GEWLATIGA
C5              GEWLATIGA
C6              GEWLATIGA
                *********




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  359 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  359 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10770]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [10770]--->[10770]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.523 Mb, Max= 30.932 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C2              MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C3              MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C4              MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C5              MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C6              MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
                **************************************************

C1              SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C2              SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C3              SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C4              SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C5              SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C6              SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
                **************************************************

C1              DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C2              DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C3              DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C4              DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C5              DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C6              DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
                **************************************************

C1              SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C2              SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C3              SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C4              SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C5              SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C6              SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
                **************************************************

C1              AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C2              AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C3              AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C4              AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C5              AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C6              AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
                **************************************************

C1              APAKVFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C2              APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C3              APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C4              APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C5              APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C6              APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
                ****:*********************************************

C1              LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C2              LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C3              LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C4              LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C5              LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C6              LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
                **************************************************

C1              GEWLATIGA
C2              GEWLATIGA
C3              GEWLATIGA
C4              GEWLATIGA
C5              GEWLATIGA
C6              GEWLATIGA
                *********




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.72 C1	 C2	 99.72
TOP	    1    0	 99.72 C2	 C1	 99.72
BOT	    0    2	 99.72 C1	 C3	 99.72
TOP	    2    0	 99.72 C3	 C1	 99.72
BOT	    0    3	 99.72 C1	 C4	 99.72
TOP	    3    0	 99.72 C4	 C1	 99.72
BOT	    0    4	 99.72 C1	 C5	 99.72
TOP	    4    0	 99.72 C5	 C1	 99.72
BOT	    0    5	 99.72 C1	 C6	 99.72
TOP	    5    0	 99.72 C6	 C1	 99.72
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 99.72
AVG	 1	 C2	  *	 99.94
AVG	 2	 C3	  *	 99.94
AVG	 3	 C4	  *	 99.94
AVG	 4	 C5	  *	 99.94
AVG	 5	 C6	  *	 99.94
TOT	 TOT	  *	 99.91
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
C2              ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
C3              ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
C4              ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
C5              ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
C6              ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
                **************************************************

C1              GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
C2              GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
C3              GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
C4              GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
C5              GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
C6              GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
                **************************************************

C1              AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
C2              AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
C3              AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
C4              AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
C5              AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
C6              AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
                **************************************************

C1              TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
C2              TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
C3              TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
C4              TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
C5              TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
C6              TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
                **************************************************

C1              CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
C2              CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
C3              CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
C4              CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
C5              CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
C6              CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
                **************************************************

C1              GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
C2              GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
C3              GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
C4              GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
C5              GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
C6              GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
                **************************************************

C1              GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
C2              GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
C3              GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
C4              GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
C5              GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
C6              GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
                **************************************************

C1              AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
C2              AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
C3              AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
C4              AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
C5              AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
C6              AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
                **************************************************

C1              TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
C2              TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
C3              TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
C4              TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
C5              TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
C6              TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
                **************************************************

C1              TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
C2              TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
C3              TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
C4              TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
C5              TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
C6              TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
                **************************************************

C1              GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
C2              GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
C3              GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
C4              GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
C5              GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
C6              GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
                **************************************************

C1              CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
C2              CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
C3              CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
C4              CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
C5              CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
C6              CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
                **************************************************

C1              GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
C2              GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
C3              GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
C4              GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
C5              GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
C6              GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
                **************************************************

C1              GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
C2              GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
C3              GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
C4              GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
C5              GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
C6              GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
                **************************************************

C1              TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
C2              TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
C3              TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
C4              TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
C5              TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
C6              TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
                **************************************************

C1              GCACCGGCCAAGGTTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
C2              GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
C3              GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
C4              GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
C5              GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
C6              GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
                ************.*************************************

C1              CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
C2              CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
C3              CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
C4              CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
C5              CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
C6              CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
                **************************************************

C1              TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
C2              TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
C3              TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
C4              TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
C5              TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
C6              TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
                **************************************************

C1              CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
C2              CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
C3              CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
C4              CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
C5              CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
C6              CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
                **************************************************

C1              CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
C2              CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
C3              CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
C4              CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
C5              CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
C6              CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
                **************************************************

C1              TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
C2              TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
C3              TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
C4              TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
C5              TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
C6              TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
                **************************************************

C1              GGCGAGTGGCTAGCCACCATTGGCGCT
C2              GGCGAGTGGCTAGCCACCATTGGCGCT
C3              GGCGAGTGGCTAGCCACCATTGGCGCT
C4              GGCGAGTGGCTAGCCACCATTGGCGCT
C5              GGCGAGTGGCTAGCCACCATTGGCGCT
C6              GGCGAGTGGCTAGCCACCATTGGCGCT
                ***************************



>C1
ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
GCACCGGCCAAGGTTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
GGCGAGTGGCTAGCCACCATTGGCGCT
>C2
ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
GGCGAGTGGCTAGCCACCATTGGCGCT
>C3
ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
GGCGAGTGGCTAGCCACCATTGGCGCT
>C4
ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
GGCGAGTGGCTAGCCACCATTGGCGCT
>C5
ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
GGCGAGTGGCTAGCCACCATTGGCGCT
>C6
ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
GGCGAGTGGCTAGCCACCATTGGCGCT
>C1
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKVFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C2
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C3
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C4
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C5
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C6
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1077 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579783270
      Setting output file names to "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 361758214
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9071436335
      Seed = 838473615
      Swapseed = 1579783270
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 5 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2413.780485 -- -24.965149
         Chain 2 -- -2413.780485 -- -24.965149
         Chain 3 -- -2413.780485 -- -24.965149
         Chain 4 -- -2413.780485 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2413.780485 -- -24.965149
         Chain 2 -- -2413.778795 -- -24.965149
         Chain 3 -- -2413.778795 -- -24.965149
         Chain 4 -- -2413.778795 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2413.780] (-2413.780) (-2413.780) (-2413.780) * [-2413.780] (-2413.779) (-2413.779) (-2413.779) 
        500 -- (-1505.198) [-1485.037] (-1481.005) (-1485.072) * (-1492.688) [-1488.364] (-1493.155) (-1493.671) -- 0:33:19
       1000 -- (-1488.533) (-1477.409) [-1480.415] (-1482.776) * [-1480.681] (-1483.415) (-1481.830) (-1475.584) -- 0:16:39
       1500 -- (-1474.054) (-1478.968) [-1474.352] (-1490.434) * (-1473.381) (-1479.713) (-1474.425) [-1473.626] -- 0:11:05
       2000 -- (-1473.616) (-1482.484) [-1475.631] (-1488.568) * (-1483.343) [-1473.421] (-1473.468) (-1484.942) -- 0:08:19
       2500 -- (-1472.569) (-1490.242) (-1478.622) [-1477.095] * (-1475.380) (-1483.520) [-1474.269] (-1474.852) -- 0:06:39
       3000 -- (-1477.274) (-1483.683) [-1477.422] (-1475.645) * (-1476.475) [-1474.586] (-1473.744) (-1480.149) -- 0:05:32
       3500 -- (-1477.272) (-1485.848) (-1485.455) [-1476.275] * (-1480.799) (-1480.892) (-1474.132) [-1476.666] -- 0:04:44
       4000 -- (-1474.928) [-1479.080] (-1480.085) (-1478.002) * (-1478.135) [-1473.606] (-1480.363) (-1480.559) -- 0:04:09
       4500 -- (-1481.107) (-1478.642) (-1475.404) [-1474.285] * [-1470.937] (-1481.587) (-1484.710) (-1474.769) -- 0:03:41
       5000 -- (-1472.293) [-1477.919] (-1488.563) (-1480.070) * [-1474.955] (-1475.430) (-1482.013) (-1475.555) -- 0:03:19

      Average standard deviation of split frequencies: 0.075151

       5500 -- (-1478.639) (-1474.615) (-1480.808) [-1477.279] * (-1471.497) (-1476.436) [-1471.022] (-1477.037) -- 0:03:00
       6000 -- (-1481.617) (-1473.446) [-1472.224] (-1473.357) * (-1469.852) [-1474.999] (-1477.667) (-1483.540) -- 0:02:45
       6500 -- (-1481.365) (-1478.527) [-1478.673] (-1477.172) * [-1473.127] (-1471.659) (-1475.452) (-1482.416) -- 0:02:32
       7000 -- (-1481.483) [-1481.122] (-1481.489) (-1486.318) * (-1480.943) (-1478.457) (-1481.714) [-1477.366] -- 0:02:21
       7500 -- (-1479.517) (-1480.321) (-1476.175) [-1481.711] * [-1481.565] (-1479.971) (-1477.418) (-1475.067) -- 0:02:12
       8000 -- [-1482.758] (-1476.168) (-1482.881) (-1483.695) * [-1471.541] (-1475.672) (-1473.047) (-1478.078) -- 0:02:04
       8500 -- (-1479.788) (-1481.171) (-1480.393) [-1471.921] * (-1479.361) (-1473.506) (-1477.792) [-1474.164] -- 0:01:56
       9000 -- (-1482.392) [-1474.235] (-1475.194) (-1477.129) * (-1475.550) [-1475.530] (-1472.517) (-1478.605) -- 0:01:50
       9500 -- (-1490.739) [-1474.119] (-1477.057) (-1475.998) * (-1497.759) (-1473.401) (-1485.275) [-1477.012] -- 0:01:44
      10000 -- (-1482.655) (-1477.715) (-1478.082) [-1484.509] * (-1477.449) (-1474.649) [-1472.173] (-1481.437) -- 0:01:39

      Average standard deviation of split frequencies: 0.065239

      10500 -- (-1478.619) [-1477.721] (-1476.707) (-1482.962) * [-1471.415] (-1476.425) (-1477.755) (-1474.007) -- 0:01:34
      11000 -- [-1476.832] (-1479.143) (-1476.085) (-1483.451) * (-1474.852) (-1476.688) (-1475.503) [-1478.703] -- 0:01:29
      11500 -- (-1473.264) [-1476.191] (-1478.250) (-1485.373) * [-1471.680] (-1475.759) (-1477.581) (-1476.142) -- 0:01:25
      12000 -- (-1478.837) [-1489.105] (-1487.013) (-1479.883) * (-1473.551) (-1479.393) (-1480.191) [-1478.059] -- 0:01:22
      12500 -- (-1481.163) (-1479.520) (-1474.043) [-1473.972] * (-1478.193) (-1473.761) (-1478.303) [-1474.198] -- 0:01:19
      13000 -- (-1472.663) (-1478.053) [-1476.553] (-1472.740) * (-1477.126) (-1469.721) (-1482.875) [-1472.624] -- 0:01:15
      13500 -- (-1485.600) (-1482.199) [-1474.448] (-1471.955) * (-1472.833) (-1474.893) [-1476.839] (-1481.512) -- 0:02:26
      14000 -- (-1475.669) (-1481.066) (-1474.560) [-1476.851] * (-1473.260) (-1474.385) (-1480.210) [-1477.839] -- 0:02:20
      14500 -- (-1473.704) (-1475.981) [-1480.369] (-1473.170) * [-1475.383] (-1475.495) (-1474.878) (-1479.184) -- 0:02:15
      15000 -- (-1476.345) (-1479.477) (-1472.644) [-1474.840] * (-1472.980) (-1475.533) (-1473.141) [-1477.153] -- 0:02:11

      Average standard deviation of split frequencies: 0.053033

      15500 -- (-1474.887) [-1476.548] (-1474.333) (-1470.048) * (-1475.553) (-1476.607) (-1471.088) [-1479.057] -- 0:02:07
      16000 -- (-1478.419) (-1475.522) (-1472.677) [-1472.153] * (-1474.510) (-1478.646) [-1472.199] (-1477.811) -- 0:02:03
      16500 -- [-1476.787] (-1475.896) (-1476.872) (-1476.076) * [-1471.759] (-1480.666) (-1472.396) (-1479.144) -- 0:01:59
      17000 -- (-1478.840) [-1475.915] (-1477.528) (-1475.331) * (-1472.422) [-1477.090] (-1473.248) (-1480.960) -- 0:01:55
      17500 -- [-1474.997] (-1473.537) (-1473.586) (-1475.403) * (-1472.294) [-1475.042] (-1473.661) (-1475.839) -- 0:01:52
      18000 -- [-1477.422] (-1476.799) (-1475.686) (-1475.882) * (-1472.294) (-1471.163) [-1472.372] (-1477.906) -- 0:01:49
      18500 -- (-1473.596) (-1472.963) [-1472.852] (-1478.250) * (-1471.714) [-1472.331] (-1475.500) (-1482.927) -- 0:01:46
      19000 -- [-1472.012] (-1475.346) (-1474.152) (-1478.059) * [-1471.631] (-1476.854) (-1473.765) (-1475.826) -- 0:01:43
      19500 -- (-1474.067) [-1472.214] (-1472.149) (-1476.167) * (-1471.028) (-1473.543) (-1474.440) [-1476.406] -- 0:01:40
      20000 -- (-1475.005) [-1473.137] (-1475.294) (-1477.040) * (-1475.190) (-1474.594) (-1480.348) [-1474.588] -- 0:01:38

      Average standard deviation of split frequencies: 0.065895

      20500 -- (-1477.704) (-1477.698) [-1474.873] (-1471.072) * (-1474.992) (-1470.131) (-1482.146) [-1481.264] -- 0:01:35
      21000 -- [-1484.983] (-1483.236) (-1473.455) (-1475.734) * (-1474.358) (-1475.980) [-1474.278] (-1479.167) -- 0:01:33
      21500 -- (-1487.045) [-1474.559] (-1480.515) (-1478.863) * (-1470.207) (-1473.426) (-1477.689) [-1478.325] -- 0:01:31
      22000 -- (-1487.178) (-1474.955) (-1481.004) [-1470.757] * (-1472.496) (-1474.638) [-1472.021] (-1475.406) -- 0:01:28
      22500 -- (-1474.565) [-1473.161] (-1482.570) (-1475.282) * (-1472.584) (-1471.436) (-1472.156) [-1477.562] -- 0:01:26
      23000 -- [-1472.806] (-1472.511) (-1477.485) (-1473.900) * [-1470.952] (-1471.072) (-1473.196) (-1476.406) -- 0:01:24
      23500 -- (-1479.534) (-1477.520) (-1479.805) [-1472.614] * [-1473.294] (-1471.346) (-1474.352) (-1482.589) -- 0:01:23
      24000 -- (-1474.263) [-1477.097] (-1475.876) (-1478.106) * (-1470.016) (-1473.648) (-1471.465) [-1474.084] -- 0:01:21
      24500 -- (-1481.218) (-1472.933) [-1474.236] (-1471.613) * (-1475.996) (-1471.260) (-1473.772) [-1478.750] -- 0:01:19
      25000 -- (-1480.268) [-1474.391] (-1470.719) (-1471.723) * (-1476.034) (-1472.530) (-1477.441) [-1477.243] -- 0:01:18

      Average standard deviation of split frequencies: 0.054393

      25500 -- [-1475.048] (-1477.129) (-1474.524) (-1472.643) * (-1471.767) (-1479.795) (-1474.466) [-1474.520] -- 0:01:16
      26000 -- [-1473.615] (-1476.493) (-1474.798) (-1473.852) * (-1472.606) [-1470.925] (-1473.364) (-1479.175) -- 0:01:14
      26500 -- [-1475.248] (-1475.211) (-1480.147) (-1475.755) * [-1474.035] (-1475.005) (-1471.587) (-1478.181) -- 0:01:13
      27000 -- (-1479.808) (-1473.426) (-1477.748) [-1473.308] * [-1472.613] (-1472.803) (-1471.768) (-1478.480) -- 0:01:12
      27500 -- (-1477.313) [-1476.864] (-1478.406) (-1475.651) * (-1472.725) (-1471.185) [-1472.133] (-1479.265) -- 0:01:46
      28000 -- (-1472.980) (-1473.548) [-1478.969] (-1474.890) * (-1474.930) [-1471.941] (-1474.826) (-1476.325) -- 0:01:44
      28500 -- (-1472.308) [-1475.466] (-1481.615) (-1474.848) * [-1471.044] (-1471.712) (-1473.918) (-1480.716) -- 0:01:42
      29000 -- (-1472.578) [-1474.462] (-1474.999) (-1475.241) * (-1471.054) (-1473.698) (-1473.915) [-1472.974] -- 0:01:40
      29500 -- (-1474.283) [-1470.585] (-1476.308) (-1476.125) * (-1471.922) (-1474.063) (-1474.495) [-1475.938] -- 0:01:38
      30000 -- [-1472.281] (-1476.388) (-1473.594) (-1476.180) * [-1472.488] (-1472.812) (-1473.765) (-1479.904) -- 0:01:37

      Average standard deviation of split frequencies: 0.053802

      30500 -- (-1474.676) [-1476.374] (-1473.419) (-1476.347) * (-1472.340) (-1471.465) (-1473.326) [-1480.103] -- 0:01:35
      31000 -- (-1475.681) [-1469.951] (-1471.432) (-1479.577) * (-1474.934) [-1472.930] (-1473.357) (-1480.013) -- 0:01:33
      31500 -- [-1473.633] (-1486.629) (-1474.942) (-1476.899) * (-1470.245) (-1472.333) (-1475.323) [-1475.886] -- 0:01:32
      32000 -- (-1475.815) [-1476.511] (-1469.601) (-1476.526) * (-1473.899) (-1469.947) [-1475.020] (-1474.861) -- 0:01:30
      32500 -- [-1472.598] (-1478.349) (-1474.658) (-1475.083) * (-1473.774) (-1471.865) (-1477.236) [-1474.094] -- 0:01:29
      33000 -- (-1471.825) (-1479.715) [-1472.550] (-1479.111) * (-1477.611) (-1471.034) (-1476.626) [-1475.847] -- 0:01:27
      33500 -- (-1473.097) (-1488.016) [-1473.073] (-1475.348) * (-1473.137) (-1472.981) (-1475.753) [-1475.559] -- 0:01:26
      34000 -- (-1477.091) [-1484.001] (-1471.636) (-1475.095) * (-1472.402) (-1473.956) (-1477.585) [-1478.607] -- 0:01:25
      34500 -- (-1472.568) (-1475.429) [-1476.441] (-1477.052) * (-1475.100) (-1472.361) [-1472.369] (-1477.997) -- 0:01:23
      35000 -- (-1470.311) [-1475.801] (-1478.944) (-1475.328) * (-1479.035) (-1472.248) [-1473.833] (-1473.178) -- 0:01:22

      Average standard deviation of split frequencies: 0.053688

      35500 -- [-1474.472] (-1482.658) (-1473.945) (-1473.549) * (-1472.326) (-1472.913) (-1477.443) [-1474.993] -- 0:01:21
      36000 -- (-1474.429) [-1478.300] (-1477.157) (-1477.085) * (-1472.956) (-1473.970) (-1475.482) [-1477.178] -- 0:01:20
      36500 -- (-1473.306) (-1472.903) (-1475.321) [-1474.460] * [-1471.658] (-1471.995) (-1475.831) (-1484.126) -- 0:01:19
      37000 -- (-1471.265) (-1474.530) (-1472.110) [-1474.546] * (-1473.847) [-1471.008] (-1473.033) (-1473.164) -- 0:01:18
      37500 -- (-1471.267) (-1475.010) [-1471.989] (-1477.390) * (-1475.486) [-1473.094] (-1476.100) (-1476.041) -- 0:01:17
      38000 -- (-1477.796) [-1473.383] (-1474.260) (-1474.364) * (-1474.198) (-1476.194) [-1472.444] (-1487.420) -- 0:01:15
      38500 -- [-1472.134] (-1472.733) (-1472.802) (-1473.449) * [-1472.559] (-1472.583) (-1472.732) (-1477.984) -- 0:01:14
      39000 -- (-1474.242) [-1477.663] (-1471.958) (-1472.281) * (-1470.403) (-1472.483) [-1478.048] (-1486.133) -- 0:01:13
      39500 -- [-1475.644] (-1478.119) (-1473.079) (-1478.380) * (-1475.824) (-1472.463) (-1478.185) [-1478.364] -- 0:01:12
      40000 -- (-1475.321) [-1482.335] (-1475.349) (-1475.871) * (-1474.250) (-1472.623) [-1471.599] (-1476.342) -- 0:01:12

      Average standard deviation of split frequencies: 0.045147

      40500 -- (-1476.221) (-1476.175) [-1472.038] (-1474.473) * (-1475.172) (-1470.752) (-1475.424) [-1479.531] -- 0:01:11
      41000 -- (-1477.516) (-1477.417) (-1472.253) [-1471.927] * (-1477.818) (-1474.946) (-1470.409) [-1475.770] -- 0:01:10
      41500 -- (-1475.504) [-1478.701] (-1473.616) (-1472.826) * (-1477.673) (-1480.793) [-1474.204] (-1482.790) -- 0:01:32
      42000 -- (-1478.111) [-1478.747] (-1474.012) (-1475.520) * (-1477.854) (-1483.302) [-1475.082] (-1477.018) -- 0:01:31
      42500 -- (-1472.050) [-1485.802] (-1474.362) (-1471.731) * (-1478.043) (-1471.911) (-1476.289) [-1486.063] -- 0:01:30
      43000 -- (-1471.090) [-1470.995] (-1473.749) (-1473.897) * [-1475.345] (-1477.700) (-1477.224) (-1477.924) -- 0:01:29
      43500 -- (-1473.394) (-1474.336) (-1471.737) [-1472.599] * (-1475.699) (-1473.422) (-1474.867) [-1475.653] -- 0:01:27
      44000 -- [-1473.765] (-1477.555) (-1474.768) (-1474.809) * (-1474.489) (-1474.999) (-1474.985) [-1477.320] -- 0:01:26
      44500 -- (-1471.859) [-1474.834] (-1472.944) (-1473.151) * (-1471.577) (-1473.511) (-1471.868) [-1475.860] -- 0:01:25
      45000 -- (-1471.139) (-1477.052) [-1477.660] (-1474.034) * (-1473.017) (-1473.575) (-1474.974) [-1479.631] -- 0:01:24

      Average standard deviation of split frequencies: 0.040452

      45500 -- (-1474.575) [-1480.016] (-1474.088) (-1474.374) * (-1477.193) (-1473.153) (-1472.340) [-1484.408] -- 0:01:23
      46000 -- (-1475.792) (-1482.254) (-1476.710) [-1476.273] * (-1475.819) (-1475.990) [-1472.372] (-1488.430) -- 0:01:22
      46500 -- (-1472.535) (-1473.308) (-1472.165) [-1475.621] * (-1476.948) (-1474.108) (-1474.225) [-1481.044] -- 0:01:22
      47000 -- (-1473.638) [-1472.420] (-1472.289) (-1476.191) * (-1475.170) (-1472.189) (-1472.591) [-1480.907] -- 0:01:21
      47500 -- (-1474.890) [-1471.504] (-1470.305) (-1478.833) * (-1475.309) [-1472.698] (-1471.662) (-1478.050) -- 0:01:20
      48000 -- (-1473.379) (-1472.479) (-1471.267) [-1476.880] * (-1475.015) (-1473.136) (-1472.220) [-1472.276] -- 0:01:19
      48500 -- [-1472.899] (-1471.455) (-1473.438) (-1475.333) * (-1475.147) (-1472.950) (-1473.938) [-1472.946] -- 0:01:18
      49000 -- [-1477.415] (-1473.540) (-1476.396) (-1476.230) * [-1474.801] (-1472.510) (-1472.860) (-1480.527) -- 0:01:17
      49500 -- (-1476.336) [-1472.184] (-1473.805) (-1475.577) * (-1472.189) (-1471.638) (-1479.865) [-1473.593] -- 0:01:16
      50000 -- (-1476.356) [-1474.150] (-1471.956) (-1474.795) * (-1474.370) (-1475.400) (-1480.358) [-1478.662] -- 0:01:16

      Average standard deviation of split frequencies: 0.031340

      50500 -- (-1477.109) [-1472.957] (-1469.856) (-1473.668) * (-1476.170) (-1471.774) (-1476.334) [-1475.439] -- 0:01:15
      51000 -- (-1478.912) (-1472.312) (-1471.822) [-1477.795] * (-1475.341) (-1475.382) [-1473.580] (-1480.143) -- 0:01:14
      51500 -- [-1478.719] (-1474.365) (-1472.208) (-1475.860) * (-1475.196) (-1472.456) (-1474.626) [-1477.246] -- 0:01:13
      52000 -- (-1476.100) (-1472.568) [-1470.853] (-1474.937) * (-1476.454) (-1476.722) (-1475.887) [-1476.808] -- 0:01:12
      52500 -- (-1475.871) (-1469.665) (-1472.954) [-1474.191] * (-1476.291) (-1472.589) [-1473.341] (-1476.381) -- 0:01:12
      53000 -- (-1475.438) (-1475.809) (-1473.434) [-1474.986] * [-1475.499] (-1474.268) (-1474.121) (-1476.774) -- 0:01:11
      53500 -- (-1475.171) (-1472.775) [-1472.934] (-1473.990) * (-1476.018) [-1472.862] (-1470.730) (-1474.728) -- 0:01:10
      54000 -- (-1478.734) (-1471.128) (-1474.202) [-1473.972] * (-1475.941) [-1471.139] (-1471.345) (-1477.308) -- 0:01:10
      54500 -- (-1475.681) (-1471.962) [-1473.411] (-1475.246) * [-1472.814] (-1475.338) (-1472.412) (-1480.656) -- 0:01:09
      55000 -- (-1475.902) [-1472.642] (-1474.554) (-1477.791) * (-1473.936) (-1472.889) (-1473.407) [-1478.440] -- 0:01:25

      Average standard deviation of split frequencies: 0.035355

      55500 -- (-1473.131) (-1477.131) [-1473.366] (-1477.199) * [-1472.407] (-1475.696) (-1476.814) (-1475.111) -- 0:01:25
      56000 -- (-1475.947) [-1472.463] (-1474.451) (-1472.617) * (-1476.178) (-1475.326) (-1474.261) [-1474.693] -- 0:01:24
      56500 -- (-1474.107) [-1471.455] (-1474.994) (-1479.235) * (-1475.344) (-1476.516) [-1474.995] (-1484.819) -- 0:01:23
      57000 -- (-1477.587) [-1472.585] (-1471.898) (-1473.092) * (-1471.926) [-1473.992] (-1474.301) (-1477.143) -- 0:01:22
      57500 -- [-1474.886] (-1474.382) (-1472.438) (-1476.965) * [-1470.142] (-1475.897) (-1476.822) (-1478.257) -- 0:01:21
      58000 -- (-1471.420) (-1476.951) [-1476.509] (-1474.877) * (-1473.586) (-1472.671) (-1474.191) [-1474.304] -- 0:01:21
      58500 -- (-1474.207) (-1473.439) (-1470.540) [-1473.745] * (-1472.766) (-1475.600) [-1473.252] (-1481.457) -- 0:01:20
      59000 -- [-1473.701] (-1473.168) (-1472.747) (-1475.009) * (-1472.848) (-1472.145) (-1472.584) [-1476.226] -- 0:01:19
      59500 -- (-1472.857) (-1473.003) [-1469.690] (-1474.086) * [-1472.668] (-1477.537) (-1473.692) (-1473.601) -- 0:01:19
      60000 -- (-1472.465) (-1477.398) [-1469.656] (-1473.680) * [-1473.328] (-1472.714) (-1471.687) (-1480.495) -- 0:01:18

      Average standard deviation of split frequencies: 0.026808

      60500 -- (-1475.869) (-1476.471) [-1471.848] (-1472.701) * (-1473.355) [-1471.894] (-1475.635) (-1481.504) -- 0:01:17
      61000 -- (-1472.523) (-1475.767) [-1472.099] (-1474.251) * (-1471.576) [-1471.769] (-1473.530) (-1479.181) -- 0:01:16
      61500 -- (-1473.547) (-1471.417) [-1471.282] (-1476.514) * [-1472.000] (-1471.972) (-1472.655) (-1479.215) -- 0:01:16
      62000 -- [-1474.551] (-1472.953) (-1474.550) (-1475.102) * [-1472.773] (-1470.953) (-1471.296) (-1481.168) -- 0:01:15
      62500 -- (-1475.749) (-1471.251) (-1472.432) [-1474.551] * (-1471.028) (-1471.903) [-1471.115] (-1479.505) -- 0:01:15
      63000 -- (-1473.423) (-1471.289) [-1473.049] (-1475.191) * (-1472.493) (-1475.792) (-1472.124) [-1484.515] -- 0:01:14
      63500 -- [-1475.377] (-1471.626) (-1473.060) (-1471.606) * (-1475.525) (-1475.283) (-1481.684) [-1479.566] -- 0:01:13
      64000 -- (-1471.674) (-1477.923) [-1475.223] (-1473.281) * (-1473.371) (-1475.629) (-1472.858) [-1483.277] -- 0:01:13
      64500 -- (-1471.791) [-1475.272] (-1471.415) (-1472.069) * [-1471.772] (-1473.911) (-1476.023) (-1477.160) -- 0:01:12
      65000 -- (-1471.335) [-1474.403] (-1472.071) (-1472.724) * (-1474.199) [-1472.916] (-1473.826) (-1478.655) -- 0:01:11

      Average standard deviation of split frequencies: 0.027550

      65500 -- (-1472.610) [-1473.656] (-1473.946) (-1473.492) * [-1471.521] (-1472.265) (-1472.982) (-1483.140) -- 0:01:11
      66000 -- (-1471.586) (-1471.597) [-1472.522] (-1475.592) * (-1483.284) [-1475.167] (-1471.927) (-1476.397) -- 0:01:10
      66500 -- [-1473.161] (-1471.005) (-1473.227) (-1475.973) * (-1474.919) (-1474.043) (-1475.097) [-1478.862] -- 0:01:10
      67000 -- (-1471.282) (-1477.824) (-1472.507) [-1475.702] * (-1471.606) (-1472.240) [-1474.092] (-1477.253) -- 0:01:09
      67500 -- (-1480.664) [-1472.081] (-1471.969) (-1474.968) * (-1476.511) (-1475.393) [-1474.917] (-1477.364) -- 0:01:09
      68000 -- (-1487.965) (-1472.014) (-1476.694) [-1475.361] * (-1470.583) (-1475.091) [-1474.929] (-1480.613) -- 0:01:08
      68500 -- (-1476.827) (-1476.350) [-1473.007] (-1478.483) * (-1470.771) [-1473.464] (-1473.430) (-1478.945) -- 0:01:07
      69000 -- (-1471.062) (-1482.562) [-1472.040] (-1476.179) * (-1472.914) (-1471.316) (-1474.485) [-1476.609] -- 0:01:07
      69500 -- (-1471.407) (-1481.384) (-1471.558) [-1472.788] * [-1473.455] (-1475.112) (-1472.304) (-1478.749) -- 0:01:06
      70000 -- (-1475.851) [-1471.788] (-1473.753) (-1476.451) * (-1472.700) (-1474.413) (-1474.058) [-1477.855] -- 0:01:19

      Average standard deviation of split frequencies: 0.024142

      70500 -- [-1476.291] (-1476.978) (-1474.208) (-1471.562) * (-1472.013) (-1474.557) (-1470.796) [-1475.549] -- 0:01:19
      71000 -- (-1474.698) [-1471.030] (-1483.029) (-1478.998) * (-1476.170) (-1472.751) (-1473.732) [-1476.235] -- 0:01:18
      71500 -- [-1471.865] (-1474.288) (-1474.754) (-1474.809) * (-1478.127) (-1471.446) (-1473.102) [-1479.232] -- 0:01:17
      72000 -- [-1471.046] (-1474.403) (-1473.071) (-1472.523) * (-1472.724) (-1472.902) (-1476.413) [-1479.406] -- 0:01:17
      72500 -- (-1479.276) [-1475.397] (-1474.241) (-1481.281) * (-1474.030) (-1473.288) (-1474.243) [-1475.054] -- 0:01:16
      73000 -- (-1475.739) (-1473.383) [-1471.858] (-1474.730) * [-1470.654] (-1471.633) (-1472.807) (-1480.199) -- 0:01:16
      73500 -- (-1471.715) (-1472.606) (-1472.287) [-1474.644] * (-1473.554) (-1472.445) (-1476.313) [-1475.839] -- 0:01:15
      74000 -- (-1472.277) [-1473.860] (-1472.814) (-1475.417) * (-1472.406) [-1473.239] (-1472.129) (-1478.737) -- 0:01:15
      74500 -- [-1474.494] (-1477.629) (-1473.387) (-1475.899) * [-1472.194] (-1472.495) (-1478.308) (-1480.662) -- 0:01:14
      75000 -- (-1475.756) (-1481.593) [-1474.291] (-1475.887) * (-1473.770) (-1473.120) (-1472.450) [-1475.091] -- 0:01:14

      Average standard deviation of split frequencies: 0.021857

      75500 -- (-1474.404) (-1474.465) [-1472.552] (-1477.370) * [-1472.156] (-1477.083) (-1472.715) (-1481.331) -- 0:01:13
      76000 -- (-1471.483) [-1473.409] (-1471.339) (-1475.459) * (-1475.087) (-1476.201) (-1470.283) [-1472.718] -- 0:01:12
      76500 -- [-1474.882] (-1474.939) (-1473.913) (-1475.922) * (-1474.934) [-1472.478] (-1472.363) (-1477.802) -- 0:01:12
      77000 -- [-1472.884] (-1475.156) (-1472.035) (-1478.397) * (-1474.090) (-1472.005) [-1470.674] (-1477.139) -- 0:01:11
      77500 -- (-1480.272) (-1474.521) (-1472.530) [-1475.299] * (-1469.588) [-1472.390] (-1472.473) (-1477.424) -- 0:01:11
      78000 -- (-1476.837) (-1472.075) (-1470.910) [-1478.606] * [-1470.870] (-1473.313) (-1473.781) (-1481.244) -- 0:01:10
      78500 -- (-1473.098) [-1475.577] (-1475.901) (-1477.596) * (-1475.287) [-1472.600] (-1474.148) (-1483.065) -- 0:01:10
      79000 -- (-1469.972) [-1472.378] (-1471.534) (-1474.623) * (-1472.546) (-1475.228) (-1473.155) [-1479.894] -- 0:01:09
      79500 -- (-1470.072) (-1473.444) (-1472.265) [-1473.743] * (-1473.276) (-1475.116) (-1479.010) [-1473.898] -- 0:01:09
      80000 -- [-1473.534] (-1472.922) (-1476.947) (-1477.078) * (-1472.135) (-1472.342) [-1475.726] (-1481.276) -- 0:01:09

      Average standard deviation of split frequencies: 0.021838

      80500 -- (-1473.027) (-1476.666) (-1470.858) [-1475.114] * (-1471.982) (-1475.201) [-1472.994] (-1475.950) -- 0:01:08
      81000 -- (-1469.660) (-1476.269) [-1472.307] (-1472.573) * (-1472.379) [-1474.137] (-1474.455) (-1477.980) -- 0:01:08
      81500 -- [-1474.224] (-1474.842) (-1473.581) (-1473.400) * (-1471.634) (-1476.221) (-1472.534) [-1472.828] -- 0:01:07
      82000 -- (-1471.588) (-1475.261) (-1475.392) [-1476.037] * (-1474.547) (-1475.356) (-1471.515) [-1475.978] -- 0:01:07
      82500 -- (-1473.516) [-1475.236] (-1473.815) (-1476.922) * (-1471.631) [-1472.887] (-1473.389) (-1471.788) -- 0:01:06
      83000 -- (-1474.740) (-1476.471) [-1470.790] (-1476.944) * (-1475.120) (-1475.551) (-1473.290) [-1474.995] -- 0:01:06
      83500 -- (-1473.900) (-1477.342) [-1470.201] (-1476.633) * (-1477.253) (-1475.243) [-1474.492] (-1477.762) -- 0:01:05
      84000 -- (-1472.597) (-1475.130) [-1472.088] (-1474.731) * (-1472.548) (-1473.091) (-1473.101) [-1475.400] -- 0:01:05
      84500 -- (-1471.299) [-1472.472] (-1471.648) (-1475.661) * (-1470.248) (-1474.789) (-1471.342) [-1475.917] -- 0:01:15
      85000 -- (-1470.229) [-1473.646] (-1472.603) (-1477.304) * [-1472.957] (-1473.877) (-1470.968) (-1477.281) -- 0:01:15

      Average standard deviation of split frequencies: 0.023080

      85500 -- [-1471.935] (-1474.503) (-1473.110) (-1475.059) * (-1474.086) (-1473.098) (-1474.695) [-1471.081] -- 0:01:14
      86000 -- (-1470.822) [-1472.173] (-1478.565) (-1474.253) * (-1473.087) [-1476.520] (-1472.912) (-1474.618) -- 0:01:14
      86500 -- (-1474.068) (-1472.457) [-1478.304] (-1472.754) * (-1474.887) (-1471.793) (-1475.289) [-1470.994] -- 0:01:13
      87000 -- (-1471.987) [-1473.253] (-1473.384) (-1474.977) * (-1473.642) [-1473.267] (-1476.993) (-1477.136) -- 0:01:13
      87500 -- (-1471.274) (-1471.652) [-1474.166] (-1472.439) * (-1475.410) [-1471.625] (-1473.773) (-1476.898) -- 0:01:13
      88000 -- (-1476.514) (-1472.091) (-1475.402) [-1474.554] * [-1471.748] (-1474.335) (-1476.249) (-1483.066) -- 0:01:12
      88500 -- (-1474.313) [-1471.521] (-1473.078) (-1474.755) * (-1470.964) [-1474.414] (-1475.235) (-1479.703) -- 0:01:12
      89000 -- (-1470.854) (-1472.435) (-1476.999) [-1474.677] * (-1473.436) (-1472.416) [-1472.441] (-1477.356) -- 0:01:11
      89500 -- [-1473.855] (-1472.855) (-1474.758) (-1475.923) * (-1472.262) (-1474.635) (-1474.235) [-1474.283] -- 0:01:11
      90000 -- (-1471.503) (-1473.577) (-1473.977) [-1474.020] * [-1472.376] (-1471.296) (-1473.352) (-1476.481) -- 0:01:10

      Average standard deviation of split frequencies: 0.027091

      90500 -- [-1470.181] (-1471.397) (-1475.064) (-1472.351) * (-1473.418) (-1473.186) (-1475.067) [-1470.295] -- 0:01:10
      91000 -- (-1470.798) (-1473.713) [-1474.732] (-1473.271) * (-1472.528) (-1470.225) (-1473.727) [-1477.323] -- 0:01:09
      91500 -- (-1471.559) (-1473.574) (-1477.118) [-1471.179] * (-1471.357) (-1473.485) (-1474.128) [-1477.869] -- 0:01:09
      92000 -- (-1472.494) (-1473.509) (-1472.584) [-1473.474] * (-1475.781) [-1473.373] (-1473.486) (-1480.358) -- 0:01:09
      92500 -- (-1473.976) (-1472.453) (-1472.938) [-1473.542] * (-1474.633) [-1470.902] (-1479.517) (-1472.422) -- 0:01:08
      93000 -- (-1473.644) [-1475.326] (-1473.307) (-1474.159) * (-1476.124) (-1470.607) [-1474.166] (-1479.967) -- 0:01:08
      93500 -- (-1472.781) [-1474.455] (-1477.766) (-1471.995) * [-1472.444] (-1474.383) (-1471.905) (-1480.469) -- 0:01:07
      94000 -- (-1471.330) [-1471.547] (-1471.107) (-1474.917) * (-1474.348) (-1477.222) (-1474.952) [-1477.426] -- 0:01:07
      94500 -- (-1471.844) [-1472.928] (-1471.473) (-1474.331) * (-1473.115) (-1475.459) (-1473.924) [-1476.604] -- 0:01:07
      95000 -- [-1472.988] (-1474.055) (-1473.421) (-1474.053) * [-1470.566] (-1472.428) (-1472.199) (-1476.763) -- 0:01:06

      Average standard deviation of split frequencies: 0.022643

      95500 -- (-1475.049) [-1473.937] (-1474.090) (-1472.982) * (-1471.954) (-1470.549) (-1476.065) [-1477.052] -- 0:01:06
      96000 -- (-1473.658) (-1474.271) (-1472.462) [-1474.002] * (-1471.319) [-1470.420] (-1471.444) (-1472.985) -- 0:01:05
      96500 -- [-1473.489] (-1474.633) (-1473.393) (-1476.105) * (-1471.682) (-1470.992) [-1470.787] (-1473.264) -- 0:01:05
      97000 -- (-1474.378) [-1470.466] (-1472.569) (-1478.216) * (-1472.901) (-1470.296) [-1471.442] (-1479.605) -- 0:01:05
      97500 -- (-1472.401) [-1471.555] (-1476.036) (-1473.665) * (-1473.452) (-1469.642) (-1473.574) [-1475.548] -- 0:01:04
      98000 -- (-1471.869) [-1471.435] (-1480.673) (-1471.591) * (-1470.347) (-1471.707) [-1471.492] (-1480.672) -- 0:01:04
      98500 -- (-1472.194) [-1471.873] (-1474.398) (-1474.476) * (-1472.870) (-1476.246) [-1474.504] (-1473.098) -- 0:01:04
      99000 -- [-1475.018] (-1481.023) (-1474.980) (-1478.774) * (-1475.233) (-1472.015) [-1471.750] (-1483.886) -- 0:01:03
      99500 -- (-1473.347) (-1476.539) [-1474.690] (-1473.531) * (-1469.086) [-1473.479] (-1476.426) (-1476.056) -- 0:01:12
      100000 -- (-1473.510) [-1473.438] (-1476.476) (-1474.739) * (-1473.255) [-1476.587] (-1477.291) (-1471.790) -- 0:01:12

      Average standard deviation of split frequencies: 0.022712

      100500 -- [-1470.643] (-1476.522) (-1473.625) (-1471.023) * [-1472.431] (-1470.449) (-1474.636) (-1476.375) -- 0:01:11
      101000 -- (-1471.337) (-1474.383) [-1472.711] (-1470.895) * (-1469.368) (-1470.040) [-1479.014] (-1474.941) -- 0:01:11
      101500 -- (-1478.026) [-1476.158] (-1474.307) (-1471.117) * (-1470.909) (-1469.563) (-1475.046) [-1471.258] -- 0:01:10
      102000 -- [-1472.648] (-1478.638) (-1473.380) (-1471.078) * (-1470.480) [-1471.067] (-1479.616) (-1471.287) -- 0:01:10
      102500 -- (-1470.988) [-1474.629] (-1473.182) (-1476.336) * [-1472.067] (-1478.840) (-1475.772) (-1471.993) -- 0:01:10
      103000 -- (-1470.812) (-1472.982) (-1474.533) [-1477.327] * (-1471.881) [-1475.363] (-1476.903) (-1474.941) -- 0:01:09
      103500 -- (-1473.756) (-1471.608) (-1473.604) [-1476.065] * (-1473.339) (-1474.860) [-1474.606] (-1473.044) -- 0:01:09
      104000 -- (-1471.261) (-1472.738) (-1478.004) [-1474.533] * (-1477.489) (-1474.302) (-1474.803) [-1470.231] -- 0:01:08
      104500 -- (-1471.880) (-1473.126) [-1475.834] (-1474.328) * (-1475.551) [-1473.016] (-1477.394) (-1475.290) -- 0:01:08
      105000 -- (-1473.850) [-1476.646] (-1475.216) (-1474.866) * [-1475.839] (-1471.937) (-1478.730) (-1473.764) -- 0:01:08

      Average standard deviation of split frequencies: 0.021534

      105500 -- (-1475.474) [-1472.292] (-1481.333) (-1475.646) * (-1475.765) [-1473.979] (-1476.777) (-1473.888) -- 0:01:07
      106000 -- (-1471.746) [-1474.049] (-1476.051) (-1474.623) * [-1474.017] (-1473.211) (-1477.180) (-1470.529) -- 0:01:07
      106500 -- (-1473.788) (-1470.681) (-1477.542) [-1480.249] * (-1474.090) [-1473.413] (-1483.014) (-1472.244) -- 0:01:07
      107000 -- (-1474.242) (-1473.861) [-1472.403] (-1474.292) * [-1471.445] (-1471.962) (-1479.540) (-1473.361) -- 0:01:06
      107500 -- (-1472.924) (-1475.445) [-1471.684] (-1477.047) * (-1473.338) [-1473.552] (-1476.031) (-1471.649) -- 0:01:06
      108000 -- (-1474.900) (-1475.830) (-1471.338) [-1474.929] * (-1474.518) (-1472.100) [-1475.153] (-1472.725) -- 0:01:06
      108500 -- (-1471.136) [-1473.442] (-1472.218) (-1475.588) * [-1472.197] (-1470.699) (-1474.722) (-1473.709) -- 0:01:05
      109000 -- (-1471.636) [-1472.903] (-1472.889) (-1473.293) * (-1472.578) [-1473.415] (-1472.610) (-1472.898) -- 0:01:05
      109500 -- (-1472.099) (-1472.504) (-1473.123) [-1472.722] * [-1471.575] (-1474.340) (-1474.640) (-1479.684) -- 0:01:05
      110000 -- [-1473.308] (-1474.091) (-1472.404) (-1471.647) * (-1477.325) (-1471.575) (-1475.266) [-1471.789] -- 0:01:04

      Average standard deviation of split frequencies: 0.020850

      110500 -- (-1472.704) (-1478.052) [-1474.916] (-1476.023) * [-1476.335] (-1471.964) (-1474.498) (-1480.327) -- 0:01:04
      111000 -- (-1472.686) (-1475.049) (-1476.116) [-1473.593] * (-1472.426) (-1471.392) (-1474.912) [-1472.971] -- 0:01:04
      111500 -- (-1471.723) [-1475.478] (-1475.537) (-1475.127) * (-1474.235) (-1472.260) [-1475.986] (-1471.680) -- 0:01:03
      112000 -- (-1474.085) [-1473.306] (-1474.774) (-1473.969) * (-1475.032) [-1469.865] (-1479.263) (-1472.350) -- 0:01:03
      112500 -- (-1475.127) (-1471.520) [-1474.736] (-1473.449) * [-1471.319] (-1474.212) (-1475.930) (-1473.123) -- 0:01:03
      113000 -- [-1470.703] (-1471.912) (-1472.166) (-1474.441) * [-1471.927] (-1472.694) (-1475.694) (-1472.302) -- 0:01:02
      113500 -- (-1471.694) (-1473.017) (-1474.795) [-1470.296] * (-1473.930) [-1472.160] (-1473.102) (-1470.404) -- 0:01:02
      114000 -- (-1472.874) (-1471.742) (-1475.273) [-1473.072] * [-1472.965] (-1473.502) (-1475.561) (-1471.607) -- 0:01:09
      114500 -- (-1474.799) (-1474.785) (-1476.130) [-1474.229] * (-1473.340) (-1471.718) [-1473.087] (-1470.671) -- 0:01:09
      115000 -- [-1472.900] (-1473.773) (-1477.043) (-1474.893) * (-1475.006) [-1472.314] (-1479.839) (-1471.327) -- 0:01:09

      Average standard deviation of split frequencies: 0.021816

      115500 -- [-1469.989] (-1472.832) (-1474.514) (-1471.610) * (-1476.252) (-1471.720) (-1475.553) [-1472.177] -- 0:01:08
      116000 -- (-1470.998) [-1471.629] (-1472.957) (-1472.948) * (-1470.479) (-1472.723) (-1476.434) [-1470.023] -- 0:01:08
      116500 -- (-1473.163) (-1470.724) [-1470.793] (-1475.465) * (-1475.449) (-1475.010) (-1472.428) [-1474.422] -- 0:01:08
      117000 -- (-1477.357) (-1472.907) [-1471.555] (-1471.128) * (-1474.777) [-1474.465] (-1475.573) (-1474.093) -- 0:01:07
      117500 -- (-1474.583) (-1473.098) (-1470.909) [-1472.297] * (-1474.777) (-1476.692) [-1473.585] (-1474.131) -- 0:01:07
      118000 -- [-1473.020] (-1474.145) (-1473.490) (-1470.160) * (-1478.653) (-1471.117) [-1470.718] (-1470.468) -- 0:01:07
      118500 -- (-1471.259) (-1475.424) (-1478.422) [-1472.077] * (-1478.614) (-1473.117) [-1471.046] (-1476.200) -- 0:01:06
      119000 -- (-1474.726) (-1475.577) [-1471.036] (-1476.862) * (-1478.966) [-1474.445] (-1475.596) (-1473.079) -- 0:01:06
      119500 -- (-1470.966) (-1473.870) (-1473.010) [-1480.547] * (-1477.532) (-1476.064) [-1475.084] (-1470.503) -- 0:01:06
      120000 -- (-1473.403) (-1473.604) [-1470.125] (-1473.647) * (-1477.537) (-1471.981) [-1472.394] (-1472.970) -- 0:01:06

      Average standard deviation of split frequencies: 0.023440

      120500 -- (-1472.320) (-1472.569) [-1477.745] (-1472.878) * (-1473.030) [-1471.401] (-1472.332) (-1476.240) -- 0:01:05
      121000 -- (-1471.090) (-1470.496) [-1473.572] (-1475.159) * (-1473.234) (-1472.579) [-1472.874] (-1473.515) -- 0:01:05
      121500 -- (-1472.500) [-1472.685] (-1472.441) (-1472.065) * (-1476.182) (-1475.554) (-1473.328) [-1470.644] -- 0:01:05
      122000 -- [-1469.957] (-1473.503) (-1472.846) (-1472.521) * (-1473.144) [-1470.448] (-1472.964) (-1476.021) -- 0:01:04
      122500 -- (-1479.294) (-1473.349) [-1472.354] (-1474.633) * (-1474.716) [-1474.171] (-1473.275) (-1473.572) -- 0:01:04
      123000 -- (-1471.847) (-1471.123) [-1472.910] (-1472.076) * (-1472.683) (-1475.305) [-1472.764] (-1473.605) -- 0:01:04
      123500 -- (-1480.326) (-1473.432) [-1473.313] (-1476.007) * (-1473.300) (-1476.673) (-1471.018) [-1474.028] -- 0:01:03
      124000 -- (-1472.211) [-1470.478] (-1473.750) (-1473.419) * [-1479.331] (-1475.272) (-1471.811) (-1475.990) -- 0:01:03
      124500 -- (-1475.412) [-1471.142] (-1472.523) (-1471.630) * (-1477.477) [-1475.455] (-1476.881) (-1473.017) -- 0:01:03
      125000 -- (-1473.436) (-1473.857) (-1473.374) [-1472.861] * (-1472.119) (-1474.668) (-1470.786) [-1474.520] -- 0:01:03

      Average standard deviation of split frequencies: 0.024693

      125500 -- (-1473.762) (-1472.746) [-1471.250] (-1473.663) * (-1472.800) (-1472.700) [-1472.329] (-1470.234) -- 0:01:02
      126000 -- (-1475.430) (-1474.033) [-1473.850] (-1479.021) * (-1475.365) (-1471.883) (-1475.702) [-1472.303] -- 0:01:02
      126500 -- (-1474.157) (-1478.802) (-1475.589) [-1473.191] * (-1473.702) (-1475.773) (-1474.102) [-1475.087] -- 0:01:02
      127000 -- (-1479.125) [-1471.733] (-1473.509) (-1475.787) * (-1472.839) (-1471.241) [-1475.498] (-1474.456) -- 0:01:01
      127500 -- [-1482.835] (-1475.683) (-1475.657) (-1477.508) * (-1471.892) (-1470.080) (-1470.792) [-1472.530] -- 0:01:01
      128000 -- (-1474.855) [-1471.992] (-1477.931) (-1472.667) * [-1473.469] (-1473.100) (-1475.358) (-1473.977) -- 0:01:01
      128500 -- (-1473.388) (-1473.546) [-1473.395] (-1474.332) * [-1470.536] (-1473.766) (-1475.604) (-1473.043) -- 0:01:01
      129000 -- (-1474.189) (-1476.693) [-1473.894] (-1471.144) * (-1472.371) [-1471.297] (-1475.095) (-1472.020) -- 0:01:07
      129500 -- [-1473.783] (-1474.177) (-1472.507) (-1471.248) * (-1470.893) [-1472.046] (-1476.691) (-1472.772) -- 0:01:07
      130000 -- [-1470.191] (-1471.148) (-1473.162) (-1473.879) * [-1471.450] (-1472.220) (-1476.354) (-1475.862) -- 0:01:06

      Average standard deviation of split frequencies: 0.023165

      130500 -- [-1472.762] (-1473.927) (-1474.537) (-1475.966) * (-1472.784) (-1476.531) (-1474.984) [-1471.762] -- 0:01:06
      131000 -- (-1473.193) [-1473.923] (-1472.703) (-1472.310) * [-1472.155] (-1470.943) (-1477.041) (-1472.133) -- 0:01:06
      131500 -- (-1474.318) [-1473.080] (-1471.518) (-1474.678) * (-1470.504) [-1472.778] (-1475.931) (-1477.898) -- 0:01:06
      132000 -- (-1474.477) [-1470.628] (-1474.590) (-1479.909) * (-1474.846) [-1470.004] (-1474.686) (-1474.172) -- 0:01:05
      132500 -- (-1474.216) (-1470.731) (-1476.212) [-1472.156] * (-1472.037) (-1471.287) (-1472.590) [-1473.313] -- 0:01:05
      133000 -- (-1470.760) (-1471.554) (-1471.187) [-1471.983] * (-1472.798) [-1472.915] (-1472.448) (-1471.596) -- 0:01:05
      133500 -- (-1470.738) (-1468.745) (-1471.592) [-1472.281] * (-1470.896) [-1477.671] (-1474.441) (-1474.847) -- 0:01:04
      134000 -- (-1473.038) (-1470.387) (-1473.689) [-1471.584] * (-1472.838) [-1469.972] (-1471.446) (-1474.297) -- 0:01:04
      134500 -- [-1474.001] (-1471.101) (-1472.855) (-1471.978) * (-1471.493) [-1472.192] (-1471.569) (-1476.879) -- 0:01:04
      135000 -- (-1476.622) [-1471.136] (-1471.439) (-1476.564) * (-1476.226) [-1470.290] (-1472.884) (-1471.740) -- 0:01:04

      Average standard deviation of split frequencies: 0.021760

      135500 -- (-1471.932) [-1470.369] (-1474.643) (-1474.292) * (-1472.311) [-1471.290] (-1475.929) (-1473.810) -- 0:01:03
      136000 -- (-1477.260) [-1469.785] (-1471.914) (-1476.626) * (-1474.306) [-1470.924] (-1472.106) (-1473.399) -- 0:01:03
      136500 -- (-1469.839) (-1473.070) [-1471.831] (-1475.763) * (-1473.181) [-1473.257] (-1472.253) (-1471.715) -- 0:01:03
      137000 -- (-1473.239) [-1471.792] (-1471.585) (-1475.890) * (-1473.321) (-1475.349) (-1471.883) [-1471.486] -- 0:01:02
      137500 -- [-1470.764] (-1474.985) (-1473.211) (-1477.153) * (-1475.721) (-1471.833) [-1470.430] (-1471.300) -- 0:01:02
      138000 -- [-1473.059] (-1471.113) (-1473.356) (-1475.263) * [-1474.192] (-1471.435) (-1472.769) (-1471.538) -- 0:01:02
      138500 -- (-1471.152) [-1472.410] (-1474.795) (-1472.935) * (-1478.388) (-1475.088) (-1472.919) [-1473.229] -- 0:01:02
      139000 -- (-1474.702) [-1471.734] (-1475.622) (-1472.701) * (-1473.100) (-1476.016) (-1470.711) [-1472.746] -- 0:01:01
      139500 -- [-1473.718] (-1470.999) (-1473.158) (-1472.024) * (-1471.938) (-1471.872) [-1472.163] (-1471.128) -- 0:01:01
      140000 -- (-1476.639) (-1471.283) (-1475.971) [-1474.580] * (-1473.207) [-1475.852] (-1473.308) (-1473.289) -- 0:01:01

      Average standard deviation of split frequencies: 0.024164

      140500 -- (-1472.725) (-1473.020) [-1475.855] (-1476.663) * (-1472.388) (-1470.949) (-1473.174) [-1472.383] -- 0:01:01
      141000 -- (-1475.366) [-1473.243] (-1474.005) (-1471.757) * (-1471.455) [-1471.985] (-1473.522) (-1474.261) -- 0:01:00
      141500 -- (-1474.580) (-1470.524) [-1474.526] (-1471.890) * (-1476.928) (-1472.742) (-1475.166) [-1474.590] -- 0:01:00
      142000 -- (-1471.746) [-1474.184] (-1474.688) (-1471.268) * (-1472.120) (-1475.317) [-1473.350] (-1480.556) -- 0:01:00
      142500 -- (-1474.319) (-1471.330) [-1473.716] (-1476.729) * (-1479.465) (-1471.274) [-1477.237] (-1471.550) -- 0:01:00
      143000 -- (-1473.246) (-1474.310) [-1471.973] (-1476.764) * (-1474.761) (-1471.463) [-1472.950] (-1473.625) -- 0:00:59
      143500 -- (-1473.685) [-1472.609] (-1475.824) (-1474.389) * (-1475.326) (-1471.382) (-1474.179) [-1471.615] -- 0:01:05
      144000 -- (-1473.505) (-1473.647) [-1472.973] (-1486.537) * [-1474.500] (-1471.046) (-1473.904) (-1475.113) -- 0:01:05
      144500 -- (-1477.282) [-1473.243] (-1471.189) (-1482.917) * (-1474.468) (-1471.718) [-1472.887] (-1472.141) -- 0:01:05
      145000 -- (-1478.736) (-1472.308) (-1471.575) [-1472.939] * (-1476.019) (-1475.954) [-1473.723] (-1474.907) -- 0:01:04

      Average standard deviation of split frequencies: 0.024471

      145500 -- (-1475.701) (-1475.266) (-1472.461) [-1476.448] * (-1470.249) (-1476.991) (-1474.608) [-1475.653] -- 0:01:04
      146000 -- (-1475.225) (-1474.092) [-1472.553] (-1474.543) * (-1474.120) (-1475.726) (-1473.832) [-1473.806] -- 0:01:04
      146500 -- (-1472.270) [-1473.427] (-1476.750) (-1473.106) * (-1472.564) [-1471.586] (-1476.227) (-1474.109) -- 0:01:04
      147000 -- (-1474.604) (-1478.208) [-1474.679] (-1470.923) * (-1473.500) [-1472.087] (-1480.506) (-1474.221) -- 0:01:03
      147500 -- (-1480.768) (-1472.141) [-1474.582] (-1475.233) * (-1475.297) (-1476.034) [-1476.038] (-1474.117) -- 0:01:03
      148000 -- (-1473.210) [-1472.388] (-1476.425) (-1472.859) * (-1472.382) (-1473.176) (-1479.542) [-1475.633] -- 0:01:03
      148500 -- (-1471.421) (-1472.766) [-1472.690] (-1472.487) * (-1474.683) [-1473.387] (-1478.549) (-1478.008) -- 0:01:03
      149000 -- [-1472.315] (-1474.207) (-1472.756) (-1470.637) * (-1470.627) [-1471.517] (-1476.313) (-1479.239) -- 0:01:02
      149500 -- (-1473.284) (-1475.545) [-1472.636] (-1473.666) * (-1471.897) (-1475.919) (-1474.205) [-1471.262] -- 0:01:02
      150000 -- [-1472.248] (-1471.677) (-1471.066) (-1471.329) * (-1470.519) (-1478.132) [-1472.105] (-1472.652) -- 0:01:02

      Average standard deviation of split frequencies: 0.023713

      150500 -- (-1470.138) [-1471.717] (-1471.738) (-1471.470) * (-1476.197) (-1476.050) [-1471.808] (-1470.898) -- 0:01:02
      151000 -- [-1472.608] (-1473.915) (-1473.711) (-1477.216) * [-1471.586] (-1476.597) (-1474.945) (-1470.423) -- 0:01:01
      151500 -- (-1470.269) (-1474.455) (-1471.210) [-1471.409] * (-1473.445) (-1475.527) [-1472.030] (-1470.360) -- 0:01:01
      152000 -- [-1471.613] (-1474.955) (-1472.490) (-1470.370) * (-1474.188) (-1475.780) (-1471.859) [-1472.687] -- 0:01:01
      152500 -- (-1472.554) (-1473.561) [-1471.499] (-1471.954) * (-1472.241) (-1475.453) (-1472.608) [-1473.870] -- 0:01:01
      153000 -- (-1471.775) (-1473.625) (-1475.371) [-1473.315] * (-1473.110) (-1474.451) (-1474.669) [-1471.965] -- 0:01:00
      153500 -- (-1477.377) (-1474.274) (-1472.948) [-1474.946] * (-1470.504) [-1477.595] (-1475.412) (-1472.082) -- 0:01:00
      154000 -- (-1472.055) (-1471.320) (-1473.920) [-1472.912] * (-1472.293) (-1475.416) [-1472.889] (-1472.293) -- 0:01:00
      154500 -- (-1474.141) (-1472.814) [-1472.267] (-1472.852) * [-1473.622] (-1477.181) (-1473.630) (-1471.084) -- 0:01:00
      155000 -- [-1471.448] (-1476.589) (-1474.472) (-1474.550) * [-1475.232] (-1474.918) (-1471.501) (-1472.448) -- 0:00:59

      Average standard deviation of split frequencies: 0.021630

      155500 -- (-1473.869) [-1475.742] (-1472.760) (-1473.340) * (-1475.916) (-1475.186) [-1472.735] (-1475.764) -- 0:00:59
      156000 -- [-1472.248] (-1481.229) (-1472.692) (-1473.301) * (-1476.387) (-1474.406) [-1475.057] (-1472.606) -- 0:00:59
      156500 -- (-1471.290) (-1476.235) [-1471.685] (-1471.788) * [-1475.128] (-1475.002) (-1474.542) (-1474.669) -- 0:00:59
      157000 -- (-1474.849) (-1473.064) (-1472.902) [-1473.708] * (-1472.447) (-1474.758) (-1476.944) [-1473.289] -- 0:00:59
      157500 -- [-1472.197] (-1474.683) (-1472.827) (-1471.913) * [-1472.425] (-1474.184) (-1477.431) (-1474.481) -- 0:00:58
      158000 -- (-1473.757) (-1474.628) [-1475.122] (-1474.424) * (-1471.217) (-1473.803) (-1472.187) [-1473.495] -- 0:00:58
      158500 -- [-1470.974] (-1477.120) (-1474.935) (-1472.453) * (-1475.429) (-1471.734) [-1473.229] (-1473.379) -- 0:01:03
      159000 -- (-1471.311) (-1473.571) [-1473.281] (-1474.695) * (-1471.049) (-1473.828) (-1471.282) [-1475.364] -- 0:01:03
      159500 -- (-1472.752) (-1479.714) [-1471.209] (-1471.603) * [-1475.986] (-1479.122) (-1471.871) (-1472.438) -- 0:01:03
      160000 -- (-1473.657) (-1473.611) (-1474.192) [-1472.649] * (-1474.783) [-1474.390] (-1474.648) (-1471.625) -- 0:01:02

      Average standard deviation of split frequencies: 0.021002

      160500 -- (-1475.230) [-1473.432] (-1474.569) (-1471.148) * (-1473.498) (-1472.757) (-1476.214) [-1474.162] -- 0:01:02
      161000 -- (-1477.212) (-1474.966) [-1472.429] (-1471.816) * (-1479.759) (-1476.474) (-1474.580) [-1476.063] -- 0:01:02
      161500 -- (-1476.190) (-1472.179) (-1473.209) [-1471.082] * (-1475.419) [-1475.968] (-1473.037) (-1470.469) -- 0:01:02
      162000 -- [-1475.447] (-1473.453) (-1472.117) (-1473.865) * (-1472.997) (-1479.293) (-1472.443) [-1472.188] -- 0:01:02
      162500 -- (-1473.557) (-1475.570) [-1472.458] (-1478.190) * (-1471.013) (-1473.840) [-1471.494] (-1474.145) -- 0:01:01
      163000 -- (-1472.784) (-1477.369) (-1471.415) [-1473.297] * [-1474.406] (-1475.922) (-1473.129) (-1473.558) -- 0:01:01
      163500 -- [-1472.770] (-1474.929) (-1475.355) (-1470.711) * (-1474.383) [-1473.139] (-1470.769) (-1473.238) -- 0:01:01
      164000 -- (-1472.706) (-1475.635) (-1473.884) [-1472.927] * (-1476.722) (-1475.922) [-1471.574] (-1473.914) -- 0:01:01
      164500 -- [-1472.265] (-1478.713) (-1473.181) (-1471.173) * (-1473.380) (-1476.043) (-1471.499) [-1473.550] -- 0:01:00
      165000 -- (-1474.662) [-1475.776] (-1474.327) (-1473.125) * [-1470.934] (-1474.959) (-1470.467) (-1474.412) -- 0:01:00

      Average standard deviation of split frequencies: 0.021822

      165500 -- (-1475.964) (-1474.977) [-1473.092] (-1470.699) * (-1477.004) (-1475.400) (-1470.077) [-1474.960] -- 0:01:00
      166000 -- (-1474.538) [-1471.050] (-1479.736) (-1472.495) * [-1476.932] (-1476.731) (-1474.926) (-1472.256) -- 0:01:00
      166500 -- (-1478.795) [-1478.803] (-1473.069) (-1471.859) * [-1474.123] (-1476.375) (-1473.235) (-1475.789) -- 0:01:00
      167000 -- (-1474.444) [-1471.848] (-1471.972) (-1471.959) * (-1475.962) (-1477.608) (-1471.050) [-1477.669] -- 0:00:59
      167500 -- (-1472.694) (-1475.836) [-1472.083] (-1471.901) * (-1472.621) (-1471.643) [-1471.931] (-1473.333) -- 0:00:59
      168000 -- (-1473.187) (-1474.174) [-1473.573] (-1475.457) * (-1483.829) (-1472.756) [-1471.999] (-1474.110) -- 0:00:59
      168500 -- [-1474.788] (-1474.417) (-1476.893) (-1478.416) * (-1473.480) (-1478.486) (-1471.560) [-1470.975] -- 0:00:59
      169000 -- (-1477.217) (-1471.891) (-1473.399) [-1476.207] * [-1472.017] (-1475.323) (-1474.957) (-1481.346) -- 0:00:59
      169500 -- (-1473.349) (-1474.143) [-1474.526] (-1474.932) * (-1474.384) (-1476.743) (-1471.661) [-1473.921] -- 0:00:58
      170000 -- (-1473.258) (-1471.571) (-1473.892) [-1480.132] * (-1472.585) (-1473.236) [-1474.922] (-1475.904) -- 0:00:58

      Average standard deviation of split frequencies: 0.022097

      170500 -- (-1475.628) (-1473.978) [-1474.692] (-1479.227) * (-1475.708) [-1473.029] (-1475.837) (-1473.512) -- 0:00:58
      171000 -- (-1478.280) (-1475.322) [-1470.625] (-1472.432) * (-1474.867) (-1473.814) (-1479.974) [-1473.226] -- 0:00:58
      171500 -- (-1472.632) (-1477.666) (-1473.204) [-1471.938] * (-1472.837) (-1471.115) [-1473.634] (-1476.002) -- 0:00:57
      172000 -- [-1471.373] (-1474.261) (-1473.210) (-1470.156) * (-1472.813) (-1472.180) [-1472.992] (-1473.852) -- 0:00:57
      172500 -- (-1470.814) (-1477.754) (-1473.690) [-1474.086] * (-1472.678) (-1472.370) (-1474.831) [-1472.055] -- 0:00:57
      173000 -- (-1471.161) (-1475.170) (-1472.141) [-1473.286] * (-1475.509) (-1473.102) [-1472.169] (-1470.653) -- 0:00:57
      173500 -- (-1473.343) [-1472.646] (-1473.167) (-1471.336) * (-1476.242) (-1471.425) (-1471.299) [-1474.436] -- 0:01:01
      174000 -- [-1471.109] (-1473.770) (-1473.875) (-1473.640) * (-1474.723) (-1475.155) [-1472.035] (-1471.788) -- 0:01:01
      174500 -- [-1473.352] (-1478.701) (-1473.284) (-1472.946) * (-1471.692) (-1474.010) [-1472.703] (-1474.148) -- 0:01:01
      175000 -- (-1472.206) (-1478.418) (-1471.108) [-1474.221] * (-1475.517) [-1473.307] (-1474.664) (-1473.825) -- 0:01:01

      Average standard deviation of split frequencies: 0.022978

      175500 -- (-1474.583) (-1477.291) (-1471.867) [-1471.817] * (-1473.991) [-1474.997] (-1473.750) (-1479.742) -- 0:01:01
      176000 -- (-1471.936) (-1478.845) [-1473.617] (-1471.727) * (-1475.360) [-1473.761] (-1477.354) (-1475.384) -- 0:01:00
      176500 -- (-1473.974) (-1477.219) [-1472.843] (-1471.349) * (-1471.350) [-1471.539] (-1473.605) (-1474.062) -- 0:01:00
      177000 -- [-1476.874] (-1475.239) (-1471.737) (-1475.494) * (-1470.793) (-1473.838) [-1470.486] (-1473.463) -- 0:01:00
      177500 -- (-1472.593) (-1472.212) (-1471.392) [-1472.475] * (-1471.842) (-1477.344) [-1470.400] (-1476.842) -- 0:01:00
      178000 -- [-1470.762] (-1475.131) (-1472.751) (-1470.367) * (-1473.892) (-1475.025) [-1472.334] (-1472.704) -- 0:01:00
      178500 -- (-1471.860) (-1476.327) (-1475.577) [-1472.796] * [-1470.636] (-1473.774) (-1474.908) (-1473.795) -- 0:00:59
      179000 -- (-1470.454) (-1475.640) (-1476.288) [-1470.342] * [-1471.281] (-1474.387) (-1477.316) (-1480.308) -- 0:00:59
      179500 -- [-1475.185] (-1475.704) (-1472.202) (-1473.975) * (-1471.459) (-1473.852) [-1472.860] (-1476.421) -- 0:00:59
      180000 -- [-1474.935] (-1476.953) (-1478.150) (-1473.347) * (-1470.119) [-1472.714] (-1473.848) (-1475.785) -- 0:00:59

      Average standard deviation of split frequencies: 0.020874

      180500 -- (-1474.521) (-1475.823) [-1472.594] (-1471.602) * (-1474.339) [-1474.898] (-1475.283) (-1472.543) -- 0:00:59
      181000 -- [-1476.709] (-1477.679) (-1473.247) (-1474.920) * (-1476.729) (-1473.404) [-1470.554] (-1476.466) -- 0:00:58
      181500 -- (-1478.081) [-1474.445] (-1474.512) (-1474.760) * (-1476.058) (-1474.054) [-1469.201] (-1473.848) -- 0:00:58
      182000 -- (-1472.630) (-1476.647) (-1472.535) [-1473.103] * [-1471.838] (-1470.452) (-1473.287) (-1472.876) -- 0:00:58
      182500 -- (-1470.859) [-1478.105] (-1473.516) (-1472.650) * (-1478.696) (-1482.127) (-1471.281) [-1472.303] -- 0:00:58
      183000 -- [-1476.092] (-1476.163) (-1473.802) (-1473.134) * [-1470.394] (-1477.426) (-1471.888) (-1477.352) -- 0:00:58
      183500 -- (-1472.675) (-1476.506) (-1473.623) [-1472.143] * [-1470.144] (-1477.286) (-1472.181) (-1473.866) -- 0:00:57
      184000 -- (-1478.014) (-1476.078) (-1475.650) [-1471.648] * (-1471.654) [-1470.882] (-1475.455) (-1470.749) -- 0:00:57
      184500 -- (-1476.414) [-1474.874] (-1473.222) (-1475.593) * (-1474.193) (-1471.128) [-1469.914] (-1474.346) -- 0:00:57
      185000 -- (-1473.457) (-1474.821) [-1471.239] (-1476.077) * [-1472.092] (-1473.204) (-1473.690) (-1471.491) -- 0:00:57

      Average standard deviation of split frequencies: 0.021844

      185500 -- (-1472.351) (-1472.790) (-1472.220) [-1472.791] * [-1475.240] (-1476.943) (-1473.506) (-1471.159) -- 0:00:57
      186000 -- [-1471.333] (-1471.849) (-1472.449) (-1475.022) * (-1472.041) (-1479.524) [-1474.138] (-1475.175) -- 0:00:56
      186500 -- (-1469.996) (-1471.249) [-1474.021] (-1473.821) * [-1469.531] (-1476.191) (-1472.026) (-1471.407) -- 0:00:56
      187000 -- (-1471.886) [-1471.556] (-1473.929) (-1471.337) * [-1471.777] (-1479.090) (-1471.766) (-1473.960) -- 0:00:56
      187500 -- [-1477.154] (-1472.493) (-1474.120) (-1474.852) * (-1470.041) [-1475.403] (-1475.096) (-1473.606) -- 0:00:56
      188000 -- [-1477.369] (-1470.236) (-1475.924) (-1473.467) * [-1476.170] (-1475.629) (-1473.527) (-1474.131) -- 0:01:00
      188500 -- (-1477.233) [-1474.385] (-1476.327) (-1476.318) * (-1470.662) (-1473.889) (-1473.560) [-1473.168] -- 0:01:00
      189000 -- (-1477.976) [-1473.839] (-1474.357) (-1473.922) * (-1472.655) (-1472.503) (-1473.771) [-1471.390] -- 0:01:00
      189500 -- (-1476.505) (-1474.767) (-1476.445) [-1471.681] * (-1470.146) (-1473.982) (-1471.771) [-1470.608] -- 0:00:59
      190000 -- (-1473.250) [-1474.467] (-1477.364) (-1472.006) * [-1472.121] (-1472.750) (-1475.558) (-1472.798) -- 0:00:59

      Average standard deviation of split frequencies: 0.022499

      190500 -- (-1469.743) (-1472.263) [-1481.370] (-1473.068) * [-1472.181] (-1476.543) (-1474.125) (-1473.255) -- 0:00:59
      191000 -- (-1472.536) [-1470.951] (-1475.125) (-1474.161) * (-1473.581) (-1473.225) [-1474.700] (-1475.210) -- 0:00:59
      191500 -- (-1471.617) [-1472.427] (-1475.280) (-1475.924) * (-1475.485) (-1471.717) [-1472.404] (-1473.988) -- 0:00:59
      192000 -- (-1473.182) [-1472.305] (-1473.993) (-1476.941) * (-1472.458) [-1472.718] (-1476.787) (-1475.227) -- 0:00:58
      192500 -- (-1478.826) (-1483.336) [-1474.350] (-1476.517) * (-1477.947) (-1471.703) [-1470.910] (-1473.271) -- 0:00:58
      193000 -- [-1473.646] (-1471.478) (-1472.506) (-1471.428) * (-1473.839) (-1474.609) [-1471.586] (-1473.028) -- 0:00:58
      193500 -- (-1473.851) (-1474.719) (-1474.691) [-1471.431] * [-1470.606] (-1471.747) (-1472.240) (-1473.725) -- 0:00:58
      194000 -- [-1480.040] (-1472.802) (-1473.741) (-1475.167) * (-1471.838) [-1473.187] (-1471.115) (-1475.699) -- 0:00:58
      194500 -- [-1470.060] (-1472.876) (-1473.968) (-1476.821) * (-1471.741) (-1471.893) [-1473.433] (-1476.551) -- 0:00:57
      195000 -- (-1471.098) (-1471.504) [-1474.193] (-1472.090) * (-1473.685) [-1471.580] (-1471.934) (-1475.777) -- 0:00:57

      Average standard deviation of split frequencies: 0.021393

      195500 -- [-1472.591] (-1478.000) (-1473.291) (-1473.503) * (-1473.152) (-1472.427) (-1472.198) [-1474.579] -- 0:00:57
      196000 -- (-1471.921) (-1478.176) (-1473.395) [-1472.186] * [-1472.455] (-1470.676) (-1473.447) (-1475.287) -- 0:00:57
      196500 -- (-1473.502) (-1475.492) (-1472.254) [-1476.111] * (-1474.322) [-1474.788] (-1470.733) (-1479.162) -- 0:00:57
      197000 -- (-1471.597) (-1472.180) (-1473.190) [-1473.615] * (-1473.482) (-1474.801) [-1471.030] (-1478.493) -- 0:00:57
      197500 -- (-1474.095) (-1472.024) [-1472.031] (-1471.104) * (-1473.243) (-1476.763) (-1471.721) [-1474.618] -- 0:00:56
      198000 -- (-1474.452) (-1470.274) (-1473.043) [-1472.841] * [-1471.543] (-1472.809) (-1470.614) (-1481.341) -- 0:00:56
      198500 -- (-1471.968) [-1473.748] (-1474.961) (-1471.380) * [-1471.843] (-1473.234) (-1475.546) (-1473.774) -- 0:00:56
      199000 -- (-1472.208) (-1477.379) (-1473.356) [-1471.305] * (-1472.423) (-1472.202) [-1475.012] (-1473.770) -- 0:00:56
      199500 -- (-1475.213) (-1475.312) [-1478.780] (-1472.623) * [-1474.154] (-1473.317) (-1481.417) (-1473.523) -- 0:00:56
      200000 -- (-1476.175) (-1479.667) (-1476.691) [-1472.036] * (-1471.344) [-1472.020] (-1481.937) (-1472.891) -- 0:00:55

      Average standard deviation of split frequencies: 0.020648

      200500 -- [-1475.516] (-1476.288) (-1475.006) (-1472.033) * (-1475.833) [-1471.290] (-1477.849) (-1473.059) -- 0:00:55
      201000 -- [-1474.152] (-1475.434) (-1473.075) (-1471.003) * (-1475.936) [-1473.201] (-1474.950) (-1474.660) -- 0:00:55
      201500 -- (-1477.854) (-1475.829) [-1472.408] (-1471.603) * (-1472.858) (-1474.593) [-1471.623] (-1473.934) -- 0:00:55
      202000 -- (-1477.677) (-1472.144) (-1472.042) [-1471.040] * (-1471.168) (-1479.165) [-1469.919] (-1473.563) -- 0:00:55
      202500 -- (-1477.242) (-1471.472) [-1473.690] (-1471.990) * (-1476.423) (-1471.181) (-1472.694) [-1472.698] -- 0:00:55
      203000 -- (-1470.949) [-1471.882] (-1472.024) (-1473.622) * (-1473.377) (-1470.862) [-1471.310] (-1470.963) -- 0:00:58
      203500 -- (-1471.061) (-1473.640) [-1470.264] (-1471.449) * [-1469.399] (-1472.181) (-1473.479) (-1474.795) -- 0:00:58
      204000 -- (-1476.821) (-1475.013) (-1472.170) [-1473.903] * (-1473.936) (-1475.358) (-1473.469) [-1471.796] -- 0:00:58
      204500 -- (-1476.037) (-1474.422) [-1472.888] (-1473.079) * (-1474.044) [-1472.276] (-1473.105) (-1474.031) -- 0:00:58
      205000 -- (-1472.496) [-1472.242] (-1473.629) (-1472.846) * (-1475.234) [-1476.310] (-1471.528) (-1473.735) -- 0:00:58

      Average standard deviation of split frequencies: 0.021920

      205500 -- [-1472.901] (-1471.354) (-1475.640) (-1475.005) * (-1472.503) (-1478.158) [-1472.835] (-1474.052) -- 0:00:57
      206000 -- [-1472.206] (-1469.743) (-1478.600) (-1472.140) * [-1478.613] (-1473.236) (-1470.026) (-1473.428) -- 0:00:57
      206500 -- (-1471.689) [-1470.946] (-1476.201) (-1475.690) * (-1474.237) (-1473.373) (-1474.966) [-1470.765] -- 0:00:57
      207000 -- (-1472.911) (-1473.164) [-1473.997] (-1476.633) * [-1470.548] (-1474.018) (-1473.546) (-1470.693) -- 0:00:57
      207500 -- [-1470.865] (-1473.528) (-1473.870) (-1471.076) * (-1471.193) [-1472.851] (-1472.819) (-1475.508) -- 0:00:57
      208000 -- (-1473.982) (-1470.909) (-1472.984) [-1473.385] * [-1472.644] (-1476.300) (-1477.604) (-1473.437) -- 0:00:57
      208500 -- (-1476.205) [-1473.434] (-1474.194) (-1477.662) * (-1478.245) (-1474.140) [-1471.832] (-1473.399) -- 0:00:56
      209000 -- (-1471.186) (-1474.350) [-1472.597] (-1477.112) * (-1471.999) (-1473.941) (-1476.443) [-1474.525] -- 0:00:56
      209500 -- [-1476.549] (-1476.001) (-1475.284) (-1473.914) * (-1472.071) (-1475.808) [-1470.967] (-1473.640) -- 0:00:56
      210000 -- (-1475.167) (-1471.650) [-1472.342] (-1483.650) * (-1472.409) (-1477.016) [-1470.543] (-1478.600) -- 0:00:56

      Average standard deviation of split frequencies: 0.019803

      210500 -- (-1475.177) [-1470.916] (-1474.497) (-1476.242) * [-1474.470] (-1477.598) (-1472.436) (-1482.988) -- 0:00:56
      211000 -- (-1472.966) (-1471.567) (-1474.097) [-1473.257] * [-1477.219] (-1475.733) (-1470.809) (-1476.551) -- 0:00:56
      211500 -- (-1472.833) (-1473.123) (-1476.148) [-1476.193] * (-1472.121) [-1470.771] (-1471.387) (-1474.754) -- 0:00:55
      212000 -- (-1475.545) (-1475.517) [-1473.168] (-1472.828) * (-1473.134) [-1471.180] (-1473.774) (-1475.236) -- 0:00:55
      212500 -- (-1474.423) [-1471.112] (-1474.076) (-1470.669) * [-1470.964] (-1470.557) (-1475.935) (-1477.549) -- 0:00:55
      213000 -- (-1474.415) (-1471.208) [-1472.264] (-1471.979) * (-1471.801) (-1470.344) [-1474.420] (-1476.077) -- 0:00:55
      213500 -- [-1472.676] (-1472.625) (-1477.370) (-1473.879) * [-1471.736] (-1476.834) (-1471.021) (-1475.723) -- 0:00:55
      214000 -- (-1476.524) [-1474.810] (-1474.304) (-1473.818) * [-1473.942] (-1471.806) (-1474.196) (-1477.286) -- 0:00:55
      214500 -- (-1472.922) (-1473.463) (-1479.985) [-1472.493] * [-1475.233] (-1474.203) (-1470.414) (-1473.862) -- 0:00:54
      215000 -- (-1473.117) [-1471.131] (-1477.654) (-1472.383) * (-1475.560) (-1471.072) (-1471.899) [-1476.939] -- 0:00:54

      Average standard deviation of split frequencies: 0.018838

      215500 -- [-1474.045] (-1476.521) (-1474.510) (-1471.330) * (-1476.648) [-1470.697] (-1473.466) (-1477.890) -- 0:00:54
      216000 -- (-1473.536) [-1475.974] (-1472.384) (-1472.806) * (-1473.874) [-1474.768] (-1474.332) (-1475.826) -- 0:00:54
      216500 -- (-1473.398) (-1472.261) [-1470.688] (-1475.995) * (-1471.533) (-1472.684) (-1475.650) [-1472.677] -- 0:00:54
      217000 -- (-1473.013) (-1472.644) [-1472.525] (-1476.490) * (-1470.579) (-1472.567) [-1475.810] (-1470.655) -- 0:00:54
      217500 -- (-1472.097) [-1471.185] (-1476.972) (-1476.943) * (-1473.231) (-1472.990) (-1475.545) [-1473.069] -- 0:00:57
      218000 -- (-1473.278) [-1474.089] (-1474.324) (-1474.058) * [-1471.270] (-1472.910) (-1474.265) (-1474.107) -- 0:00:57
      218500 -- (-1472.266) [-1469.952] (-1472.477) (-1473.731) * (-1475.704) (-1472.837) (-1470.086) [-1473.654] -- 0:00:57
      219000 -- (-1472.118) [-1471.495] (-1475.611) (-1471.847) * (-1475.243) (-1476.977) (-1473.300) [-1477.242] -- 0:00:57
      219500 -- [-1471.464] (-1475.426) (-1476.415) (-1473.657) * (-1475.786) [-1472.849] (-1471.921) (-1474.506) -- 0:00:56
      220000 -- (-1470.401) [-1473.001] (-1475.817) (-1471.921) * (-1477.626) (-1471.299) (-1475.642) [-1472.018] -- 0:00:56

      Average standard deviation of split frequencies: 0.017209

      220500 -- (-1477.489) (-1479.376) [-1471.327] (-1472.217) * (-1472.079) [-1472.573] (-1476.784) (-1476.136) -- 0:00:56
      221000 -- (-1476.588) [-1472.703] (-1470.710) (-1472.666) * (-1472.585) (-1471.684) (-1476.196) [-1475.363] -- 0:00:56
      221500 -- (-1471.318) (-1474.638) [-1470.317] (-1470.443) * (-1475.431) [-1471.388] (-1477.155) (-1476.351) -- 0:00:56
      222000 -- [-1471.015] (-1471.160) (-1472.738) (-1469.913) * [-1474.833] (-1472.196) (-1472.588) (-1472.680) -- 0:00:56
      222500 -- (-1476.720) [-1473.937] (-1472.760) (-1471.006) * (-1470.776) (-1471.885) (-1474.886) [-1470.930] -- 0:00:55
      223000 -- (-1475.180) [-1472.982] (-1473.230) (-1477.554) * (-1476.349) (-1475.759) (-1472.702) [-1471.699] -- 0:00:55
      223500 -- (-1471.549) [-1473.035] (-1472.727) (-1469.562) * [-1471.711] (-1477.289) (-1473.126) (-1472.894) -- 0:00:55
      224000 -- [-1474.175] (-1479.193) (-1470.328) (-1472.604) * (-1472.025) (-1476.432) [-1469.638] (-1472.822) -- 0:00:55
      224500 -- (-1473.992) [-1472.540] (-1472.260) (-1472.321) * [-1475.208] (-1475.076) (-1470.999) (-1474.618) -- 0:00:55
      225000 -- [-1471.999] (-1472.746) (-1473.200) (-1472.345) * (-1474.806) [-1471.516] (-1471.030) (-1473.514) -- 0:00:55

      Average standard deviation of split frequencies: 0.016803

      225500 -- [-1473.695] (-1471.907) (-1473.487) (-1472.562) * [-1472.155] (-1472.685) (-1472.478) (-1473.582) -- 0:00:54
      226000 -- (-1471.332) (-1475.124) [-1473.200] (-1473.931) * [-1472.660] (-1477.922) (-1477.118) (-1474.815) -- 0:00:54
      226500 -- (-1472.581) (-1475.095) (-1476.058) [-1470.302] * (-1473.999) (-1476.525) (-1474.396) [-1473.356] -- 0:00:54
      227000 -- (-1470.882) (-1472.300) [-1477.494] (-1471.801) * (-1472.996) (-1471.737) [-1473.993] (-1471.868) -- 0:00:54
      227500 -- (-1473.220) (-1472.563) [-1472.529] (-1478.905) * (-1476.611) (-1478.271) [-1473.942] (-1476.115) -- 0:00:54
      228000 -- (-1473.666) (-1475.966) [-1473.483] (-1471.094) * (-1475.103) (-1477.546) [-1471.937] (-1475.937) -- 0:00:54
      228500 -- [-1472.762] (-1473.982) (-1473.837) (-1472.552) * (-1471.060) (-1473.139) (-1472.627) [-1476.943] -- 0:00:54
      229000 -- (-1472.939) (-1475.330) [-1473.259] (-1472.313) * (-1471.373) (-1472.705) [-1471.357] (-1479.179) -- 0:00:53
      229500 -- (-1473.863) (-1474.242) (-1472.348) [-1470.105] * (-1471.777) (-1474.595) [-1477.494] (-1471.346) -- 0:00:53
      230000 -- (-1471.740) (-1474.336) (-1476.437) [-1475.065] * (-1472.563) (-1472.929) (-1473.353) [-1474.774] -- 0:00:53

      Average standard deviation of split frequencies: 0.015267

      230500 -- (-1470.932) (-1476.463) [-1475.729] (-1473.454) * [-1476.392] (-1472.142) (-1473.198) (-1476.206) -- 0:00:53
      231000 -- [-1473.964] (-1476.901) (-1475.262) (-1479.576) * [-1478.605] (-1474.290) (-1471.776) (-1472.805) -- 0:00:53
      231500 -- [-1474.040] (-1475.924) (-1475.138) (-1475.449) * (-1472.688) (-1475.929) [-1469.976] (-1475.069) -- 0:00:53
      232000 -- [-1472.496] (-1473.012) (-1475.327) (-1475.516) * (-1471.965) (-1474.373) [-1472.142] (-1474.539) -- 0:00:52
      232500 -- (-1475.110) [-1473.809] (-1476.228) (-1474.782) * (-1474.257) (-1473.603) [-1471.236] (-1470.384) -- 0:00:56
      233000 -- (-1474.234) (-1472.903) [-1473.809] (-1473.107) * (-1476.294) [-1471.106] (-1473.128) (-1469.665) -- 0:00:55
      233500 -- (-1473.564) [-1473.071] (-1476.363) (-1475.974) * (-1473.381) (-1470.657) (-1478.183) [-1472.996] -- 0:00:55
      234000 -- [-1471.355] (-1474.703) (-1479.690) (-1472.188) * (-1474.094) (-1472.952) [-1473.591] (-1471.900) -- 0:00:55
      234500 -- (-1474.574) (-1472.781) [-1472.623] (-1472.332) * [-1474.002] (-1473.918) (-1475.473) (-1471.700) -- 0:00:55
      235000 -- [-1474.063] (-1471.313) (-1472.875) (-1477.304) * (-1471.421) [-1473.570] (-1472.150) (-1472.874) -- 0:00:55

      Average standard deviation of split frequencies: 0.015745

      235500 -- [-1473.759] (-1471.372) (-1472.140) (-1470.550) * (-1473.599) (-1476.785) (-1471.435) [-1475.315] -- 0:00:55
      236000 -- (-1471.454) [-1477.839] (-1471.911) (-1472.866) * (-1473.228) [-1471.933] (-1472.432) (-1473.619) -- 0:00:55
      236500 -- (-1472.960) (-1470.791) (-1474.127) [-1472.595] * (-1474.164) (-1474.777) (-1470.349) [-1472.022] -- 0:00:54
      237000 -- (-1473.336) (-1471.013) (-1471.820) [-1472.477] * (-1473.811) [-1474.790] (-1476.955) (-1475.922) -- 0:00:54
      237500 -- (-1472.488) (-1469.810) [-1471.719] (-1471.891) * (-1473.351) (-1474.538) [-1474.735] (-1473.381) -- 0:00:54
      238000 -- (-1473.609) (-1471.953) (-1472.041) [-1474.336] * [-1471.437] (-1476.351) (-1474.800) (-1474.048) -- 0:00:54
      238500 -- (-1472.418) [-1471.061] (-1472.456) (-1475.313) * (-1474.482) (-1475.841) [-1472.448] (-1474.791) -- 0:00:54
      239000 -- (-1475.375) (-1475.961) (-1471.903) [-1473.190] * (-1482.192) [-1474.973] (-1474.619) (-1475.337) -- 0:00:54
      239500 -- (-1474.203) [-1469.977] (-1472.914) (-1471.110) * (-1481.588) (-1473.787) (-1473.726) [-1472.845] -- 0:00:53
      240000 -- (-1475.101) [-1474.348] (-1476.778) (-1471.357) * (-1478.282) (-1474.000) [-1471.404] (-1469.865) -- 0:00:53

      Average standard deviation of split frequencies: 0.015555

      240500 -- (-1471.196) [-1471.266] (-1476.405) (-1472.161) * (-1473.198) (-1476.500) [-1472.686] (-1472.377) -- 0:00:53
      241000 -- (-1476.160) [-1470.302] (-1474.379) (-1472.504) * (-1473.063) (-1472.581) [-1474.690] (-1470.983) -- 0:00:53
      241500 -- (-1476.685) (-1474.523) (-1478.181) [-1470.335] * (-1472.924) [-1473.905] (-1475.155) (-1471.065) -- 0:00:53
      242000 -- [-1471.816] (-1471.653) (-1475.633) (-1474.582) * (-1471.382) (-1475.370) (-1473.645) [-1473.482] -- 0:00:53
      242500 -- (-1475.157) (-1473.829) (-1473.301) [-1474.483] * [-1473.235] (-1470.046) (-1472.527) (-1474.500) -- 0:00:53
      243000 -- (-1473.595) (-1473.314) (-1471.048) [-1472.201] * (-1470.082) (-1475.120) (-1473.082) [-1473.969] -- 0:00:52
      243500 -- (-1472.804) (-1474.695) (-1472.395) [-1471.882] * (-1472.576) [-1474.233] (-1476.800) (-1472.839) -- 0:00:52
      244000 -- (-1478.564) [-1471.479] (-1471.245) (-1471.997) * [-1472.088] (-1475.507) (-1481.325) (-1473.972) -- 0:00:52
      244500 -- (-1480.662) (-1472.411) (-1470.226) [-1472.448] * (-1479.201) (-1477.404) [-1476.915] (-1474.153) -- 0:00:52
      245000 -- (-1474.220) (-1472.283) (-1473.020) [-1472.079] * (-1474.503) [-1471.304] (-1475.508) (-1473.978) -- 0:00:52

      Average standard deviation of split frequencies: 0.016182

      245500 -- (-1474.814) (-1473.283) (-1475.876) [-1473.316] * (-1477.136) [-1472.397] (-1484.517) (-1471.017) -- 0:00:52
      246000 -- [-1473.893] (-1471.755) (-1474.030) (-1475.939) * (-1472.667) [-1473.746] (-1478.641) (-1474.764) -- 0:00:52
      246500 -- [-1471.699] (-1473.699) (-1474.713) (-1478.085) * (-1472.975) [-1475.914] (-1476.981) (-1472.605) -- 0:00:51
      247000 -- (-1470.551) (-1474.351) (-1471.586) [-1471.844] * [-1471.337] (-1476.333) (-1472.630) (-1473.147) -- 0:00:54
      247500 -- (-1473.688) (-1472.754) (-1471.477) [-1472.020] * (-1474.659) (-1474.164) (-1469.704) [-1471.577] -- 0:00:54
      248000 -- [-1473.963] (-1473.788) (-1472.299) (-1473.023) * (-1473.004) (-1475.145) (-1471.792) [-1472.160] -- 0:00:54
      248500 -- (-1473.818) (-1472.266) (-1473.162) [-1470.855] * [-1475.088] (-1473.291) (-1479.058) (-1471.943) -- 0:00:54
      249000 -- (-1480.348) [-1471.420] (-1474.249) (-1473.360) * (-1472.684) (-1477.058) [-1473.935] (-1471.706) -- 0:00:54
      249500 -- (-1474.968) [-1470.135] (-1471.732) (-1474.125) * (-1473.087) (-1476.034) (-1474.059) [-1470.872] -- 0:00:54
      250000 -- (-1472.380) (-1473.176) [-1472.805] (-1478.225) * (-1472.518) (-1475.036) (-1475.346) [-1471.837] -- 0:00:54

      Average standard deviation of split frequencies: 0.014105

      250500 -- (-1474.805) (-1470.336) (-1472.564) [-1474.413] * (-1472.098) (-1474.656) (-1475.598) [-1472.806] -- 0:00:53
      251000 -- [-1471.652] (-1471.971) (-1474.054) (-1474.505) * [-1470.462] (-1473.981) (-1475.464) (-1472.943) -- 0:00:53
      251500 -- (-1472.267) (-1478.582) [-1473.625] (-1474.151) * (-1470.792) (-1474.028) (-1476.231) [-1470.883] -- 0:00:53
      252000 -- (-1472.982) [-1477.112] (-1473.597) (-1474.543) * [-1469.912] (-1475.563) (-1473.629) (-1472.966) -- 0:00:53
      252500 -- (-1477.864) (-1473.037) (-1476.664) [-1474.785] * (-1475.039) (-1472.268) [-1470.368] (-1473.185) -- 0:00:53
      253000 -- [-1473.772] (-1474.802) (-1473.102) (-1473.985) * (-1475.571) [-1471.881] (-1471.663) (-1472.613) -- 0:00:53
      253500 -- (-1473.974) (-1473.026) [-1470.441] (-1477.021) * (-1476.051) [-1472.823] (-1472.501) (-1476.398) -- 0:00:53
      254000 -- (-1475.437) (-1473.041) [-1475.281] (-1473.426) * [-1477.655] (-1472.559) (-1472.613) (-1476.242) -- 0:00:52
      254500 -- (-1480.699) (-1472.164) (-1477.167) [-1471.223] * (-1474.292) (-1474.399) [-1472.578] (-1475.596) -- 0:00:52
      255000 -- [-1475.798] (-1473.557) (-1473.473) (-1472.313) * [-1472.118] (-1474.596) (-1474.675) (-1477.490) -- 0:00:52

      Average standard deviation of split frequencies: 0.014846

      255500 -- (-1475.811) (-1472.446) [-1471.907] (-1475.036) * [-1471.983] (-1477.286) (-1472.302) (-1473.325) -- 0:00:52
      256000 -- (-1478.916) (-1472.488) [-1472.114] (-1472.612) * (-1473.695) (-1479.144) (-1471.734) [-1470.866] -- 0:00:52
      256500 -- (-1475.585) (-1473.887) (-1469.704) [-1472.309] * (-1471.844) [-1478.194] (-1474.075) (-1475.028) -- 0:00:52
      257000 -- (-1477.205) (-1472.617) [-1473.606] (-1474.096) * (-1473.186) (-1472.973) [-1471.844] (-1476.542) -- 0:00:52
      257500 -- (-1476.421) [-1475.037] (-1474.253) (-1477.598) * (-1472.685) [-1476.710] (-1472.035) (-1470.976) -- 0:00:51
      258000 -- (-1477.043) (-1471.145) [-1473.014] (-1474.306) * (-1473.211) [-1473.802] (-1475.597) (-1474.082) -- 0:00:51
      258500 -- [-1474.123] (-1475.227) (-1472.165) (-1473.899) * (-1474.882) (-1474.968) (-1473.119) [-1474.285] -- 0:00:51
      259000 -- (-1472.493) (-1471.581) (-1475.463) [-1471.227] * [-1470.719] (-1474.231) (-1473.822) (-1471.729) -- 0:00:51
      259500 -- [-1473.898] (-1471.349) (-1475.459) (-1473.679) * [-1474.273] (-1476.051) (-1476.395) (-1475.427) -- 0:00:51
      260000 -- (-1473.367) (-1478.136) [-1473.421] (-1473.477) * (-1473.196) (-1477.636) (-1474.661) [-1476.928] -- 0:00:51

      Average standard deviation of split frequencies: 0.013297

      260500 -- (-1473.796) [-1472.139] (-1469.329) (-1477.557) * [-1471.076] (-1476.222) (-1474.772) (-1474.769) -- 0:00:51
      261000 -- (-1471.040) [-1470.468] (-1470.023) (-1477.409) * (-1472.513) [-1476.733] (-1471.978) (-1474.729) -- 0:00:50
      261500 -- (-1471.418) (-1471.975) [-1468.823] (-1478.531) * (-1471.482) (-1475.827) [-1474.129] (-1470.634) -- 0:00:50
      262000 -- (-1473.323) [-1472.356] (-1472.646) (-1472.447) * (-1474.996) (-1476.020) [-1472.417] (-1472.988) -- 0:00:53
      262500 -- (-1474.106) [-1473.287] (-1472.623) (-1474.773) * (-1474.838) (-1474.848) [-1471.909] (-1475.731) -- 0:00:53
      263000 -- (-1472.119) (-1472.238) [-1473.280] (-1475.123) * (-1470.908) (-1471.528) [-1473.000] (-1474.167) -- 0:00:53
      263500 -- [-1474.689] (-1473.042) (-1472.837) (-1473.370) * (-1471.772) (-1475.017) [-1471.074] (-1478.001) -- 0:00:53
      264000 -- (-1475.200) [-1473.055] (-1475.975) (-1471.143) * [-1472.910] (-1473.340) (-1471.380) (-1470.897) -- 0:00:52
      264500 -- (-1475.829) [-1472.500] (-1471.877) (-1470.239) * [-1474.202] (-1472.734) (-1471.162) (-1472.713) -- 0:00:52
      265000 -- (-1475.930) [-1472.365] (-1473.511) (-1474.697) * (-1473.334) (-1472.723) (-1476.457) [-1471.082] -- 0:00:52

      Average standard deviation of split frequencies: 0.014571

      265500 -- (-1476.480) (-1471.884) [-1473.615] (-1470.612) * [-1471.190] (-1474.672) (-1474.221) (-1477.572) -- 0:00:52
      266000 -- [-1474.201] (-1473.642) (-1470.634) (-1473.404) * [-1471.167] (-1477.547) (-1478.872) (-1476.532) -- 0:00:52
      266500 -- (-1474.631) [-1471.895] (-1475.376) (-1475.399) * [-1472.346] (-1477.358) (-1477.601) (-1473.193) -- 0:00:52
      267000 -- (-1478.986) (-1469.524) [-1473.108] (-1475.886) * (-1474.566) [-1474.729] (-1470.662) (-1472.435) -- 0:00:52
      267500 -- (-1476.480) [-1472.750] (-1470.563) (-1474.857) * (-1471.484) (-1475.919) (-1471.544) [-1474.492] -- 0:00:52
      268000 -- (-1474.582) [-1471.771] (-1473.997) (-1473.501) * (-1472.603) (-1474.000) (-1469.279) [-1474.521] -- 0:00:51
      268500 -- (-1474.553) [-1470.244] (-1472.565) (-1473.987) * (-1474.580) (-1477.179) [-1474.652] (-1474.318) -- 0:00:51
      269000 -- (-1473.541) [-1475.455] (-1471.500) (-1474.929) * (-1476.409) (-1477.462) [-1475.253] (-1475.115) -- 0:00:51
      269500 -- (-1473.306) [-1473.119] (-1474.268) (-1471.754) * [-1472.455] (-1476.601) (-1474.574) (-1469.919) -- 0:00:51
      270000 -- (-1472.834) (-1476.576) [-1475.739] (-1472.994) * (-1472.367) (-1476.174) [-1475.099] (-1474.356) -- 0:00:51

      Average standard deviation of split frequencies: 0.015367

      270500 -- [-1474.776] (-1471.108) (-1477.432) (-1470.288) * (-1473.818) (-1476.845) (-1476.684) [-1473.618] -- 0:00:51
      271000 -- (-1474.285) [-1471.161] (-1472.358) (-1472.586) * (-1473.068) (-1472.919) (-1474.452) [-1471.411] -- 0:00:51
      271500 -- (-1475.585) [-1472.796] (-1475.568) (-1478.307) * (-1481.439) (-1473.053) [-1471.996] (-1473.536) -- 0:00:50
      272000 -- (-1471.753) [-1471.590] (-1472.413) (-1477.170) * (-1481.344) [-1472.964] (-1470.750) (-1472.504) -- 0:00:50
      272500 -- (-1472.230) (-1471.483) [-1472.184] (-1474.554) * (-1471.311) [-1472.289] (-1474.288) (-1474.024) -- 0:00:50
      273000 -- [-1475.468] (-1474.000) (-1475.523) (-1478.744) * [-1474.337] (-1472.394) (-1477.708) (-1470.528) -- 0:00:50
      273500 -- (-1473.397) [-1473.491] (-1474.430) (-1471.809) * [-1472.698] (-1474.721) (-1473.142) (-1473.497) -- 0:00:50
      274000 -- (-1472.807) (-1474.985) (-1473.503) [-1475.580] * (-1473.435) (-1474.137) (-1471.940) [-1475.890] -- 0:00:50
      274500 -- [-1477.440] (-1472.136) (-1478.334) (-1473.195) * (-1470.079) [-1472.650] (-1471.726) (-1471.845) -- 0:00:50
      275000 -- [-1473.023] (-1470.574) (-1472.927) (-1472.840) * [-1472.810] (-1478.145) (-1471.109) (-1476.799) -- 0:00:50

      Average standard deviation of split frequencies: 0.015271

      275500 -- (-1476.531) (-1473.211) (-1474.034) [-1473.172] * [-1470.495] (-1475.373) (-1471.588) (-1473.436) -- 0:00:49
      276000 -- (-1471.627) (-1473.655) (-1472.977) [-1471.656] * (-1473.005) [-1480.197] (-1474.649) (-1474.036) -- 0:00:49
      276500 -- (-1475.215) [-1472.173] (-1476.561) (-1471.564) * (-1475.503) (-1473.359) [-1475.417] (-1471.780) -- 0:00:49
      277000 -- [-1475.282] (-1474.968) (-1477.850) (-1476.328) * (-1470.216) (-1473.835) [-1475.134] (-1471.699) -- 0:00:52
      277500 -- [-1472.276] (-1472.510) (-1474.310) (-1473.830) * [-1469.930] (-1475.294) (-1472.522) (-1473.527) -- 0:00:52
      278000 -- [-1474.532] (-1473.448) (-1474.917) (-1472.929) * (-1473.542) (-1473.884) (-1475.471) [-1473.888] -- 0:00:51
      278500 -- (-1484.727) (-1472.176) (-1480.995) [-1473.057] * [-1471.102] (-1472.001) (-1473.892) (-1470.801) -- 0:00:51
      279000 -- (-1476.866) (-1475.761) [-1471.838] (-1471.858) * (-1470.394) (-1474.177) (-1475.629) [-1469.511] -- 0:00:51
      279500 -- (-1472.558) (-1473.746) (-1470.618) [-1475.509] * (-1472.713) [-1471.623] (-1471.907) (-1470.977) -- 0:00:51
      280000 -- [-1473.200] (-1471.195) (-1476.979) (-1474.287) * (-1474.768) [-1474.395] (-1471.409) (-1471.116) -- 0:00:51

      Average standard deviation of split frequencies: 0.015116

      280500 -- (-1472.042) [-1472.491] (-1473.504) (-1473.656) * (-1472.848) (-1474.307) [-1472.859] (-1475.011) -- 0:00:51
      281000 -- (-1471.642) [-1475.004] (-1472.722) (-1472.763) * (-1472.388) (-1474.748) (-1471.449) [-1477.800] -- 0:00:51
      281500 -- (-1470.097) (-1473.693) [-1470.264] (-1472.659) * (-1473.141) (-1479.545) (-1472.185) [-1471.305] -- 0:00:51
      282000 -- (-1475.629) [-1472.978] (-1473.539) (-1474.018) * [-1474.649] (-1482.869) (-1474.904) (-1469.876) -- 0:00:50
      282500 -- (-1470.717) (-1472.044) (-1471.043) [-1474.515] * (-1473.534) [-1475.157] (-1473.467) (-1470.656) -- 0:00:50
      283000 -- [-1473.381] (-1471.834) (-1470.909) (-1473.514) * [-1473.985] (-1471.277) (-1478.733) (-1475.935) -- 0:00:50
      283500 -- (-1473.572) [-1471.672] (-1470.156) (-1473.383) * (-1470.834) [-1475.390] (-1474.147) (-1474.121) -- 0:00:50
      284000 -- [-1469.955] (-1478.678) (-1471.072) (-1474.321) * (-1472.220) (-1472.990) (-1476.297) [-1476.025] -- 0:00:50
      284500 -- [-1474.854] (-1481.112) (-1472.888) (-1473.552) * (-1472.677) (-1474.965) [-1478.624] (-1473.473) -- 0:00:50
      285000 -- [-1470.873] (-1475.728) (-1473.166) (-1475.878) * (-1474.289) (-1474.181) (-1473.420) [-1472.069] -- 0:00:50

      Average standard deviation of split frequencies: 0.015222

      285500 -- (-1470.758) (-1474.898) [-1470.120] (-1477.470) * (-1472.896) (-1473.823) (-1472.568) [-1472.457] -- 0:00:50
      286000 -- (-1473.175) (-1475.596) (-1474.467) [-1473.311] * (-1473.264) (-1475.319) [-1476.664] (-1473.715) -- 0:00:49
      286500 -- (-1472.438) (-1474.196) [-1475.687] (-1475.329) * (-1474.524) [-1473.000] (-1476.225) (-1473.312) -- 0:00:49
      287000 -- (-1474.659) [-1474.701] (-1475.928) (-1474.937) * [-1473.643] (-1474.759) (-1476.708) (-1474.550) -- 0:00:49
      287500 -- (-1474.573) (-1475.270) [-1475.078] (-1473.853) * (-1471.810) [-1473.024] (-1479.342) (-1473.261) -- 0:00:49
      288000 -- (-1471.326) (-1474.499) [-1475.995] (-1473.752) * (-1474.028) [-1475.495] (-1476.473) (-1471.076) -- 0:00:49
      288500 -- (-1471.064) (-1471.578) (-1475.709) [-1471.591] * (-1473.869) (-1476.977) (-1473.612) [-1474.468] -- 0:00:49
      289000 -- (-1471.267) (-1474.058) (-1477.918) [-1472.663] * (-1471.706) (-1473.659) (-1476.928) [-1474.040] -- 0:00:49
      289500 -- [-1471.142] (-1472.244) (-1477.554) (-1475.556) * [-1470.758] (-1474.571) (-1477.505) (-1474.000) -- 0:00:49
      290000 -- [-1471.537] (-1470.781) (-1477.381) (-1472.424) * (-1469.518) (-1475.223) [-1474.683] (-1475.679) -- 0:00:48

      Average standard deviation of split frequencies: 0.013583

      290500 -- [-1471.101] (-1474.060) (-1475.841) (-1476.483) * (-1469.554) (-1478.017) (-1471.470) [-1472.445] -- 0:00:48
      291000 -- (-1476.708) (-1474.717) [-1474.090] (-1476.323) * [-1472.241] (-1479.223) (-1472.046) (-1475.897) -- 0:00:48
      291500 -- (-1475.353) [-1474.606] (-1475.517) (-1474.631) * [-1471.035] (-1472.548) (-1475.975) (-1473.282) -- 0:00:51
      292000 -- (-1472.276) [-1475.358] (-1477.442) (-1471.767) * (-1471.463) [-1473.213] (-1472.665) (-1473.353) -- 0:00:50
      292500 -- [-1472.990] (-1471.434) (-1473.984) (-1473.201) * (-1473.353) (-1471.704) [-1474.460] (-1475.563) -- 0:00:50
      293000 -- [-1473.039] (-1479.044) (-1473.584) (-1474.109) * (-1477.323) (-1472.478) [-1475.480] (-1476.322) -- 0:00:50
      293500 -- [-1472.030] (-1471.766) (-1470.778) (-1477.769) * (-1470.326) (-1473.064) [-1475.513] (-1476.419) -- 0:00:50
      294000 -- (-1472.947) (-1473.826) (-1474.373) [-1478.247] * (-1471.870) (-1471.586) (-1472.044) [-1474.383] -- 0:00:50
      294500 -- [-1473.269] (-1471.493) (-1473.911) (-1477.741) * (-1472.672) (-1471.307) (-1472.252) [-1474.984] -- 0:00:50
      295000 -- [-1473.856] (-1474.926) (-1472.118) (-1475.697) * [-1470.708] (-1473.062) (-1475.830) (-1471.851) -- 0:00:50

      Average standard deviation of split frequencies: 0.013238

      295500 -- (-1472.389) (-1470.822) (-1471.081) [-1475.859] * (-1471.254) (-1477.842) (-1472.195) [-1473.051] -- 0:00:50
      296000 -- [-1472.633] (-1473.937) (-1473.069) (-1476.999) * (-1470.128) (-1473.034) [-1472.494] (-1472.672) -- 0:00:49
      296500 -- (-1473.780) [-1474.196] (-1471.602) (-1479.417) * (-1474.542) (-1471.647) (-1471.566) [-1475.831] -- 0:00:49
      297000 -- [-1472.871] (-1475.816) (-1470.592) (-1478.758) * (-1470.632) (-1471.006) (-1472.019) [-1473.653] -- 0:00:49
      297500 -- [-1472.952] (-1477.434) (-1478.294) (-1473.056) * (-1474.496) (-1473.156) (-1473.155) [-1473.409] -- 0:00:49
      298000 -- [-1475.102] (-1484.434) (-1476.846) (-1474.019) * (-1474.345) [-1472.347] (-1472.848) (-1474.278) -- 0:00:49
      298500 -- (-1475.054) [-1475.339] (-1473.040) (-1474.832) * (-1471.794) (-1471.844) [-1472.796] (-1482.841) -- 0:00:49
      299000 -- (-1475.030) [-1473.981] (-1472.660) (-1475.293) * [-1472.112] (-1473.292) (-1477.388) (-1472.501) -- 0:00:49
      299500 -- (-1473.300) (-1472.383) (-1472.164) [-1474.191] * (-1473.611) (-1474.923) [-1474.468] (-1473.003) -- 0:00:49
      300000 -- (-1475.134) (-1472.272) (-1472.531) [-1475.952] * [-1472.742] (-1477.219) (-1471.871) (-1475.621) -- 0:00:48

      Average standard deviation of split frequencies: 0.012727

      300500 -- (-1472.008) (-1473.747) (-1473.592) [-1470.038] * [-1469.832] (-1472.762) (-1470.416) (-1474.805) -- 0:00:48
      301000 -- [-1471.264] (-1474.589) (-1472.367) (-1472.055) * (-1472.668) (-1475.128) [-1470.726] (-1474.463) -- 0:00:48
      301500 -- (-1470.899) [-1471.737] (-1473.220) (-1473.472) * (-1472.838) [-1475.649] (-1474.013) (-1477.475) -- 0:00:48
      302000 -- (-1472.687) [-1471.983] (-1474.248) (-1475.395) * (-1470.647) (-1475.211) (-1473.855) [-1472.315] -- 0:00:48
      302500 -- (-1471.334) [-1470.515] (-1474.980) (-1478.120) * (-1473.377) (-1472.756) (-1472.082) [-1471.874] -- 0:00:48
      303000 -- (-1472.912) (-1471.863) [-1472.568] (-1475.611) * (-1473.757) (-1472.717) [-1471.413] (-1473.093) -- 0:00:48
      303500 -- (-1472.881) (-1472.191) (-1475.710) [-1473.564] * (-1472.614) (-1474.733) [-1473.010] (-1474.983) -- 0:00:48
      304000 -- [-1473.160] (-1474.171) (-1476.818) (-1472.340) * (-1474.266) [-1475.663] (-1474.377) (-1474.099) -- 0:00:48
      304500 -- (-1472.142) (-1472.628) (-1474.171) [-1473.846] * (-1474.341) (-1474.249) (-1473.946) [-1474.640] -- 0:00:47
      305000 -- (-1473.040) (-1476.539) [-1473.182] (-1474.070) * [-1471.862] (-1473.372) (-1471.823) (-1475.067) -- 0:00:47

      Average standard deviation of split frequencies: 0.011871

      305500 -- (-1473.161) [-1471.492] (-1475.498) (-1473.421) * [-1472.569] (-1471.558) (-1473.633) (-1474.716) -- 0:00:47
      306000 -- (-1474.959) [-1476.603] (-1475.707) (-1474.274) * [-1472.506] (-1473.330) (-1472.871) (-1475.908) -- 0:00:47
      306500 -- (-1472.854) (-1477.071) (-1475.446) [-1476.787] * (-1474.239) (-1483.222) [-1472.389] (-1470.799) -- 0:00:49
      307000 -- [-1471.781] (-1472.140) (-1473.213) (-1475.216) * (-1477.284) (-1477.927) (-1474.659) [-1474.657] -- 0:00:49
      307500 -- [-1471.037] (-1472.842) (-1475.736) (-1476.916) * (-1475.736) (-1476.554) (-1471.132) [-1472.793] -- 0:00:49
      308000 -- (-1473.425) (-1471.803) (-1473.060) [-1476.121] * (-1472.137) (-1476.798) (-1470.551) [-1471.160] -- 0:00:49
      308500 -- (-1473.685) (-1472.145) [-1474.717] (-1476.047) * [-1473.369] (-1475.580) (-1471.726) (-1473.536) -- 0:00:49
      309000 -- (-1471.951) [-1471.718] (-1478.085) (-1477.598) * [-1472.468] (-1473.211) (-1473.564) (-1474.720) -- 0:00:49
      309500 -- (-1470.681) (-1478.474) (-1475.824) [-1474.174] * [-1474.031] (-1470.803) (-1473.223) (-1471.238) -- 0:00:49
      310000 -- [-1475.964] (-1473.836) (-1477.089) (-1475.190) * (-1472.262) [-1470.853] (-1473.393) (-1474.982) -- 0:00:48

      Average standard deviation of split frequencies: 0.011001

      310500 -- (-1475.391) (-1475.870) (-1479.968) [-1473.664] * [-1473.089] (-1477.311) (-1472.854) (-1471.264) -- 0:00:48
      311000 -- (-1473.993) (-1475.526) [-1475.479] (-1476.036) * (-1475.695) (-1473.398) (-1472.683) [-1472.639] -- 0:00:48
      311500 -- (-1475.576) [-1473.732] (-1477.319) (-1478.971) * (-1470.550) (-1471.992) [-1473.487] (-1473.890) -- 0:00:48
      312000 -- (-1473.717) (-1471.717) [-1473.107] (-1477.521) * (-1474.217) (-1470.833) (-1474.775) [-1471.592] -- 0:00:48
      312500 -- (-1473.757) [-1472.586] (-1472.587) (-1474.719) * (-1471.270) (-1473.494) (-1471.423) [-1472.177] -- 0:00:48
      313000 -- (-1472.957) [-1474.115] (-1472.556) (-1475.536) * (-1472.280) (-1473.061) (-1472.570) [-1473.549] -- 0:00:48
      313500 -- (-1473.205) (-1474.803) [-1476.154] (-1475.434) * [-1473.938] (-1474.752) (-1473.008) (-1474.767) -- 0:00:48
      314000 -- (-1474.624) (-1475.607) (-1472.188) [-1472.293] * (-1472.573) (-1473.365) (-1472.865) [-1470.837] -- 0:00:48
      314500 -- (-1471.958) (-1477.255) [-1476.082] (-1473.791) * [-1472.447] (-1476.768) (-1474.221) (-1472.213) -- 0:00:47
      315000 -- (-1470.559) (-1475.935) (-1475.820) [-1472.218] * (-1476.779) (-1478.008) (-1472.242) [-1473.777] -- 0:00:47

      Average standard deviation of split frequencies: 0.011232

      315500 -- (-1472.894) (-1479.023) [-1472.178] (-1472.699) * (-1478.638) [-1475.751] (-1473.154) (-1471.655) -- 0:00:47
      316000 -- [-1471.743] (-1487.401) (-1472.894) (-1476.113) * (-1472.048) (-1481.094) (-1473.404) [-1470.325] -- 0:00:47
      316500 -- [-1471.529] (-1473.447) (-1475.125) (-1476.392) * (-1475.391) (-1473.783) [-1473.574] (-1473.971) -- 0:00:47
      317000 -- (-1473.581) [-1471.397] (-1476.181) (-1475.081) * (-1475.598) [-1476.271] (-1472.526) (-1475.656) -- 0:00:47
      317500 -- (-1474.326) [-1475.960] (-1477.214) (-1475.415) * (-1477.159) (-1473.784) (-1473.021) [-1474.269] -- 0:00:47
      318000 -- (-1471.345) (-1474.272) [-1474.544] (-1472.686) * (-1475.133) (-1476.734) [-1475.331] (-1474.062) -- 0:00:47
      318500 -- [-1472.592] (-1474.732) (-1478.080) (-1475.292) * [-1471.662] (-1474.795) (-1473.059) (-1473.579) -- 0:00:47
      319000 -- [-1472.475] (-1482.483) (-1479.689) (-1472.755) * [-1472.734] (-1476.099) (-1475.019) (-1474.521) -- 0:00:46
      319500 -- [-1474.103] (-1480.573) (-1472.134) (-1473.227) * (-1473.335) (-1475.738) (-1477.470) [-1475.688] -- 0:00:46
      320000 -- (-1482.414) (-1473.713) [-1470.824] (-1472.753) * [-1471.456] (-1471.729) (-1475.407) (-1475.190) -- 0:00:46

      Average standard deviation of split frequencies: 0.011485

      320500 -- (-1470.293) (-1472.839) [-1473.443] (-1472.467) * (-1473.797) [-1472.046] (-1473.291) (-1477.747) -- 0:00:46
      321000 -- (-1470.208) [-1472.394] (-1478.016) (-1473.034) * (-1477.739) [-1476.396] (-1475.059) (-1477.023) -- 0:00:48
      321500 -- [-1477.835] (-1474.077) (-1477.003) (-1474.557) * (-1474.638) (-1474.202) (-1472.257) [-1471.650] -- 0:00:48
      322000 -- (-1478.753) (-1473.053) (-1475.065) [-1472.356] * (-1477.943) (-1474.612) [-1472.034] (-1472.445) -- 0:00:48
      322500 -- (-1472.871) [-1473.207] (-1476.943) (-1475.104) * [-1475.005] (-1474.341) (-1473.221) (-1471.862) -- 0:00:48
      323000 -- (-1472.202) [-1476.639] (-1473.995) (-1475.038) * [-1472.996] (-1472.238) (-1473.231) (-1476.897) -- 0:00:48
      323500 -- (-1473.318) (-1474.787) [-1477.956] (-1473.020) * [-1470.555] (-1471.578) (-1474.702) (-1475.332) -- 0:00:48
      324000 -- [-1475.139] (-1472.089) (-1478.292) (-1477.392) * (-1474.246) (-1478.607) [-1473.747] (-1476.557) -- 0:00:47
      324500 -- (-1472.909) (-1475.206) [-1473.674] (-1476.127) * (-1474.366) (-1473.368) (-1474.326) [-1474.471] -- 0:00:47
      325000 -- (-1473.986) [-1471.249] (-1473.186) (-1477.772) * (-1474.162) (-1474.691) (-1471.597) [-1471.602] -- 0:00:47

      Average standard deviation of split frequencies: 0.011478

      325500 -- (-1472.492) [-1470.718] (-1474.645) (-1478.066) * (-1475.271) (-1474.811) (-1474.268) [-1472.176] -- 0:00:47
      326000 -- [-1474.055] (-1470.627) (-1476.838) (-1471.692) * (-1470.316) [-1473.860] (-1475.600) (-1473.883) -- 0:00:47
      326500 -- (-1476.343) (-1471.715) (-1475.803) [-1474.855] * (-1472.490) [-1475.495] (-1474.739) (-1473.703) -- 0:00:47
      327000 -- (-1471.502) (-1473.685) (-1472.965) [-1471.868] * (-1473.299) [-1472.322] (-1475.281) (-1473.003) -- 0:00:47
      327500 -- (-1474.771) (-1476.074) [-1471.199] (-1471.766) * [-1477.150] (-1473.145) (-1475.356) (-1477.150) -- 0:00:47
      328000 -- [-1472.798] (-1474.599) (-1472.211) (-1471.755) * (-1473.005) (-1472.579) (-1478.171) [-1471.817] -- 0:00:47
      328500 -- (-1473.070) (-1471.989) (-1476.224) [-1471.464] * (-1472.083) (-1470.985) (-1476.297) [-1474.567] -- 0:00:47
      329000 -- (-1471.860) [-1478.114] (-1475.922) (-1474.268) * (-1473.032) (-1474.709) (-1472.035) [-1472.312] -- 0:00:46
      329500 -- (-1475.353) [-1473.665] (-1477.346) (-1470.803) * (-1471.080) (-1476.232) [-1472.833] (-1476.966) -- 0:00:46
      330000 -- (-1477.171) (-1475.877) (-1481.085) [-1472.288] * [-1472.474] (-1474.896) (-1472.230) (-1474.901) -- 0:00:46

      Average standard deviation of split frequencies: 0.011227

      330500 -- [-1470.968] (-1475.032) (-1479.221) (-1472.181) * (-1473.031) (-1472.676) (-1476.340) [-1473.016] -- 0:00:46
      331000 -- (-1476.968) (-1477.132) (-1472.547) [-1473.549] * (-1472.428) [-1470.202] (-1474.756) (-1478.513) -- 0:00:46
      331500 -- (-1472.094) (-1473.833) (-1475.574) [-1472.936] * (-1472.928) [-1472.440] (-1474.881) (-1474.965) -- 0:00:46
      332000 -- (-1471.156) (-1474.677) [-1472.959] (-1474.741) * [-1475.021] (-1478.180) (-1475.336) (-1475.002) -- 0:00:46
      332500 -- [-1474.029] (-1473.823) (-1475.002) (-1473.947) * [-1472.446] (-1474.104) (-1472.941) (-1476.998) -- 0:00:46
      333000 -- (-1474.808) (-1475.871) [-1472.208] (-1478.315) * (-1473.847) [-1471.256] (-1473.957) (-1474.450) -- 0:00:46
      333500 -- (-1472.029) (-1473.245) [-1472.263] (-1474.366) * [-1474.969] (-1472.135) (-1473.557) (-1472.221) -- 0:00:45
      334000 -- (-1476.538) (-1476.065) (-1471.061) [-1471.496] * (-1470.659) [-1471.377] (-1478.192) (-1474.155) -- 0:00:45
      334500 -- [-1476.132] (-1471.996) (-1473.075) (-1477.274) * (-1471.102) (-1472.028) (-1474.601) [-1474.974] -- 0:00:45
      335000 -- [-1474.864] (-1472.155) (-1472.714) (-1474.160) * (-1470.152) (-1474.214) [-1470.314] (-1473.233) -- 0:00:45

      Average standard deviation of split frequencies: 0.011049

      335500 -- [-1474.804] (-1472.181) (-1472.293) (-1470.293) * (-1470.185) (-1475.899) (-1469.864) [-1472.978] -- 0:00:47
      336000 -- (-1473.139) [-1473.567] (-1476.449) (-1473.745) * (-1474.076) (-1472.271) [-1471.787] (-1469.368) -- 0:00:47
      336500 -- (-1474.681) [-1475.617] (-1474.426) (-1472.168) * (-1470.173) [-1472.611] (-1475.303) (-1473.832) -- 0:00:47
      337000 -- (-1477.583) (-1474.848) (-1475.908) [-1471.991] * (-1471.198) [-1471.875] (-1477.339) (-1476.869) -- 0:00:47
      337500 -- [-1476.346] (-1471.039) (-1474.633) (-1474.001) * (-1476.602) (-1472.718) [-1472.032] (-1472.840) -- 0:00:47
      338000 -- (-1472.622) [-1472.223] (-1472.332) (-1472.089) * [-1471.123] (-1474.928) (-1472.750) (-1476.542) -- 0:00:47
      338500 -- (-1475.810) (-1472.763) (-1476.588) [-1474.553] * (-1475.530) [-1475.597] (-1475.077) (-1472.743) -- 0:00:46
      339000 -- (-1476.557) [-1471.647] (-1475.691) (-1474.337) * (-1478.820) [-1472.509] (-1472.032) (-1476.625) -- 0:00:46
      339500 -- [-1474.095] (-1470.984) (-1476.204) (-1471.705) * (-1472.311) (-1472.267) (-1473.017) [-1472.292] -- 0:00:46
      340000 -- (-1472.205) [-1475.080] (-1479.501) (-1476.179) * (-1471.699) (-1476.659) (-1471.147) [-1471.830] -- 0:00:46

      Average standard deviation of split frequencies: 0.011589

      340500 -- (-1472.652) (-1473.825) (-1473.007) [-1472.745] * (-1472.937) [-1472.815] (-1471.690) (-1472.893) -- 0:00:46
      341000 -- [-1472.058] (-1471.411) (-1473.179) (-1472.017) * (-1469.214) (-1471.036) [-1473.507] (-1473.821) -- 0:00:46
      341500 -- (-1475.141) (-1475.710) [-1473.466] (-1473.291) * (-1471.633) (-1472.466) (-1472.882) [-1474.712] -- 0:00:46
      342000 -- (-1479.980) [-1470.049] (-1473.841) (-1477.073) * (-1470.704) (-1471.364) [-1473.348] (-1475.703) -- 0:00:46
      342500 -- (-1475.442) [-1471.253] (-1475.165) (-1473.740) * [-1472.909] (-1474.718) (-1480.655) (-1475.449) -- 0:00:46
      343000 -- [-1473.308] (-1476.901) (-1473.615) (-1474.682) * (-1472.660) [-1472.553] (-1473.503) (-1472.709) -- 0:00:45
      343500 -- (-1477.383) (-1480.633) (-1471.722) [-1476.402] * [-1472.577] (-1474.145) (-1471.636) (-1476.610) -- 0:00:45
      344000 -- [-1474.172] (-1472.339) (-1471.643) (-1474.205) * [-1474.121] (-1472.737) (-1473.944) (-1472.753) -- 0:00:45
      344500 -- [-1472.083] (-1472.308) (-1475.584) (-1474.241) * (-1473.587) [-1472.284] (-1476.388) (-1475.961) -- 0:00:45
      345000 -- (-1469.786) (-1471.517) [-1473.227] (-1472.322) * [-1471.753] (-1472.200) (-1470.532) (-1473.906) -- 0:00:45

      Average standard deviation of split frequencies: 0.011070

      345500 -- (-1477.777) (-1471.624) (-1474.379) [-1472.610] * (-1474.505) (-1472.030) [-1473.611] (-1472.864) -- 0:00:45
      346000 -- [-1472.304] (-1471.804) (-1476.161) (-1475.592) * (-1473.709) (-1472.643) [-1471.027] (-1472.710) -- 0:00:45
      346500 -- (-1473.869) [-1471.505] (-1473.325) (-1474.034) * (-1472.840) (-1471.136) [-1469.702] (-1473.457) -- 0:00:45
      347000 -- (-1472.225) (-1474.673) [-1475.823] (-1472.298) * (-1471.618) (-1475.697) (-1475.498) [-1472.777] -- 0:00:45
      347500 -- [-1472.324] (-1473.051) (-1472.884) (-1472.386) * [-1473.518] (-1476.291) (-1472.331) (-1471.342) -- 0:00:45
      348000 -- (-1470.853) (-1482.490) [-1471.238] (-1476.606) * (-1471.530) [-1471.923] (-1474.270) (-1471.800) -- 0:00:44
      348500 -- [-1471.842] (-1474.912) (-1470.125) (-1471.706) * (-1474.669) (-1477.154) (-1473.298) [-1471.054] -- 0:00:44
      349000 -- (-1469.588) [-1472.554] (-1476.400) (-1472.507) * (-1473.693) (-1472.271) [-1473.758] (-1473.687) -- 0:00:44
      349500 -- [-1470.987] (-1471.271) (-1471.621) (-1471.991) * [-1474.888] (-1475.720) (-1473.991) (-1472.950) -- 0:00:44
      350000 -- [-1471.914] (-1473.195) (-1473.779) (-1472.285) * (-1477.018) [-1474.665] (-1477.367) (-1470.632) -- 0:00:44

      Average standard deviation of split frequencies: 0.011007

      350500 -- (-1472.734) (-1471.705) [-1474.386] (-1470.807) * [-1473.080] (-1475.078) (-1474.090) (-1473.424) -- 0:00:46
      351000 -- (-1478.725) [-1472.012] (-1473.266) (-1473.294) * (-1473.371) (-1473.394) [-1475.363] (-1474.939) -- 0:00:46
      351500 -- (-1477.656) (-1472.171) (-1472.434) [-1474.322] * (-1472.663) (-1472.953) (-1479.126) [-1471.686] -- 0:00:46
      352000 -- (-1473.722) (-1470.385) [-1473.886] (-1475.620) * (-1473.344) (-1473.942) [-1474.112] (-1472.419) -- 0:00:46
      352500 -- (-1471.594) [-1470.113] (-1470.840) (-1474.880) * (-1471.803) [-1476.138] (-1473.467) (-1474.816) -- 0:00:45
      353000 -- (-1470.656) (-1472.496) [-1470.969] (-1471.623) * (-1475.419) [-1473.307] (-1471.804) (-1477.033) -- 0:00:45
      353500 -- (-1472.590) (-1473.292) [-1470.939] (-1480.664) * (-1473.417) (-1479.336) (-1473.296) [-1471.908] -- 0:00:45
      354000 -- (-1471.807) (-1473.541) [-1471.625] (-1476.148) * (-1473.882) (-1474.524) [-1474.950] (-1474.360) -- 0:00:45
      354500 -- (-1475.095) (-1475.950) [-1472.920] (-1472.897) * [-1473.480] (-1474.705) (-1470.760) (-1473.014) -- 0:00:45
      355000 -- [-1472.714] (-1478.312) (-1478.956) (-1477.426) * [-1471.154] (-1472.351) (-1472.964) (-1473.929) -- 0:00:45

      Average standard deviation of split frequencies: 0.010511

      355500 -- [-1476.482] (-1476.639) (-1473.959) (-1472.920) * (-1471.770) [-1473.128] (-1477.909) (-1474.676) -- 0:00:45
      356000 -- (-1471.433) (-1476.878) [-1473.903] (-1472.092) * [-1470.846] (-1474.810) (-1472.276) (-1472.852) -- 0:00:45
      356500 -- (-1471.786) (-1477.207) (-1474.382) [-1472.719] * [-1474.866] (-1472.026) (-1475.816) (-1476.365) -- 0:00:45
      357000 -- (-1473.515) (-1476.172) (-1472.264) [-1474.002] * [-1471.659] (-1471.920) (-1473.203) (-1479.534) -- 0:00:45
      357500 -- (-1472.779) (-1476.824) (-1474.665) [-1474.405] * [-1474.124] (-1470.814) (-1470.479) (-1476.045) -- 0:00:44
      358000 -- [-1471.588] (-1472.966) (-1475.194) (-1471.799) * (-1471.455) (-1475.301) (-1471.775) [-1472.334] -- 0:00:44
      358500 -- [-1470.977] (-1473.133) (-1475.449) (-1475.296) * (-1475.268) [-1475.058] (-1472.790) (-1477.364) -- 0:00:44
      359000 -- (-1475.458) (-1476.247) (-1475.788) [-1471.726] * (-1472.725) (-1471.760) (-1475.116) [-1475.256] -- 0:00:44
      359500 -- (-1471.962) [-1473.813] (-1474.352) (-1470.156) * (-1473.470) (-1471.907) [-1474.925] (-1474.554) -- 0:00:44
      360000 -- (-1470.731) (-1474.908) (-1474.343) [-1470.925] * (-1476.120) [-1470.989] (-1475.426) (-1477.653) -- 0:00:44

      Average standard deviation of split frequencies: 0.009884

      360500 -- (-1472.006) [-1470.522] (-1478.051) (-1472.239) * [-1473.375] (-1476.528) (-1472.607) (-1477.918) -- 0:00:44
      361000 -- (-1471.165) (-1473.429) [-1475.371] (-1471.365) * (-1472.361) (-1473.326) [-1472.191] (-1482.448) -- 0:00:44
      361500 -- (-1473.652) [-1474.898] (-1473.905) (-1475.385) * (-1475.778) (-1477.240) [-1472.759] (-1474.439) -- 0:00:44
      362000 -- (-1472.629) (-1471.781) (-1474.549) [-1472.223] * [-1472.717] (-1473.808) (-1471.133) (-1473.529) -- 0:00:44
      362500 -- (-1471.072) (-1472.655) (-1476.019) [-1475.154] * (-1474.292) [-1472.185] (-1473.244) (-1474.303) -- 0:00:43
      363000 -- (-1473.325) (-1473.410) (-1476.276) [-1471.821] * (-1472.071) (-1475.779) [-1471.149] (-1474.253) -- 0:00:43
      363500 -- (-1474.550) (-1473.133) [-1474.165] (-1475.883) * (-1475.554) [-1469.748] (-1474.594) (-1471.460) -- 0:00:43
      364000 -- [-1471.632] (-1474.165) (-1473.695) (-1473.679) * (-1471.033) (-1473.256) [-1475.784] (-1471.687) -- 0:00:43
      364500 -- (-1473.556) (-1473.325) [-1475.078] (-1478.989) * [-1472.593] (-1475.085) (-1470.807) (-1470.579) -- 0:00:43
      365000 -- (-1472.294) (-1478.167) [-1472.492] (-1474.482) * (-1474.499) (-1470.276) [-1471.566] (-1476.400) -- 0:00:43

      Average standard deviation of split frequencies: 0.010304

      365500 -- (-1470.995) (-1475.884) (-1473.540) [-1473.310] * [-1471.795] (-1471.547) (-1472.151) (-1474.320) -- 0:00:45
      366000 -- (-1473.602) (-1474.732) (-1474.704) [-1474.085] * (-1473.416) (-1471.120) [-1474.030] (-1476.121) -- 0:00:45
      366500 -- (-1470.591) (-1474.907) [-1474.206] (-1473.656) * [-1470.634] (-1471.120) (-1471.883) (-1473.470) -- 0:00:44
      367000 -- [-1470.963] (-1475.202) (-1473.127) (-1471.632) * [-1472.793] (-1472.134) (-1474.955) (-1472.975) -- 0:00:44
      367500 -- (-1474.796) (-1474.329) (-1477.199) [-1469.985] * (-1471.458) (-1475.599) (-1474.761) [-1473.515] -- 0:00:44
      368000 -- [-1473.682] (-1477.638) (-1475.531) (-1470.948) * (-1471.675) (-1472.086) [-1474.542] (-1475.103) -- 0:00:44
      368500 -- (-1471.978) (-1475.865) [-1475.649] (-1471.278) * (-1472.880) (-1475.200) (-1473.093) [-1474.418] -- 0:00:44
      369000 -- (-1474.501) (-1476.475) (-1477.799) [-1472.906] * [-1476.460] (-1471.685) (-1473.083) (-1473.599) -- 0:00:44
      369500 -- (-1472.491) (-1475.049) (-1475.547) [-1472.688] * (-1473.791) (-1473.071) (-1470.951) [-1471.373] -- 0:00:44
      370000 -- (-1473.890) [-1473.038] (-1475.674) (-1472.071) * (-1474.241) (-1471.961) (-1472.354) [-1474.183] -- 0:00:44

      Average standard deviation of split frequencies: 0.009538

      370500 -- (-1474.906) (-1473.439) (-1475.794) [-1472.537] * (-1473.657) (-1471.541) [-1471.076] (-1472.556) -- 0:00:44
      371000 -- (-1475.861) [-1472.302] (-1476.376) (-1471.331) * (-1474.745) (-1472.785) (-1474.422) [-1472.916] -- 0:00:44
      371500 -- (-1475.249) (-1472.115) [-1472.460] (-1472.136) * [-1474.477] (-1470.915) (-1477.638) (-1475.683) -- 0:00:43
      372000 -- (-1474.011) [-1474.864] (-1475.941) (-1472.813) * [-1473.210] (-1473.315) (-1472.502) (-1472.488) -- 0:00:43
      372500 -- (-1477.107) [-1475.950] (-1472.978) (-1471.260) * (-1473.635) [-1472.111] (-1474.982) (-1472.570) -- 0:00:43
      373000 -- (-1475.436) (-1473.873) [-1475.293] (-1472.769) * (-1475.732) (-1473.703) (-1470.083) [-1474.077] -- 0:00:43
      373500 -- (-1474.059) (-1475.740) [-1475.378] (-1473.952) * (-1476.015) [-1473.124] (-1475.220) (-1472.328) -- 0:00:43
      374000 -- (-1471.051) (-1476.922) [-1474.272] (-1475.613) * (-1475.211) [-1472.014] (-1472.257) (-1469.649) -- 0:00:43
      374500 -- (-1474.341) [-1479.103] (-1478.313) (-1472.613) * (-1473.530) (-1478.791) (-1473.337) [-1472.925] -- 0:00:43
      375000 -- (-1471.546) (-1479.068) (-1475.058) [-1469.852] * (-1473.319) (-1473.496) [-1471.217] (-1472.231) -- 0:00:43

      Average standard deviation of split frequencies: 0.009011

      375500 -- [-1472.987] (-1475.635) (-1475.350) (-1472.169) * (-1473.278) [-1475.855] (-1471.794) (-1473.524) -- 0:00:43
      376000 -- (-1471.522) (-1479.065) (-1470.551) [-1473.818] * (-1472.640) [-1476.207] (-1471.729) (-1476.975) -- 0:00:43
      376500 -- [-1473.694] (-1477.714) (-1474.723) (-1471.801) * (-1472.556) [-1476.950] (-1474.113) (-1474.824) -- 0:00:43
      377000 -- [-1473.736] (-1474.663) (-1472.600) (-1472.531) * (-1473.989) [-1474.152] (-1474.218) (-1471.761) -- 0:00:42
      377500 -- [-1472.495] (-1476.206) (-1476.285) (-1475.914) * (-1472.642) (-1470.598) [-1470.648] (-1476.890) -- 0:00:42
      378000 -- (-1471.024) (-1476.121) (-1472.612) [-1470.489] * (-1477.978) [-1476.066] (-1471.761) (-1476.819) -- 0:00:42
      378500 -- [-1470.855] (-1475.599) (-1473.315) (-1476.445) * (-1471.737) (-1475.356) [-1473.116] (-1472.105) -- 0:00:42
      379000 -- [-1473.345] (-1475.120) (-1477.906) (-1473.594) * (-1475.528) (-1474.668) [-1473.177] (-1474.417) -- 0:00:42
      379500 -- [-1475.535] (-1472.022) (-1474.252) (-1473.343) * (-1481.139) (-1471.614) (-1476.671) [-1471.055] -- 0:00:42
      380000 -- (-1471.727) (-1472.073) [-1471.540] (-1471.343) * (-1478.158) (-1473.217) (-1476.381) [-1473.850] -- 0:00:42

      Average standard deviation of split frequencies: 0.008436

      380500 -- (-1474.886) (-1474.480) [-1474.239] (-1471.030) * (-1469.961) (-1473.821) (-1470.803) [-1471.912] -- 0:00:43
      381000 -- [-1472.665] (-1475.125) (-1471.699) (-1474.273) * (-1469.937) [-1475.642] (-1476.683) (-1475.781) -- 0:00:43
      381500 -- [-1470.768] (-1475.466) (-1471.720) (-1474.423) * (-1470.721) (-1472.925) (-1471.526) [-1474.782] -- 0:00:43
      382000 -- (-1471.932) (-1475.143) [-1472.851] (-1473.695) * (-1475.703) [-1470.098] (-1472.514) (-1474.677) -- 0:00:43
      382500 -- (-1473.970) [-1474.585] (-1472.131) (-1472.063) * (-1473.152) [-1472.790] (-1473.474) (-1472.576) -- 0:00:43
      383000 -- (-1474.507) [-1476.728] (-1475.698) (-1472.536) * (-1473.548) [-1470.249] (-1473.380) (-1470.868) -- 0:00:43
      383500 -- [-1476.927] (-1473.578) (-1477.298) (-1472.796) * (-1479.655) (-1474.774) (-1473.814) [-1471.455] -- 0:00:43
      384000 -- (-1472.687) (-1473.017) (-1476.472) [-1473.588] * (-1475.358) (-1475.700) (-1476.800) [-1474.875] -- 0:00:43
      384500 -- (-1473.192) [-1471.456] (-1474.612) (-1474.408) * (-1475.117) [-1471.694] (-1476.928) (-1474.221) -- 0:00:43
      385000 -- [-1476.126] (-1472.188) (-1475.844) (-1474.984) * (-1473.727) (-1471.260) (-1474.379) [-1471.947] -- 0:00:43

      Average standard deviation of split frequencies: 0.008854

      385500 -- [-1476.571] (-1475.952) (-1473.096) (-1472.307) * (-1472.607) (-1471.994) (-1472.467) [-1472.783] -- 0:00:43
      386000 -- (-1476.455) (-1475.570) [-1473.845] (-1472.935) * [-1472.509] (-1474.118) (-1473.645) (-1473.853) -- 0:00:42
      386500 -- [-1472.094] (-1475.564) (-1474.393) (-1473.389) * (-1473.979) (-1476.881) [-1473.049] (-1473.947) -- 0:00:42
      387000 -- [-1471.173] (-1477.405) (-1472.784) (-1475.688) * (-1473.706) (-1474.748) (-1476.542) [-1473.843] -- 0:00:42
      387500 -- (-1476.032) (-1474.578) (-1470.806) [-1473.930] * (-1474.530) (-1473.759) (-1478.388) [-1470.842] -- 0:00:42
      388000 -- (-1471.205) (-1472.981) [-1476.620] (-1475.688) * (-1473.043) [-1474.748] (-1474.281) (-1470.348) -- 0:00:42
      388500 -- [-1471.176] (-1475.803) (-1480.151) (-1472.928) * (-1473.733) [-1471.752] (-1471.223) (-1473.107) -- 0:00:42
      389000 -- [-1470.708] (-1477.050) (-1474.318) (-1475.424) * (-1471.544) (-1472.146) [-1470.646] (-1473.432) -- 0:00:42
      389500 -- (-1475.399) (-1478.127) [-1471.558] (-1473.463) * [-1473.340] (-1478.081) (-1475.324) (-1475.722) -- 0:00:42
      390000 -- (-1474.574) (-1478.278) [-1477.576] (-1473.768) * (-1471.672) (-1475.628) (-1472.712) [-1477.322] -- 0:00:42

      Average standard deviation of split frequencies: 0.008371

      390500 -- (-1473.962) (-1476.399) [-1471.310] (-1475.049) * (-1473.193) (-1472.294) (-1471.100) [-1478.794] -- 0:00:42
      391000 -- (-1474.141) (-1473.817) [-1473.172] (-1474.036) * [-1471.525] (-1472.226) (-1472.792) (-1478.124) -- 0:00:42
      391500 -- (-1470.570) (-1474.610) [-1472.525] (-1474.044) * (-1472.460) (-1471.673) [-1471.591] (-1473.463) -- 0:00:41
      392000 -- [-1471.928] (-1474.851) (-1475.181) (-1475.976) * (-1472.851) [-1473.264] (-1473.782) (-1472.757) -- 0:00:41
      392500 -- [-1474.256] (-1473.561) (-1475.632) (-1476.761) * [-1471.841] (-1472.578) (-1473.041) (-1472.723) -- 0:00:41
      393000 -- (-1472.428) [-1474.441] (-1473.298) (-1476.920) * (-1472.440) (-1472.212) [-1471.483] (-1474.016) -- 0:00:41
      393500 -- (-1476.006) [-1473.933] (-1476.232) (-1471.908) * (-1474.413) (-1472.011) (-1471.031) [-1476.301] -- 0:00:41
      394000 -- (-1473.411) (-1475.501) (-1481.229) [-1474.285] * (-1472.070) [-1472.064] (-1471.296) (-1471.564) -- 0:00:41
      394500 -- (-1474.013) (-1475.947) (-1478.498) [-1476.039] * (-1475.965) [-1472.136] (-1473.361) (-1470.119) -- 0:00:41
      395000 -- (-1472.059) (-1472.211) [-1474.096] (-1473.497) * (-1471.862) (-1473.121) [-1472.252] (-1475.180) -- 0:00:42

      Average standard deviation of split frequencies: 0.008015

      395500 -- [-1471.623] (-1473.388) (-1473.484) (-1475.669) * (-1472.617) (-1476.254) [-1471.877] (-1477.317) -- 0:00:42
      396000 -- (-1476.621) (-1474.737) [-1473.067] (-1476.985) * [-1471.992] (-1479.536) (-1475.259) (-1472.258) -- 0:00:42
      396500 -- (-1472.174) (-1476.060) [-1470.283] (-1473.101) * (-1472.758) (-1477.354) (-1474.179) [-1473.414] -- 0:00:42
      397000 -- (-1472.596) [-1471.395] (-1473.292) (-1469.683) * [-1475.552] (-1476.825) (-1475.249) (-1472.058) -- 0:00:42
      397500 -- (-1478.917) (-1473.276) [-1474.084] (-1475.441) * (-1474.825) [-1476.936] (-1478.976) (-1472.744) -- 0:00:42
      398000 -- (-1474.842) (-1475.265) [-1471.862] (-1471.244) * [-1473.572] (-1474.522) (-1472.076) (-1471.081) -- 0:00:42
      398500 -- (-1472.384) [-1474.764] (-1474.884) (-1475.363) * (-1474.360) (-1472.619) [-1472.432] (-1474.857) -- 0:00:42
      399000 -- (-1472.148) (-1477.831) [-1479.196] (-1475.347) * [-1472.625] (-1473.189) (-1472.513) (-1472.127) -- 0:00:42
      399500 -- [-1475.622] (-1473.416) (-1472.752) (-1472.949) * [-1471.988] (-1474.751) (-1475.012) (-1470.943) -- 0:00:42
      400000 -- (-1475.619) (-1471.144) (-1475.941) [-1474.323] * (-1472.280) (-1472.051) [-1473.989] (-1470.663) -- 0:00:41

      Average standard deviation of split frequencies: 0.009412

      400500 -- (-1473.356) (-1472.760) [-1472.489] (-1472.311) * (-1475.362) (-1472.008) [-1472.355] (-1471.669) -- 0:00:41
      401000 -- (-1473.608) [-1472.097] (-1474.344) (-1472.034) * (-1471.164) [-1472.772] (-1472.904) (-1471.789) -- 0:00:41
      401500 -- (-1475.849) [-1471.906] (-1474.372) (-1472.739) * (-1472.911) [-1471.001] (-1474.719) (-1477.292) -- 0:00:41
      402000 -- (-1474.929) [-1470.540] (-1476.002) (-1472.708) * (-1474.235) (-1470.998) (-1471.401) [-1470.960] -- 0:00:41
      402500 -- (-1478.326) (-1472.907) (-1477.174) [-1476.235] * (-1475.336) (-1469.746) [-1471.685] (-1472.167) -- 0:00:41
      403000 -- (-1474.156) (-1470.708) [-1475.949] (-1471.695) * (-1475.964) [-1472.042] (-1475.001) (-1474.970) -- 0:00:41
      403500 -- [-1472.947] (-1471.675) (-1475.759) (-1474.615) * [-1476.055] (-1474.194) (-1477.304) (-1471.881) -- 0:00:41
      404000 -- (-1472.771) [-1473.773] (-1477.372) (-1470.836) * (-1475.466) (-1474.426) [-1477.038] (-1475.322) -- 0:00:41
      404500 -- [-1472.073] (-1474.218) (-1477.465) (-1473.474) * (-1476.129) (-1477.496) [-1471.573] (-1473.643) -- 0:00:41
      405000 -- [-1471.827] (-1481.916) (-1472.879) (-1475.580) * (-1477.400) (-1482.562) (-1476.796) [-1474.097] -- 0:00:41

      Average standard deviation of split frequencies: 0.009211

      405500 -- [-1471.233] (-1472.779) (-1471.988) (-1472.068) * (-1472.163) (-1473.767) (-1475.358) [-1472.716] -- 0:00:41
      406000 -- [-1472.000] (-1473.784) (-1479.654) (-1475.802) * (-1473.624) (-1476.555) (-1476.023) [-1470.511] -- 0:00:40
      406500 -- [-1473.543] (-1471.870) (-1473.530) (-1471.983) * (-1474.061) (-1476.570) (-1474.785) [-1476.192] -- 0:00:40
      407000 -- (-1476.931) [-1474.778] (-1476.837) (-1471.273) * (-1474.382) (-1476.543) [-1472.286] (-1475.979) -- 0:00:40
      407500 -- (-1478.318) (-1472.839) (-1473.011) [-1472.261] * (-1473.313) [-1474.173] (-1476.720) (-1475.204) -- 0:00:40
      408000 -- [-1474.019] (-1471.682) (-1475.796) (-1471.463) * (-1473.312) (-1469.298) [-1475.671] (-1475.359) -- 0:00:40
      408500 -- [-1471.577] (-1473.766) (-1474.037) (-1472.327) * [-1473.712] (-1470.279) (-1476.293) (-1476.703) -- 0:00:40
      409000 -- [-1472.618] (-1473.864) (-1470.696) (-1472.001) * (-1475.897) (-1474.129) [-1476.686] (-1478.017) -- 0:00:40
      409500 -- (-1472.963) (-1471.867) (-1472.695) [-1475.693] * [-1478.817] (-1475.649) (-1474.456) (-1477.691) -- 0:00:40
      410000 -- (-1473.193) [-1472.115] (-1471.896) (-1470.979) * (-1475.063) (-1473.068) (-1476.168) [-1474.911] -- 0:00:41

      Average standard deviation of split frequencies: 0.009872

      410500 -- (-1473.156) (-1472.040) [-1472.357] (-1473.309) * (-1471.071) [-1470.277] (-1475.965) (-1472.904) -- 0:00:41
      411000 -- (-1473.312) [-1473.340] (-1472.265) (-1474.138) * [-1475.964] (-1471.879) (-1473.473) (-1482.309) -- 0:00:41
      411500 -- (-1473.712) (-1474.968) [-1478.071] (-1473.731) * (-1475.410) (-1469.998) [-1479.655] (-1474.735) -- 0:00:41
      412000 -- [-1474.646] (-1477.090) (-1471.944) (-1477.027) * (-1474.548) (-1471.249) [-1472.959] (-1471.391) -- 0:00:41
      412500 -- (-1476.215) (-1473.091) (-1472.119) [-1476.297] * (-1473.742) [-1472.133] (-1475.844) (-1475.630) -- 0:00:41
      413000 -- [-1472.552] (-1479.343) (-1470.384) (-1475.487) * (-1472.703) (-1473.384) [-1476.480] (-1476.432) -- 0:00:41
      413500 -- (-1475.810) (-1475.694) (-1472.785) [-1471.537] * [-1475.514] (-1471.796) (-1476.568) (-1473.692) -- 0:00:41
      414000 -- (-1471.533) [-1475.119] (-1474.651) (-1471.931) * [-1472.464] (-1473.449) (-1476.226) (-1475.593) -- 0:00:41
      414500 -- (-1472.138) (-1473.518) [-1472.499] (-1472.895) * (-1479.889) [-1474.547] (-1473.462) (-1473.716) -- 0:00:40
      415000 -- (-1472.606) [-1476.821] (-1471.935) (-1471.132) * (-1473.260) (-1472.333) [-1476.735] (-1475.999) -- 0:00:40

      Average standard deviation of split frequencies: 0.008914

      415500 -- [-1473.052] (-1473.779) (-1472.677) (-1474.328) * (-1471.092) (-1477.631) (-1474.075) [-1471.695] -- 0:00:40
      416000 -- (-1472.031) [-1474.968] (-1477.058) (-1473.695) * (-1473.383) (-1476.784) (-1475.122) [-1471.558] -- 0:00:40
      416500 -- (-1471.968) (-1477.187) [-1472.028] (-1475.490) * (-1472.538) [-1476.088] (-1472.063) (-1476.033) -- 0:00:40
      417000 -- (-1472.723) (-1479.585) [-1471.337] (-1476.922) * [-1472.791] (-1472.122) (-1476.359) (-1473.821) -- 0:00:40
      417500 -- (-1475.010) (-1473.743) [-1472.478] (-1474.931) * [-1472.200] (-1471.616) (-1471.735) (-1478.485) -- 0:00:40
      418000 -- (-1470.881) [-1473.615] (-1475.184) (-1471.956) * (-1473.258) [-1473.402] (-1471.447) (-1473.792) -- 0:00:40
      418500 -- (-1468.686) [-1470.904] (-1474.887) (-1474.489) * [-1472.859] (-1474.330) (-1475.179) (-1474.526) -- 0:00:40
      419000 -- [-1476.576] (-1472.783) (-1474.314) (-1473.316) * (-1473.210) [-1471.948] (-1471.990) (-1471.868) -- 0:00:40
      419500 -- (-1475.588) [-1477.886] (-1470.673) (-1472.556) * [-1473.770] (-1472.791) (-1476.100) (-1473.007) -- 0:00:40
      420000 -- [-1471.198] (-1473.979) (-1471.615) (-1472.817) * (-1473.357) (-1476.721) (-1477.788) [-1472.150] -- 0:00:40

      Average standard deviation of split frequencies: 0.009040

      420500 -- (-1472.324) (-1470.401) [-1475.307] (-1472.246) * (-1477.333) (-1475.321) (-1471.827) [-1471.669] -- 0:00:39
      421000 -- [-1469.237] (-1473.273) (-1479.314) (-1472.343) * (-1471.397) (-1471.982) [-1472.168] (-1470.375) -- 0:00:39
      421500 -- (-1472.198) (-1475.934) (-1472.676) [-1472.048] * (-1474.764) (-1472.586) (-1480.738) [-1470.865] -- 0:00:39
      422000 -- [-1471.292] (-1474.415) (-1474.741) (-1473.365) * (-1474.747) (-1474.885) [-1474.145] (-1475.885) -- 0:00:39
      422500 -- (-1472.695) [-1472.987] (-1476.928) (-1471.149) * (-1475.445) (-1474.014) [-1478.372] (-1475.356) -- 0:00:39
      423000 -- [-1474.262] (-1471.049) (-1473.811) (-1470.447) * [-1475.482] (-1472.112) (-1477.442) (-1473.258) -- 0:00:39
      423500 -- (-1474.536) [-1474.036] (-1473.737) (-1478.862) * (-1476.273) [-1472.412] (-1478.994) (-1471.762) -- 0:00:39
      424000 -- [-1474.508] (-1473.771) (-1470.469) (-1475.893) * (-1475.476) (-1471.339) (-1475.979) [-1470.869] -- 0:00:39
      424500 -- [-1471.527] (-1474.089) (-1474.095) (-1473.356) * (-1472.839) [-1471.542] (-1473.511) (-1474.459) -- 0:00:39
      425000 -- (-1477.253) (-1472.596) [-1472.681] (-1474.445) * [-1470.375] (-1472.250) (-1473.682) (-1474.690) -- 0:00:40

      Average standard deviation of split frequencies: 0.008705

      425500 -- (-1475.295) (-1471.752) [-1474.703] (-1470.916) * (-1472.824) [-1473.566] (-1471.149) (-1472.322) -- 0:00:40
      426000 -- (-1471.007) (-1471.806) [-1477.454] (-1470.726) * (-1474.696) (-1474.689) [-1472.122] (-1476.098) -- 0:00:40
      426500 -- [-1476.557] (-1475.224) (-1474.571) (-1471.350) * (-1476.792) [-1470.824] (-1471.194) (-1471.711) -- 0:00:40
      427000 -- (-1473.512) (-1474.954) [-1476.053] (-1473.938) * [-1475.939] (-1473.128) (-1473.199) (-1473.914) -- 0:00:40
      427500 -- (-1472.053) (-1472.292) (-1473.243) [-1471.925] * (-1476.297) (-1473.638) (-1475.640) [-1477.660] -- 0:00:40
      428000 -- (-1475.326) (-1473.725) [-1471.034] (-1477.595) * (-1478.749) (-1473.346) (-1473.889) [-1472.457] -- 0:00:40
      428500 -- (-1474.396) (-1472.897) [-1471.684] (-1475.224) * (-1470.092) (-1474.392) (-1471.866) [-1471.678] -- 0:00:40
      429000 -- (-1473.598) (-1474.728) (-1472.326) [-1474.658] * [-1471.346] (-1469.759) (-1475.188) (-1472.194) -- 0:00:39
      429500 -- [-1471.797] (-1472.692) (-1476.764) (-1475.121) * (-1473.058) [-1472.290] (-1475.990) (-1472.284) -- 0:00:39
      430000 -- [-1473.027] (-1475.225) (-1476.414) (-1471.091) * (-1469.609) (-1473.675) (-1480.806) [-1473.543] -- 0:00:39

      Average standard deviation of split frequencies: 0.008684

      430500 -- (-1475.469) (-1473.380) (-1477.171) [-1472.673] * [-1469.930] (-1476.095) (-1476.053) (-1473.319) -- 0:00:39
      431000 -- (-1475.940) [-1474.280] (-1481.573) (-1472.201) * (-1469.901) (-1481.628) [-1471.480] (-1471.563) -- 0:00:39
      431500 -- (-1474.733) [-1473.760] (-1478.914) (-1471.093) * (-1472.738) (-1473.075) (-1473.481) [-1476.147] -- 0:00:39
      432000 -- (-1475.774) [-1473.608] (-1476.954) (-1472.878) * (-1474.394) (-1477.041) (-1476.600) [-1472.279] -- 0:00:39
      432500 -- (-1472.278) (-1477.375) [-1471.848] (-1471.989) * (-1472.140) (-1476.809) [-1471.682] (-1469.538) -- 0:00:39
      433000 -- [-1472.426] (-1478.165) (-1480.558) (-1472.044) * (-1471.395) (-1476.174) (-1472.392) [-1475.220] -- 0:00:39
      433500 -- (-1476.600) (-1476.637) (-1472.525) [-1470.216] * (-1474.747) [-1475.603] (-1479.602) (-1473.350) -- 0:00:39
      434000 -- (-1472.466) (-1476.977) (-1476.884) [-1471.036] * (-1473.223) (-1472.460) [-1471.699] (-1474.460) -- 0:00:39
      434500 -- (-1474.113) [-1472.026] (-1476.192) (-1470.852) * (-1472.080) (-1473.349) (-1471.775) [-1470.972] -- 0:00:39
      435000 -- (-1472.976) (-1473.667) (-1475.156) [-1471.542] * (-1473.506) (-1472.941) (-1472.096) [-1470.022] -- 0:00:38

      Average standard deviation of split frequencies: 0.009082

      435500 -- (-1471.743) (-1474.944) [-1472.706] (-1470.049) * (-1474.062) [-1477.552] (-1471.734) (-1476.305) -- 0:00:38
      436000 -- (-1471.296) (-1474.963) (-1473.945) [-1471.079] * (-1471.731) (-1477.458) (-1470.537) [-1474.285] -- 0:00:38
      436500 -- [-1473.199] (-1473.230) (-1473.597) (-1470.675) * (-1476.988) [-1475.252] (-1474.606) (-1473.585) -- 0:00:38
      437000 -- (-1474.131) [-1471.603] (-1473.740) (-1471.243) * (-1472.656) [-1471.884] (-1474.310) (-1472.908) -- 0:00:38
      437500 -- (-1474.572) [-1469.187] (-1472.093) (-1471.312) * (-1473.892) (-1473.422) [-1470.243] (-1473.770) -- 0:00: