>C1
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKVFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C2
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C3
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C4
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C5
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C6
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=359
C1 MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C2 MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C3 MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C4 MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C5 MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C6 MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
**************************************************
C1 SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C2 SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C3 SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C4 SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C5 SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C6 SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
**************************************************
C1 DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C2 DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C3 DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C4 DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C5 DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C6 DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
**************************************************
C1 SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C2 SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C3 SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C4 SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C5 SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C6 SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
**************************************************
C1 AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C2 AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C3 AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C4 AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C5 AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C6 AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
**************************************************
C1 APAKVFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C2 APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C3 APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C4 APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C5 APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C6 APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
****:*********************************************
C1 LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C2 LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C3 LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C4 LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C5 LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C6 LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
**************************************************
C1 GEWLATIGA
C2 GEWLATIGA
C3 GEWLATIGA
C4 GEWLATIGA
C5 GEWLATIGA
C6 GEWLATIGA
*********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 359 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 359 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [10770]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [10770]--->[10770]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.523 Mb, Max= 30.932 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C2 MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C3 MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C4 MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C5 MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
C6 MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
**************************************************
C1 SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C2 SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C3 SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C4 SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C5 SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
C6 SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
**************************************************
C1 DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C2 DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C3 DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C4 DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C5 DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
C6 DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
**************************************************
C1 SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C2 SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C3 SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C4 SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C5 SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
C6 SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
**************************************************
C1 AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C2 AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C3 AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C4 AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C5 AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
C6 AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
**************************************************
C1 APAKVFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C2 APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C3 APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C4 APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C5 APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
C6 APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
****:*********************************************
C1 LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C2 LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C3 LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C4 LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C5 LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
C6 LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
**************************************************
C1 GEWLATIGA
C2 GEWLATIGA
C3 GEWLATIGA
C4 GEWLATIGA
C5 GEWLATIGA
C6 GEWLATIGA
*********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 99.72 C1 C2 99.72
TOP 1 0 99.72 C2 C1 99.72
BOT 0 2 99.72 C1 C3 99.72
TOP 2 0 99.72 C3 C1 99.72
BOT 0 3 99.72 C1 C4 99.72
TOP 3 0 99.72 C4 C1 99.72
BOT 0 4 99.72 C1 C5 99.72
TOP 4 0 99.72 C5 C1 99.72
BOT 0 5 99.72 C1 C6 99.72
TOP 5 0 99.72 C6 C1 99.72
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.72
AVG 1 C2 * 99.94
AVG 2 C3 * 99.94
AVG 3 C4 * 99.94
AVG 4 C5 * 99.94
AVG 5 C6 * 99.94
TOT TOT * 99.91
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
C2 ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
C3 ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
C4 ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
C5 ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
C6 ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
**************************************************
C1 GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
C2 GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
C3 GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
C4 GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
C5 GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
C6 GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
**************************************************
C1 AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
C2 AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
C3 AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
C4 AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
C5 AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
C6 AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
**************************************************
C1 TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
C2 TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
C3 TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
C4 TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
C5 TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
C6 TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
**************************************************
C1 CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
C2 CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
C3 CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
C4 CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
C5 CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
C6 CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
**************************************************
C1 GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
C2 GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
C3 GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
C4 GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
C5 GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
C6 GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
**************************************************
C1 GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
C2 GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
C3 GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
C4 GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
C5 GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
C6 GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
**************************************************
C1 AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
C2 AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
C3 AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
C4 AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
C5 AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
C6 AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
**************************************************
C1 TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
C2 TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
C3 TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
C4 TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
C5 TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
C6 TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
**************************************************
C1 TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
C2 TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
C3 TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
C4 TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
C5 TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
C6 TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
**************************************************
C1 GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
C2 GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
C3 GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
C4 GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
C5 GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
C6 GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
**************************************************
C1 CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
C2 CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
C3 CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
C4 CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
C5 CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
C6 CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
**************************************************
C1 GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
C2 GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
C3 GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
C4 GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
C5 GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
C6 GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
**************************************************
C1 GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
C2 GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
C3 GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
C4 GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
C5 GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
C6 GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
**************************************************
C1 TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
C2 TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
C3 TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
C4 TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
C5 TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
C6 TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
**************************************************
C1 GCACCGGCCAAGGTTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
C2 GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
C3 GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
C4 GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
C5 GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
C6 GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
************.*************************************
C1 CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
C2 CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
C3 CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
C4 CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
C5 CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
C6 CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
**************************************************
C1 TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
C2 TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
C3 TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
C4 TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
C5 TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
C6 TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
**************************************************
C1 CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
C2 CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
C3 CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
C4 CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
C5 CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
C6 CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
**************************************************
C1 CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
C2 CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
C3 CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
C4 CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
C5 CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
C6 CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
**************************************************
C1 TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
C2 TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
C3 TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
C4 TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
C5 TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
C6 TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
**************************************************
C1 GGCGAGTGGCTAGCCACCATTGGCGCT
C2 GGCGAGTGGCTAGCCACCATTGGCGCT
C3 GGCGAGTGGCTAGCCACCATTGGCGCT
C4 GGCGAGTGGCTAGCCACCATTGGCGCT
C5 GGCGAGTGGCTAGCCACCATTGGCGCT
C6 GGCGAGTGGCTAGCCACCATTGGCGCT
***************************
>C1
ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
GCACCGGCCAAGGTTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
GGCGAGTGGCTAGCCACCATTGGCGCT
>C2
ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
GGCGAGTGGCTAGCCACCATTGGCGCT
>C3
ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
GGCGAGTGGCTAGCCACCATTGGCGCT
>C4
ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
GGCGAGTGGCTAGCCACCATTGGCGCT
>C5
ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
GGCGAGTGGCTAGCCACCATTGGCGCT
>C6
ATGAGACAGATCCTTGTCGCTGTCACAGTCGCGCTGGTTGTGTCTATCCT
GTTGACCCCAGCGCTGATCCGGTTGTTCACCAGACACGGCTTCGGCCAGG
AAATCCGTGAAGACGGCCCACCCAGCCACCACAACAAACGGGGAACCCCA
TCTATGGGTGGTGTTGCCATTGTCGCCGGCATTTGGGCCGGCTACCTGGG
CACTCATCTGGCAGGCTTGGCGTTCGATGGTGAAGGCGTATCGGCGTCGG
GTGTGCTGGTGTTGGGTCTGGCTACTGCGCTGGGCGGCGTCGGATTCCTC
GATGACTTGATCAAGATCCGCAGGTCGCGCAACCTCGGGTTGAACAAGAC
AGCCAAGACCGTCGGGCAGATAACAGCCGCGGTGCTGTTCGGGGTGCTGG
TGTTGCAGTTCCGCAATGGCGCCGGCTTGACACCGGCCAGCGCGGATCTG
TCCTACGTGCGTGAGATTGCGACCGTCACCTTGGCGCCGGCGTTATTCGT
GCTGTTCTGCATGGTCATCGTCAGTGCCTGGTCAAATGCGGTCAACTTCA
CCGACGGCTTAGACGGGCTGGCCGCTGGCAGTATGGCGATGGTCACCGCC
GCCTATGTTTTGATCACCTTTTGGCAATATCGCAATGCGTGCGTGACGGC
GCCGGGACTGGGTTGCTATAATGTGCGCGATCCGCTGGACCTGACGTTGA
TTGCAGCTGCGACGGTGGGCGCGTGTATTGGCTTTTTGTGGTGGAATGCC
GCACCGGCCAAGATTTTCATGGGAGATACCGGGTCCCTAGCGTTGGGTGG
CGTGATCGCTGGCTTGTCGGTCACCAGTCGCACTGAGATTCTTGCGGTCG
TGCTGGGTTCGCTGTTCGTTGCCGAAATCACCTCGGTTGTATTGCAGATT
CTGGCTTTCCGGACCACTGGTCGTCGGGTGTTTCGGATGGCGCCGTTCCA
CCATCATTTCGAATTGGCCGGTTGGGCCGAAACCACTGTGATCATTCGTT
TTTGGCTGCTCACAGCGATCGCTTGCGGTCTGGGCGTGGTCCTGTTCTAT
GGCGAGTGGCTAGCCACCATTGGCGCT
>C1
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKVFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C2
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C3
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C4
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C5
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
>C6
MRQILVAVTVALVVSILLTPALIRLFTRHGFGQEIREDGPPSHHNKRGTP
SMGGVAIVAGIWAGYLGTHLAGLAFDGEGVSASGVLVLGLATALGGVGFL
DDLIKIRRSRNLGLNKTAKTVGQITAAVLFGVLVLQFRNGAGLTPASADL
SYVREIATVTLAPALFVLFCMVIVSAWSNAVNFTDGLDGLAAGSMAMVTA
AYVLITFWQYRNACVTAPGLGCYNVRDPLDLTLIAAATVGACIGFLWWNA
APAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGSLFVAEITSVVLQI
LAFRTTGRRVFRMAPFHHHFELAGWAETTVIIRFWLLTAIACGLGVVLFY
GEWLATIGA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 1077 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579783270
Setting output file names to "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 361758214
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9071436335
Seed = 838473615
Swapseed = 1579783270
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 5 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2413.780485 -- -24.965149
Chain 2 -- -2413.780485 -- -24.965149
Chain 3 -- -2413.780485 -- -24.965149
Chain 4 -- -2413.780485 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2413.780485 -- -24.965149
Chain 2 -- -2413.778795 -- -24.965149
Chain 3 -- -2413.778795 -- -24.965149
Chain 4 -- -2413.778795 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2413.780] (-2413.780) (-2413.780) (-2413.780) * [-2413.780] (-2413.779) (-2413.779) (-2413.779)
500 -- (-1505.198) [-1485.037] (-1481.005) (-1485.072) * (-1492.688) [-1488.364] (-1493.155) (-1493.671) -- 0:33:19
1000 -- (-1488.533) (-1477.409) [-1480.415] (-1482.776) * [-1480.681] (-1483.415) (-1481.830) (-1475.584) -- 0:16:39
1500 -- (-1474.054) (-1478.968) [-1474.352] (-1490.434) * (-1473.381) (-1479.713) (-1474.425) [-1473.626] -- 0:11:05
2000 -- (-1473.616) (-1482.484) [-1475.631] (-1488.568) * (-1483.343) [-1473.421] (-1473.468) (-1484.942) -- 0:08:19
2500 -- (-1472.569) (-1490.242) (-1478.622) [-1477.095] * (-1475.380) (-1483.520) [-1474.269] (-1474.852) -- 0:06:39
3000 -- (-1477.274) (-1483.683) [-1477.422] (-1475.645) * (-1476.475) [-1474.586] (-1473.744) (-1480.149) -- 0:05:32
3500 -- (-1477.272) (-1485.848) (-1485.455) [-1476.275] * (-1480.799) (-1480.892) (-1474.132) [-1476.666] -- 0:04:44
4000 -- (-1474.928) [-1479.080] (-1480.085) (-1478.002) * (-1478.135) [-1473.606] (-1480.363) (-1480.559) -- 0:04:09
4500 -- (-1481.107) (-1478.642) (-1475.404) [-1474.285] * [-1470.937] (-1481.587) (-1484.710) (-1474.769) -- 0:03:41
5000 -- (-1472.293) [-1477.919] (-1488.563) (-1480.070) * [-1474.955] (-1475.430) (-1482.013) (-1475.555) -- 0:03:19
Average standard deviation of split frequencies: 0.075151
5500 -- (-1478.639) (-1474.615) (-1480.808) [-1477.279] * (-1471.497) (-1476.436) [-1471.022] (-1477.037) -- 0:03:00
6000 -- (-1481.617) (-1473.446) [-1472.224] (-1473.357) * (-1469.852) [-1474.999] (-1477.667) (-1483.540) -- 0:02:45
6500 -- (-1481.365) (-1478.527) [-1478.673] (-1477.172) * [-1473.127] (-1471.659) (-1475.452) (-1482.416) -- 0:02:32
7000 -- (-1481.483) [-1481.122] (-1481.489) (-1486.318) * (-1480.943) (-1478.457) (-1481.714) [-1477.366] -- 0:02:21
7500 -- (-1479.517) (-1480.321) (-1476.175) [-1481.711] * [-1481.565] (-1479.971) (-1477.418) (-1475.067) -- 0:02:12
8000 -- [-1482.758] (-1476.168) (-1482.881) (-1483.695) * [-1471.541] (-1475.672) (-1473.047) (-1478.078) -- 0:02:04
8500 -- (-1479.788) (-1481.171) (-1480.393) [-1471.921] * (-1479.361) (-1473.506) (-1477.792) [-1474.164] -- 0:01:56
9000 -- (-1482.392) [-1474.235] (-1475.194) (-1477.129) * (-1475.550) [-1475.530] (-1472.517) (-1478.605) -- 0:01:50
9500 -- (-1490.739) [-1474.119] (-1477.057) (-1475.998) * (-1497.759) (-1473.401) (-1485.275) [-1477.012] -- 0:01:44
10000 -- (-1482.655) (-1477.715) (-1478.082) [-1484.509] * (-1477.449) (-1474.649) [-1472.173] (-1481.437) -- 0:01:39
Average standard deviation of split frequencies: 0.065239
10500 -- (-1478.619) [-1477.721] (-1476.707) (-1482.962) * [-1471.415] (-1476.425) (-1477.755) (-1474.007) -- 0:01:34
11000 -- [-1476.832] (-1479.143) (-1476.085) (-1483.451) * (-1474.852) (-1476.688) (-1475.503) [-1478.703] -- 0:01:29
11500 -- (-1473.264) [-1476.191] (-1478.250) (-1485.373) * [-1471.680] (-1475.759) (-1477.581) (-1476.142) -- 0:01:25
12000 -- (-1478.837) [-1489.105] (-1487.013) (-1479.883) * (-1473.551) (-1479.393) (-1480.191) [-1478.059] -- 0:01:22
12500 -- (-1481.163) (-1479.520) (-1474.043) [-1473.972] * (-1478.193) (-1473.761) (-1478.303) [-1474.198] -- 0:01:19
13000 -- (-1472.663) (-1478.053) [-1476.553] (-1472.740) * (-1477.126) (-1469.721) (-1482.875) [-1472.624] -- 0:01:15
13500 -- (-1485.600) (-1482.199) [-1474.448] (-1471.955) * (-1472.833) (-1474.893) [-1476.839] (-1481.512) -- 0:02:26
14000 -- (-1475.669) (-1481.066) (-1474.560) [-1476.851] * (-1473.260) (-1474.385) (-1480.210) [-1477.839] -- 0:02:20
14500 -- (-1473.704) (-1475.981) [-1480.369] (-1473.170) * [-1475.383] (-1475.495) (-1474.878) (-1479.184) -- 0:02:15
15000 -- (-1476.345) (-1479.477) (-1472.644) [-1474.840] * (-1472.980) (-1475.533) (-1473.141) [-1477.153] -- 0:02:11
Average standard deviation of split frequencies: 0.053033
15500 -- (-1474.887) [-1476.548] (-1474.333) (-1470.048) * (-1475.553) (-1476.607) (-1471.088) [-1479.057] -- 0:02:07
16000 -- (-1478.419) (-1475.522) (-1472.677) [-1472.153] * (-1474.510) (-1478.646) [-1472.199] (-1477.811) -- 0:02:03
16500 -- [-1476.787] (-1475.896) (-1476.872) (-1476.076) * [-1471.759] (-1480.666) (-1472.396) (-1479.144) -- 0:01:59
17000 -- (-1478.840) [-1475.915] (-1477.528) (-1475.331) * (-1472.422) [-1477.090] (-1473.248) (-1480.960) -- 0:01:55
17500 -- [-1474.997] (-1473.537) (-1473.586) (-1475.403) * (-1472.294) [-1475.042] (-1473.661) (-1475.839) -- 0:01:52
18000 -- [-1477.422] (-1476.799) (-1475.686) (-1475.882) * (-1472.294) (-1471.163) [-1472.372] (-1477.906) -- 0:01:49
18500 -- (-1473.596) (-1472.963) [-1472.852] (-1478.250) * (-1471.714) [-1472.331] (-1475.500) (-1482.927) -- 0:01:46
19000 -- [-1472.012] (-1475.346) (-1474.152) (-1478.059) * [-1471.631] (-1476.854) (-1473.765) (-1475.826) -- 0:01:43
19500 -- (-1474.067) [-1472.214] (-1472.149) (-1476.167) * (-1471.028) (-1473.543) (-1474.440) [-1476.406] -- 0:01:40
20000 -- (-1475.005) [-1473.137] (-1475.294) (-1477.040) * (-1475.190) (-1474.594) (-1480.348) [-1474.588] -- 0:01:38
Average standard deviation of split frequencies: 0.065895
20500 -- (-1477.704) (-1477.698) [-1474.873] (-1471.072) * (-1474.992) (-1470.131) (-1482.146) [-1481.264] -- 0:01:35
21000 -- [-1484.983] (-1483.236) (-1473.455) (-1475.734) * (-1474.358) (-1475.980) [-1474.278] (-1479.167) -- 0:01:33
21500 -- (-1487.045) [-1474.559] (-1480.515) (-1478.863) * (-1470.207) (-1473.426) (-1477.689) [-1478.325] -- 0:01:31
22000 -- (-1487.178) (-1474.955) (-1481.004) [-1470.757] * (-1472.496) (-1474.638) [-1472.021] (-1475.406) -- 0:01:28
22500 -- (-1474.565) [-1473.161] (-1482.570) (-1475.282) * (-1472.584) (-1471.436) (-1472.156) [-1477.562] -- 0:01:26
23000 -- [-1472.806] (-1472.511) (-1477.485) (-1473.900) * [-1470.952] (-1471.072) (-1473.196) (-1476.406) -- 0:01:24
23500 -- (-1479.534) (-1477.520) (-1479.805) [-1472.614] * [-1473.294] (-1471.346) (-1474.352) (-1482.589) -- 0:01:23
24000 -- (-1474.263) [-1477.097] (-1475.876) (-1478.106) * (-1470.016) (-1473.648) (-1471.465) [-1474.084] -- 0:01:21
24500 -- (-1481.218) (-1472.933) [-1474.236] (-1471.613) * (-1475.996) (-1471.260) (-1473.772) [-1478.750] -- 0:01:19
25000 -- (-1480.268) [-1474.391] (-1470.719) (-1471.723) * (-1476.034) (-1472.530) (-1477.441) [-1477.243] -- 0:01:18
Average standard deviation of split frequencies: 0.054393
25500 -- [-1475.048] (-1477.129) (-1474.524) (-1472.643) * (-1471.767) (-1479.795) (-1474.466) [-1474.520] -- 0:01:16
26000 -- [-1473.615] (-1476.493) (-1474.798) (-1473.852) * (-1472.606) [-1470.925] (-1473.364) (-1479.175) -- 0:01:14
26500 -- [-1475.248] (-1475.211) (-1480.147) (-1475.755) * [-1474.035] (-1475.005) (-1471.587) (-1478.181) -- 0:01:13
27000 -- (-1479.808) (-1473.426) (-1477.748) [-1473.308] * [-1472.613] (-1472.803) (-1471.768) (-1478.480) -- 0:01:12
27500 -- (-1477.313) [-1476.864] (-1478.406) (-1475.651) * (-1472.725) (-1471.185) [-1472.133] (-1479.265) -- 0:01:46
28000 -- (-1472.980) (-1473.548) [-1478.969] (-1474.890) * (-1474.930) [-1471.941] (-1474.826) (-1476.325) -- 0:01:44
28500 -- (-1472.308) [-1475.466] (-1481.615) (-1474.848) * [-1471.044] (-1471.712) (-1473.918) (-1480.716) -- 0:01:42
29000 -- (-1472.578) [-1474.462] (-1474.999) (-1475.241) * (-1471.054) (-1473.698) (-1473.915) [-1472.974] -- 0:01:40
29500 -- (-1474.283) [-1470.585] (-1476.308) (-1476.125) * (-1471.922) (-1474.063) (-1474.495) [-1475.938] -- 0:01:38
30000 -- [-1472.281] (-1476.388) (-1473.594) (-1476.180) * [-1472.488] (-1472.812) (-1473.765) (-1479.904) -- 0:01:37
Average standard deviation of split frequencies: 0.053802
30500 -- (-1474.676) [-1476.374] (-1473.419) (-1476.347) * (-1472.340) (-1471.465) (-1473.326) [-1480.103] -- 0:01:35
31000 -- (-1475.681) [-1469.951] (-1471.432) (-1479.577) * (-1474.934) [-1472.930] (-1473.357) (-1480.013) -- 0:01:33
31500 -- [-1473.633] (-1486.629) (-1474.942) (-1476.899) * (-1470.245) (-1472.333) (-1475.323) [-1475.886] -- 0:01:32
32000 -- (-1475.815) [-1476.511] (-1469.601) (-1476.526) * (-1473.899) (-1469.947) [-1475.020] (-1474.861) -- 0:01:30
32500 -- [-1472.598] (-1478.349) (-1474.658) (-1475.083) * (-1473.774) (-1471.865) (-1477.236) [-1474.094] -- 0:01:29
33000 -- (-1471.825) (-1479.715) [-1472.550] (-1479.111) * (-1477.611) (-1471.034) (-1476.626) [-1475.847] -- 0:01:27
33500 -- (-1473.097) (-1488.016) [-1473.073] (-1475.348) * (-1473.137) (-1472.981) (-1475.753) [-1475.559] -- 0:01:26
34000 -- (-1477.091) [-1484.001] (-1471.636) (-1475.095) * (-1472.402) (-1473.956) (-1477.585) [-1478.607] -- 0:01:25
34500 -- (-1472.568) (-1475.429) [-1476.441] (-1477.052) * (-1475.100) (-1472.361) [-1472.369] (-1477.997) -- 0:01:23
35000 -- (-1470.311) [-1475.801] (-1478.944) (-1475.328) * (-1479.035) (-1472.248) [-1473.833] (-1473.178) -- 0:01:22
Average standard deviation of split frequencies: 0.053688
35500 -- [-1474.472] (-1482.658) (-1473.945) (-1473.549) * (-1472.326) (-1472.913) (-1477.443) [-1474.993] -- 0:01:21
36000 -- (-1474.429) [-1478.300] (-1477.157) (-1477.085) * (-1472.956) (-1473.970) (-1475.482) [-1477.178] -- 0:01:20
36500 -- (-1473.306) (-1472.903) (-1475.321) [-1474.460] * [-1471.658] (-1471.995) (-1475.831) (-1484.126) -- 0:01:19
37000 -- (-1471.265) (-1474.530) (-1472.110) [-1474.546] * (-1473.847) [-1471.008] (-1473.033) (-1473.164) -- 0:01:18
37500 -- (-1471.267) (-1475.010) [-1471.989] (-1477.390) * (-1475.486) [-1473.094] (-1476.100) (-1476.041) -- 0:01:17
38000 -- (-1477.796) [-1473.383] (-1474.260) (-1474.364) * (-1474.198) (-1476.194) [-1472.444] (-1487.420) -- 0:01:15
38500 -- [-1472.134] (-1472.733) (-1472.802) (-1473.449) * [-1472.559] (-1472.583) (-1472.732) (-1477.984) -- 0:01:14
39000 -- (-1474.242) [-1477.663] (-1471.958) (-1472.281) * (-1470.403) (-1472.483) [-1478.048] (-1486.133) -- 0:01:13
39500 -- [-1475.644] (-1478.119) (-1473.079) (-1478.380) * (-1475.824) (-1472.463) (-1478.185) [-1478.364] -- 0:01:12
40000 -- (-1475.321) [-1482.335] (-1475.349) (-1475.871) * (-1474.250) (-1472.623) [-1471.599] (-1476.342) -- 0:01:12
Average standard deviation of split frequencies: 0.045147
40500 -- (-1476.221) (-1476.175) [-1472.038] (-1474.473) * (-1475.172) (-1470.752) (-1475.424) [-1479.531] -- 0:01:11
41000 -- (-1477.516) (-1477.417) (-1472.253) [-1471.927] * (-1477.818) (-1474.946) (-1470.409) [-1475.770] -- 0:01:10
41500 -- (-1475.504) [-1478.701] (-1473.616) (-1472.826) * (-1477.673) (-1480.793) [-1474.204] (-1482.790) -- 0:01:32
42000 -- (-1478.111) [-1478.747] (-1474.012) (-1475.520) * (-1477.854) (-1483.302) [-1475.082] (-1477.018) -- 0:01:31
42500 -- (-1472.050) [-1485.802] (-1474.362) (-1471.731) * (-1478.043) (-1471.911) (-1476.289) [-1486.063] -- 0:01:30
43000 -- (-1471.090) [-1470.995] (-1473.749) (-1473.897) * [-1475.345] (-1477.700) (-1477.224) (-1477.924) -- 0:01:29
43500 -- (-1473.394) (-1474.336) (-1471.737) [-1472.599] * (-1475.699) (-1473.422) (-1474.867) [-1475.653] -- 0:01:27
44000 -- [-1473.765] (-1477.555) (-1474.768) (-1474.809) * (-1474.489) (-1474.999) (-1474.985) [-1477.320] -- 0:01:26
44500 -- (-1471.859) [-1474.834] (-1472.944) (-1473.151) * (-1471.577) (-1473.511) (-1471.868) [-1475.860] -- 0:01:25
45000 -- (-1471.139) (-1477.052) [-1477.660] (-1474.034) * (-1473.017) (-1473.575) (-1474.974) [-1479.631] -- 0:01:24
Average standard deviation of split frequencies: 0.040452
45500 -- (-1474.575) [-1480.016] (-1474.088) (-1474.374) * (-1477.193) (-1473.153) (-1472.340) [-1484.408] -- 0:01:23
46000 -- (-1475.792) (-1482.254) (-1476.710) [-1476.273] * (-1475.819) (-1475.990) [-1472.372] (-1488.430) -- 0:01:22
46500 -- (-1472.535) (-1473.308) (-1472.165) [-1475.621] * (-1476.948) (-1474.108) (-1474.225) [-1481.044] -- 0:01:22
47000 -- (-1473.638) [-1472.420] (-1472.289) (-1476.191) * (-1475.170) (-1472.189) (-1472.591) [-1480.907] -- 0:01:21
47500 -- (-1474.890) [-1471.504] (-1470.305) (-1478.833) * (-1475.309) [-1472.698] (-1471.662) (-1478.050) -- 0:01:20
48000 -- (-1473.379) (-1472.479) (-1471.267) [-1476.880] * (-1475.015) (-1473.136) (-1472.220) [-1472.276] -- 0:01:19
48500 -- [-1472.899] (-1471.455) (-1473.438) (-1475.333) * (-1475.147) (-1472.950) (-1473.938) [-1472.946] -- 0:01:18
49000 -- [-1477.415] (-1473.540) (-1476.396) (-1476.230) * [-1474.801] (-1472.510) (-1472.860) (-1480.527) -- 0:01:17
49500 -- (-1476.336) [-1472.184] (-1473.805) (-1475.577) * (-1472.189) (-1471.638) (-1479.865) [-1473.593] -- 0:01:16
50000 -- (-1476.356) [-1474.150] (-1471.956) (-1474.795) * (-1474.370) (-1475.400) (-1480.358) [-1478.662] -- 0:01:16
Average standard deviation of split frequencies: 0.031340
50500 -- (-1477.109) [-1472.957] (-1469.856) (-1473.668) * (-1476.170) (-1471.774) (-1476.334) [-1475.439] -- 0:01:15
51000 -- (-1478.912) (-1472.312) (-1471.822) [-1477.795] * (-1475.341) (-1475.382) [-1473.580] (-1480.143) -- 0:01:14
51500 -- [-1478.719] (-1474.365) (-1472.208) (-1475.860) * (-1475.196) (-1472.456) (-1474.626) [-1477.246] -- 0:01:13
52000 -- (-1476.100) (-1472.568) [-1470.853] (-1474.937) * (-1476.454) (-1476.722) (-1475.887) [-1476.808] -- 0:01:12
52500 -- (-1475.871) (-1469.665) (-1472.954) [-1474.191] * (-1476.291) (-1472.589) [-1473.341] (-1476.381) -- 0:01:12
53000 -- (-1475.438) (-1475.809) (-1473.434) [-1474.986] * [-1475.499] (-1474.268) (-1474.121) (-1476.774) -- 0:01:11
53500 -- (-1475.171) (-1472.775) [-1472.934] (-1473.990) * (-1476.018) [-1472.862] (-1470.730) (-1474.728) -- 0:01:10
54000 -- (-1478.734) (-1471.128) (-1474.202) [-1473.972] * (-1475.941) [-1471.139] (-1471.345) (-1477.308) -- 0:01:10
54500 -- (-1475.681) (-1471.962) [-1473.411] (-1475.246) * [-1472.814] (-1475.338) (-1472.412) (-1480.656) -- 0:01:09
55000 -- (-1475.902) [-1472.642] (-1474.554) (-1477.791) * (-1473.936) (-1472.889) (-1473.407) [-1478.440] -- 0:01:25
Average standard deviation of split frequencies: 0.035355
55500 -- (-1473.131) (-1477.131) [-1473.366] (-1477.199) * [-1472.407] (-1475.696) (-1476.814) (-1475.111) -- 0:01:25
56000 -- (-1475.947) [-1472.463] (-1474.451) (-1472.617) * (-1476.178) (-1475.326) (-1474.261) [-1474.693] -- 0:01:24
56500 -- (-1474.107) [-1471.455] (-1474.994) (-1479.235) * (-1475.344) (-1476.516) [-1474.995] (-1484.819) -- 0:01:23
57000 -- (-1477.587) [-1472.585] (-1471.898) (-1473.092) * (-1471.926) [-1473.992] (-1474.301) (-1477.143) -- 0:01:22
57500 -- [-1474.886] (-1474.382) (-1472.438) (-1476.965) * [-1470.142] (-1475.897) (-1476.822) (-1478.257) -- 0:01:21
58000 -- (-1471.420) (-1476.951) [-1476.509] (-1474.877) * (-1473.586) (-1472.671) (-1474.191) [-1474.304] -- 0:01:21
58500 -- (-1474.207) (-1473.439) (-1470.540) [-1473.745] * (-1472.766) (-1475.600) [-1473.252] (-1481.457) -- 0:01:20
59000 -- [-1473.701] (-1473.168) (-1472.747) (-1475.009) * (-1472.848) (-1472.145) (-1472.584) [-1476.226] -- 0:01:19
59500 -- (-1472.857) (-1473.003) [-1469.690] (-1474.086) * [-1472.668] (-1477.537) (-1473.692) (-1473.601) -- 0:01:19
60000 -- (-1472.465) (-1477.398) [-1469.656] (-1473.680) * [-1473.328] (-1472.714) (-1471.687) (-1480.495) -- 0:01:18
Average standard deviation of split frequencies: 0.026808
60500 -- (-1475.869) (-1476.471) [-1471.848] (-1472.701) * (-1473.355) [-1471.894] (-1475.635) (-1481.504) -- 0:01:17
61000 -- (-1472.523) (-1475.767) [-1472.099] (-1474.251) * (-1471.576) [-1471.769] (-1473.530) (-1479.181) -- 0:01:16
61500 -- (-1473.547) (-1471.417) [-1471.282] (-1476.514) * [-1472.000] (-1471.972) (-1472.655) (-1479.215) -- 0:01:16
62000 -- [-1474.551] (-1472.953) (-1474.550) (-1475.102) * [-1472.773] (-1470.953) (-1471.296) (-1481.168) -- 0:01:15
62500 -- (-1475.749) (-1471.251) (-1472.432) [-1474.551] * (-1471.028) (-1471.903) [-1471.115] (-1479.505) -- 0:01:15
63000 -- (-1473.423) (-1471.289) [-1473.049] (-1475.191) * (-1472.493) (-1475.792) (-1472.124) [-1484.515] -- 0:01:14
63500 -- [-1475.377] (-1471.626) (-1473.060) (-1471.606) * (-1475.525) (-1475.283) (-1481.684) [-1479.566] -- 0:01:13
64000 -- (-1471.674) (-1477.923) [-1475.223] (-1473.281) * (-1473.371) (-1475.629) (-1472.858) [-1483.277] -- 0:01:13
64500 -- (-1471.791) [-1475.272] (-1471.415) (-1472.069) * [-1471.772] (-1473.911) (-1476.023) (-1477.160) -- 0:01:12
65000 -- (-1471.335) [-1474.403] (-1472.071) (-1472.724) * (-1474.199) [-1472.916] (-1473.826) (-1478.655) -- 0:01:11
Average standard deviation of split frequencies: 0.027550
65500 -- (-1472.610) [-1473.656] (-1473.946) (-1473.492) * [-1471.521] (-1472.265) (-1472.982) (-1483.140) -- 0:01:11
66000 -- (-1471.586) (-1471.597) [-1472.522] (-1475.592) * (-1483.284) [-1475.167] (-1471.927) (-1476.397) -- 0:01:10
66500 -- [-1473.161] (-1471.005) (-1473.227) (-1475.973) * (-1474.919) (-1474.043) (-1475.097) [-1478.862] -- 0:01:10
67000 -- (-1471.282) (-1477.824) (-1472.507) [-1475.702] * (-1471.606) (-1472.240) [-1474.092] (-1477.253) -- 0:01:09
67500 -- (-1480.664) [-1472.081] (-1471.969) (-1474.968) * (-1476.511) (-1475.393) [-1474.917] (-1477.364) -- 0:01:09
68000 -- (-1487.965) (-1472.014) (-1476.694) [-1475.361] * (-1470.583) (-1475.091) [-1474.929] (-1480.613) -- 0:01:08
68500 -- (-1476.827) (-1476.350) [-1473.007] (-1478.483) * (-1470.771) [-1473.464] (-1473.430) (-1478.945) -- 0:01:07
69000 -- (-1471.062) (-1482.562) [-1472.040] (-1476.179) * (-1472.914) (-1471.316) (-1474.485) [-1476.609] -- 0:01:07
69500 -- (-1471.407) (-1481.384) (-1471.558) [-1472.788] * [-1473.455] (-1475.112) (-1472.304) (-1478.749) -- 0:01:06
70000 -- (-1475.851) [-1471.788] (-1473.753) (-1476.451) * (-1472.700) (-1474.413) (-1474.058) [-1477.855] -- 0:01:19
Average standard deviation of split frequencies: 0.024142
70500 -- [-1476.291] (-1476.978) (-1474.208) (-1471.562) * (-1472.013) (-1474.557) (-1470.796) [-1475.549] -- 0:01:19
71000 -- (-1474.698) [-1471.030] (-1483.029) (-1478.998) * (-1476.170) (-1472.751) (-1473.732) [-1476.235] -- 0:01:18
71500 -- [-1471.865] (-1474.288) (-1474.754) (-1474.809) * (-1478.127) (-1471.446) (-1473.102) [-1479.232] -- 0:01:17
72000 -- [-1471.046] (-1474.403) (-1473.071) (-1472.523) * (-1472.724) (-1472.902) (-1476.413) [-1479.406] -- 0:01:17
72500 -- (-1479.276) [-1475.397] (-1474.241) (-1481.281) * (-1474.030) (-1473.288) (-1474.243) [-1475.054] -- 0:01:16
73000 -- (-1475.739) (-1473.383) [-1471.858] (-1474.730) * [-1470.654] (-1471.633) (-1472.807) (-1480.199) -- 0:01:16
73500 -- (-1471.715) (-1472.606) (-1472.287) [-1474.644] * (-1473.554) (-1472.445) (-1476.313) [-1475.839] -- 0:01:15
74000 -- (-1472.277) [-1473.860] (-1472.814) (-1475.417) * (-1472.406) [-1473.239] (-1472.129) (-1478.737) -- 0:01:15
74500 -- [-1474.494] (-1477.629) (-1473.387) (-1475.899) * [-1472.194] (-1472.495) (-1478.308) (-1480.662) -- 0:01:14
75000 -- (-1475.756) (-1481.593) [-1474.291] (-1475.887) * (-1473.770) (-1473.120) (-1472.450) [-1475.091] -- 0:01:14
Average standard deviation of split frequencies: 0.021857
75500 -- (-1474.404) (-1474.465) [-1472.552] (-1477.370) * [-1472.156] (-1477.083) (-1472.715) (-1481.331) -- 0:01:13
76000 -- (-1471.483) [-1473.409] (-1471.339) (-1475.459) * (-1475.087) (-1476.201) (-1470.283) [-1472.718] -- 0:01:12
76500 -- [-1474.882] (-1474.939) (-1473.913) (-1475.922) * (-1474.934) [-1472.478] (-1472.363) (-1477.802) -- 0:01:12
77000 -- [-1472.884] (-1475.156) (-1472.035) (-1478.397) * (-1474.090) (-1472.005) [-1470.674] (-1477.139) -- 0:01:11
77500 -- (-1480.272) (-1474.521) (-1472.530) [-1475.299] * (-1469.588) [-1472.390] (-1472.473) (-1477.424) -- 0:01:11
78000 -- (-1476.837) (-1472.075) (-1470.910) [-1478.606] * [-1470.870] (-1473.313) (-1473.781) (-1481.244) -- 0:01:10
78500 -- (-1473.098) [-1475.577] (-1475.901) (-1477.596) * (-1475.287) [-1472.600] (-1474.148) (-1483.065) -- 0:01:10
79000 -- (-1469.972) [-1472.378] (-1471.534) (-1474.623) * (-1472.546) (-1475.228) (-1473.155) [-1479.894] -- 0:01:09
79500 -- (-1470.072) (-1473.444) (-1472.265) [-1473.743] * (-1473.276) (-1475.116) (-1479.010) [-1473.898] -- 0:01:09
80000 -- [-1473.534] (-1472.922) (-1476.947) (-1477.078) * (-1472.135) (-1472.342) [-1475.726] (-1481.276) -- 0:01:09
Average standard deviation of split frequencies: 0.021838
80500 -- (-1473.027) (-1476.666) (-1470.858) [-1475.114] * (-1471.982) (-1475.201) [-1472.994] (-1475.950) -- 0:01:08
81000 -- (-1469.660) (-1476.269) [-1472.307] (-1472.573) * (-1472.379) [-1474.137] (-1474.455) (-1477.980) -- 0:01:08
81500 -- [-1474.224] (-1474.842) (-1473.581) (-1473.400) * (-1471.634) (-1476.221) (-1472.534) [-1472.828] -- 0:01:07
82000 -- (-1471.588) (-1475.261) (-1475.392) [-1476.037] * (-1474.547) (-1475.356) (-1471.515) [-1475.978] -- 0:01:07
82500 -- (-1473.516) [-1475.236] (-1473.815) (-1476.922) * (-1471.631) [-1472.887] (-1473.389) (-1471.788) -- 0:01:06
83000 -- (-1474.740) (-1476.471) [-1470.790] (-1476.944) * (-1475.120) (-1475.551) (-1473.290) [-1474.995] -- 0:01:06
83500 -- (-1473.900) (-1477.342) [-1470.201] (-1476.633) * (-1477.253) (-1475.243) [-1474.492] (-1477.762) -- 0:01:05
84000 -- (-1472.597) (-1475.130) [-1472.088] (-1474.731) * (-1472.548) (-1473.091) (-1473.101) [-1475.400] -- 0:01:05
84500 -- (-1471.299) [-1472.472] (-1471.648) (-1475.661) * (-1470.248) (-1474.789) (-1471.342) [-1475.917] -- 0:01:15
85000 -- (-1470.229) [-1473.646] (-1472.603) (-1477.304) * [-1472.957] (-1473.877) (-1470.968) (-1477.281) -- 0:01:15
Average standard deviation of split frequencies: 0.023080
85500 -- [-1471.935] (-1474.503) (-1473.110) (-1475.059) * (-1474.086) (-1473.098) (-1474.695) [-1471.081] -- 0:01:14
86000 -- (-1470.822) [-1472.173] (-1478.565) (-1474.253) * (-1473.087) [-1476.520] (-1472.912) (-1474.618) -- 0:01:14
86500 -- (-1474.068) (-1472.457) [-1478.304] (-1472.754) * (-1474.887) (-1471.793) (-1475.289) [-1470.994] -- 0:01:13
87000 -- (-1471.987) [-1473.253] (-1473.384) (-1474.977) * (-1473.642) [-1473.267] (-1476.993) (-1477.136) -- 0:01:13
87500 -- (-1471.274) (-1471.652) [-1474.166] (-1472.439) * (-1475.410) [-1471.625] (-1473.773) (-1476.898) -- 0:01:13
88000 -- (-1476.514) (-1472.091) (-1475.402) [-1474.554] * [-1471.748] (-1474.335) (-1476.249) (-1483.066) -- 0:01:12
88500 -- (-1474.313) [-1471.521] (-1473.078) (-1474.755) * (-1470.964) [-1474.414] (-1475.235) (-1479.703) -- 0:01:12
89000 -- (-1470.854) (-1472.435) (-1476.999) [-1474.677] * (-1473.436) (-1472.416) [-1472.441] (-1477.356) -- 0:01:11
89500 -- [-1473.855] (-1472.855) (-1474.758) (-1475.923) * (-1472.262) (-1474.635) (-1474.235) [-1474.283] -- 0:01:11
90000 -- (-1471.503) (-1473.577) (-1473.977) [-1474.020] * [-1472.376] (-1471.296) (-1473.352) (-1476.481) -- 0:01:10
Average standard deviation of split frequencies: 0.027091
90500 -- [-1470.181] (-1471.397) (-1475.064) (-1472.351) * (-1473.418) (-1473.186) (-1475.067) [-1470.295] -- 0:01:10
91000 -- (-1470.798) (-1473.713) [-1474.732] (-1473.271) * (-1472.528) (-1470.225) (-1473.727) [-1477.323] -- 0:01:09
91500 -- (-1471.559) (-1473.574) (-1477.118) [-1471.179] * (-1471.357) (-1473.485) (-1474.128) [-1477.869] -- 0:01:09
92000 -- (-1472.494) (-1473.509) (-1472.584) [-1473.474] * (-1475.781) [-1473.373] (-1473.486) (-1480.358) -- 0:01:09
92500 -- (-1473.976) (-1472.453) (-1472.938) [-1473.542] * (-1474.633) [-1470.902] (-1479.517) (-1472.422) -- 0:01:08
93000 -- (-1473.644) [-1475.326] (-1473.307) (-1474.159) * (-1476.124) (-1470.607) [-1474.166] (-1479.967) -- 0:01:08
93500 -- (-1472.781) [-1474.455] (-1477.766) (-1471.995) * [-1472.444] (-1474.383) (-1471.905) (-1480.469) -- 0:01:07
94000 -- (-1471.330) [-1471.547] (-1471.107) (-1474.917) * (-1474.348) (-1477.222) (-1474.952) [-1477.426] -- 0:01:07
94500 -- (-1471.844) [-1472.928] (-1471.473) (-1474.331) * (-1473.115) (-1475.459) (-1473.924) [-1476.604] -- 0:01:07
95000 -- [-1472.988] (-1474.055) (-1473.421) (-1474.053) * [-1470.566] (-1472.428) (-1472.199) (-1476.763) -- 0:01:06
Average standard deviation of split frequencies: 0.022643
95500 -- (-1475.049) [-1473.937] (-1474.090) (-1472.982) * (-1471.954) (-1470.549) (-1476.065) [-1477.052] -- 0:01:06
96000 -- (-1473.658) (-1474.271) (-1472.462) [-1474.002] * (-1471.319) [-1470.420] (-1471.444) (-1472.985) -- 0:01:05
96500 -- [-1473.489] (-1474.633) (-1473.393) (-1476.105) * (-1471.682) (-1470.992) [-1470.787] (-1473.264) -- 0:01:05
97000 -- (-1474.378) [-1470.466] (-1472.569) (-1478.216) * (-1472.901) (-1470.296) [-1471.442] (-1479.605) -- 0:01:05
97500 -- (-1472.401) [-1471.555] (-1476.036) (-1473.665) * (-1473.452) (-1469.642) (-1473.574) [-1475.548] -- 0:01:04
98000 -- (-1471.869) [-1471.435] (-1480.673) (-1471.591) * (-1470.347) (-1471.707) [-1471.492] (-1480.672) -- 0:01:04
98500 -- (-1472.194) [-1471.873] (-1474.398) (-1474.476) * (-1472.870) (-1476.246) [-1474.504] (-1473.098) -- 0:01:04
99000 -- [-1475.018] (-1481.023) (-1474.980) (-1478.774) * (-1475.233) (-1472.015) [-1471.750] (-1483.886) -- 0:01:03
99500 -- (-1473.347) (-1476.539) [-1474.690] (-1473.531) * (-1469.086) [-1473.479] (-1476.426) (-1476.056) -- 0:01:12
100000 -- (-1473.510) [-1473.438] (-1476.476) (-1474.739) * (-1473.255) [-1476.587] (-1477.291) (-1471.790) -- 0:01:12
Average standard deviation of split frequencies: 0.022712
100500 -- [-1470.643] (-1476.522) (-1473.625) (-1471.023) * [-1472.431] (-1470.449) (-1474.636) (-1476.375) -- 0:01:11
101000 -- (-1471.337) (-1474.383) [-1472.711] (-1470.895) * (-1469.368) (-1470.040) [-1479.014] (-1474.941) -- 0:01:11
101500 -- (-1478.026) [-1476.158] (-1474.307) (-1471.117) * (-1470.909) (-1469.563) (-1475.046) [-1471.258] -- 0:01:10
102000 -- [-1472.648] (-1478.638) (-1473.380) (-1471.078) * (-1470.480) [-1471.067] (-1479.616) (-1471.287) -- 0:01:10
102500 -- (-1470.988) [-1474.629] (-1473.182) (-1476.336) * [-1472.067] (-1478.840) (-1475.772) (-1471.993) -- 0:01:10
103000 -- (-1470.812) (-1472.982) (-1474.533) [-1477.327] * (-1471.881) [-1475.363] (-1476.903) (-1474.941) -- 0:01:09
103500 -- (-1473.756) (-1471.608) (-1473.604) [-1476.065] * (-1473.339) (-1474.860) [-1474.606] (-1473.044) -- 0:01:09
104000 -- (-1471.261) (-1472.738) (-1478.004) [-1474.533] * (-1477.489) (-1474.302) (-1474.803) [-1470.231] -- 0:01:08
104500 -- (-1471.880) (-1473.126) [-1475.834] (-1474.328) * (-1475.551) [-1473.016] (-1477.394) (-1475.290) -- 0:01:08
105000 -- (-1473.850) [-1476.646] (-1475.216) (-1474.866) * [-1475.839] (-1471.937) (-1478.730) (-1473.764) -- 0:01:08
Average standard deviation of split frequencies: 0.021534
105500 -- (-1475.474) [-1472.292] (-1481.333) (-1475.646) * (-1475.765) [-1473.979] (-1476.777) (-1473.888) -- 0:01:07
106000 -- (-1471.746) [-1474.049] (-1476.051) (-1474.623) * [-1474.017] (-1473.211) (-1477.180) (-1470.529) -- 0:01:07
106500 -- (-1473.788) (-1470.681) (-1477.542) [-1480.249] * (-1474.090) [-1473.413] (-1483.014) (-1472.244) -- 0:01:07
107000 -- (-1474.242) (-1473.861) [-1472.403] (-1474.292) * [-1471.445] (-1471.962) (-1479.540) (-1473.361) -- 0:01:06
107500 -- (-1472.924) (-1475.445) [-1471.684] (-1477.047) * (-1473.338) [-1473.552] (-1476.031) (-1471.649) -- 0:01:06
108000 -- (-1474.900) (-1475.830) (-1471.338) [-1474.929] * (-1474.518) (-1472.100) [-1475.153] (-1472.725) -- 0:01:06
108500 -- (-1471.136) [-1473.442] (-1472.218) (-1475.588) * [-1472.197] (-1470.699) (-1474.722) (-1473.709) -- 0:01:05
109000 -- (-1471.636) [-1472.903] (-1472.889) (-1473.293) * (-1472.578) [-1473.415] (-1472.610) (-1472.898) -- 0:01:05
109500 -- (-1472.099) (-1472.504) (-1473.123) [-1472.722] * [-1471.575] (-1474.340) (-1474.640) (-1479.684) -- 0:01:05
110000 -- [-1473.308] (-1474.091) (-1472.404) (-1471.647) * (-1477.325) (-1471.575) (-1475.266) [-1471.789] -- 0:01:04
Average standard deviation of split frequencies: 0.020850
110500 -- (-1472.704) (-1478.052) [-1474.916] (-1476.023) * [-1476.335] (-1471.964) (-1474.498) (-1480.327) -- 0:01:04
111000 -- (-1472.686) (-1475.049) (-1476.116) [-1473.593] * (-1472.426) (-1471.392) (-1474.912) [-1472.971] -- 0:01:04
111500 -- (-1471.723) [-1475.478] (-1475.537) (-1475.127) * (-1474.235) (-1472.260) [-1475.986] (-1471.680) -- 0:01:03
112000 -- (-1474.085) [-1473.306] (-1474.774) (-1473.969) * (-1475.032) [-1469.865] (-1479.263) (-1472.350) -- 0:01:03
112500 -- (-1475.127) (-1471.520) [-1474.736] (-1473.449) * [-1471.319] (-1474.212) (-1475.930) (-1473.123) -- 0:01:03
113000 -- [-1470.703] (-1471.912) (-1472.166) (-1474.441) * [-1471.927] (-1472.694) (-1475.694) (-1472.302) -- 0:01:02
113500 -- (-1471.694) (-1473.017) (-1474.795) [-1470.296] * (-1473.930) [-1472.160] (-1473.102) (-1470.404) -- 0:01:02
114000 -- (-1472.874) (-1471.742) (-1475.273) [-1473.072] * [-1472.965] (-1473.502) (-1475.561) (-1471.607) -- 0:01:09
114500 -- (-1474.799) (-1474.785) (-1476.130) [-1474.229] * (-1473.340) (-1471.718) [-1473.087] (-1470.671) -- 0:01:09
115000 -- [-1472.900] (-1473.773) (-1477.043) (-1474.893) * (-1475.006) [-1472.314] (-1479.839) (-1471.327) -- 0:01:09
Average standard deviation of split frequencies: 0.021816
115500 -- [-1469.989] (-1472.832) (-1474.514) (-1471.610) * (-1476.252) (-1471.720) (-1475.553) [-1472.177] -- 0:01:08
116000 -- (-1470.998) [-1471.629] (-1472.957) (-1472.948) * (-1470.479) (-1472.723) (-1476.434) [-1470.023] -- 0:01:08
116500 -- (-1473.163) (-1470.724) [-1470.793] (-1475.465) * (-1475.449) (-1475.010) (-1472.428) [-1474.422] -- 0:01:08
117000 -- (-1477.357) (-1472.907) [-1471.555] (-1471.128) * (-1474.777) [-1474.465] (-1475.573) (-1474.093) -- 0:01:07
117500 -- (-1474.583) (-1473.098) (-1470.909) [-1472.297] * (-1474.777) (-1476.692) [-1473.585] (-1474.131) -- 0:01:07
118000 -- [-1473.020] (-1474.145) (-1473.490) (-1470.160) * (-1478.653) (-1471.117) [-1470.718] (-1470.468) -- 0:01:07
118500 -- (-1471.259) (-1475.424) (-1478.422) [-1472.077] * (-1478.614) (-1473.117) [-1471.046] (-1476.200) -- 0:01:06
119000 -- (-1474.726) (-1475.577) [-1471.036] (-1476.862) * (-1478.966) [-1474.445] (-1475.596) (-1473.079) -- 0:01:06
119500 -- (-1470.966) (-1473.870) (-1473.010) [-1480.547] * (-1477.532) (-1476.064) [-1475.084] (-1470.503) -- 0:01:06
120000 -- (-1473.403) (-1473.604) [-1470.125] (-1473.647) * (-1477.537) (-1471.981) [-1472.394] (-1472.970) -- 0:01:06
Average standard deviation of split frequencies: 0.023440
120500 -- (-1472.320) (-1472.569) [-1477.745] (-1472.878) * (-1473.030) [-1471.401] (-1472.332) (-1476.240) -- 0:01:05
121000 -- (-1471.090) (-1470.496) [-1473.572] (-1475.159) * (-1473.234) (-1472.579) [-1472.874] (-1473.515) -- 0:01:05
121500 -- (-1472.500) [-1472.685] (-1472.441) (-1472.065) * (-1476.182) (-1475.554) (-1473.328) [-1470.644] -- 0:01:05
122000 -- [-1469.957] (-1473.503) (-1472.846) (-1472.521) * (-1473.144) [-1470.448] (-1472.964) (-1476.021) -- 0:01:04
122500 -- (-1479.294) (-1473.349) [-1472.354] (-1474.633) * (-1474.716) [-1474.171] (-1473.275) (-1473.572) -- 0:01:04
123000 -- (-1471.847) (-1471.123) [-1472.910] (-1472.076) * (-1472.683) (-1475.305) [-1472.764] (-1473.605) -- 0:01:04
123500 -- (-1480.326) (-1473.432) [-1473.313] (-1476.007) * (-1473.300) (-1476.673) (-1471.018) [-1474.028] -- 0:01:03
124000 -- (-1472.211) [-1470.478] (-1473.750) (-1473.419) * [-1479.331] (-1475.272) (-1471.811) (-1475.990) -- 0:01:03
124500 -- (-1475.412) [-1471.142] (-1472.523) (-1471.630) * (-1477.477) [-1475.455] (-1476.881) (-1473.017) -- 0:01:03
125000 -- (-1473.436) (-1473.857) (-1473.374) [-1472.861] * (-1472.119) (-1474.668) (-1470.786) [-1474.520] -- 0:01:03
Average standard deviation of split frequencies: 0.024693
125500 -- (-1473.762) (-1472.746) [-1471.250] (-1473.663) * (-1472.800) (-1472.700) [-1472.329] (-1470.234) -- 0:01:02
126000 -- (-1475.430) (-1474.033) [-1473.850] (-1479.021) * (-1475.365) (-1471.883) (-1475.702) [-1472.303] -- 0:01:02
126500 -- (-1474.157) (-1478.802) (-1475.589) [-1473.191] * (-1473.702) (-1475.773) (-1474.102) [-1475.087] -- 0:01:02
127000 -- (-1479.125) [-1471.733] (-1473.509) (-1475.787) * (-1472.839) (-1471.241) [-1475.498] (-1474.456) -- 0:01:01
127500 -- [-1482.835] (-1475.683) (-1475.657) (-1477.508) * (-1471.892) (-1470.080) (-1470.792) [-1472.530] -- 0:01:01
128000 -- (-1474.855) [-1471.992] (-1477.931) (-1472.667) * [-1473.469] (-1473.100) (-1475.358) (-1473.977) -- 0:01:01
128500 -- (-1473.388) (-1473.546) [-1473.395] (-1474.332) * [-1470.536] (-1473.766) (-1475.604) (-1473.043) -- 0:01:01
129000 -- (-1474.189) (-1476.693) [-1473.894] (-1471.144) * (-1472.371) [-1471.297] (-1475.095) (-1472.020) -- 0:01:07
129500 -- [-1473.783] (-1474.177) (-1472.507) (-1471.248) * (-1470.893) [-1472.046] (-1476.691) (-1472.772) -- 0:01:07
130000 -- [-1470.191] (-1471.148) (-1473.162) (-1473.879) * [-1471.450] (-1472.220) (-1476.354) (-1475.862) -- 0:01:06
Average standard deviation of split frequencies: 0.023165
130500 -- [-1472.762] (-1473.927) (-1474.537) (-1475.966) * (-1472.784) (-1476.531) (-1474.984) [-1471.762] -- 0:01:06
131000 -- (-1473.193) [-1473.923] (-1472.703) (-1472.310) * [-1472.155] (-1470.943) (-1477.041) (-1472.133) -- 0:01:06
131500 -- (-1474.318) [-1473.080] (-1471.518) (-1474.678) * (-1470.504) [-1472.778] (-1475.931) (-1477.898) -- 0:01:06
132000 -- (-1474.477) [-1470.628] (-1474.590) (-1479.909) * (-1474.846) [-1470.004] (-1474.686) (-1474.172) -- 0:01:05
132500 -- (-1474.216) (-1470.731) (-1476.212) [-1472.156] * (-1472.037) (-1471.287) (-1472.590) [-1473.313] -- 0:01:05
133000 -- (-1470.760) (-1471.554) (-1471.187) [-1471.983] * (-1472.798) [-1472.915] (-1472.448) (-1471.596) -- 0:01:05
133500 -- (-1470.738) (-1468.745) (-1471.592) [-1472.281] * (-1470.896) [-1477.671] (-1474.441) (-1474.847) -- 0:01:04
134000 -- (-1473.038) (-1470.387) (-1473.689) [-1471.584] * (-1472.838) [-1469.972] (-1471.446) (-1474.297) -- 0:01:04
134500 -- [-1474.001] (-1471.101) (-1472.855) (-1471.978) * (-1471.493) [-1472.192] (-1471.569) (-1476.879) -- 0:01:04
135000 -- (-1476.622) [-1471.136] (-1471.439) (-1476.564) * (-1476.226) [-1470.290] (-1472.884) (-1471.740) -- 0:01:04
Average standard deviation of split frequencies: 0.021760
135500 -- (-1471.932) [-1470.369] (-1474.643) (-1474.292) * (-1472.311) [-1471.290] (-1475.929) (-1473.810) -- 0:01:03
136000 -- (-1477.260) [-1469.785] (-1471.914) (-1476.626) * (-1474.306) [-1470.924] (-1472.106) (-1473.399) -- 0:01:03
136500 -- (-1469.839) (-1473.070) [-1471.831] (-1475.763) * (-1473.181) [-1473.257] (-1472.253) (-1471.715) -- 0:01:03
137000 -- (-1473.239) [-1471.792] (-1471.585) (-1475.890) * (-1473.321) (-1475.349) (-1471.883) [-1471.486] -- 0:01:02
137500 -- [-1470.764] (-1474.985) (-1473.211) (-1477.153) * (-1475.721) (-1471.833) [-1470.430] (-1471.300) -- 0:01:02
138000 -- [-1473.059] (-1471.113) (-1473.356) (-1475.263) * [-1474.192] (-1471.435) (-1472.769) (-1471.538) -- 0:01:02
138500 -- (-1471.152) [-1472.410] (-1474.795) (-1472.935) * (-1478.388) (-1475.088) (-1472.919) [-1473.229] -- 0:01:02
139000 -- (-1474.702) [-1471.734] (-1475.622) (-1472.701) * (-1473.100) (-1476.016) (-1470.711) [-1472.746] -- 0:01:01
139500 -- [-1473.718] (-1470.999) (-1473.158) (-1472.024) * (-1471.938) (-1471.872) [-1472.163] (-1471.128) -- 0:01:01
140000 -- (-1476.639) (-1471.283) (-1475.971) [-1474.580] * (-1473.207) [-1475.852] (-1473.308) (-1473.289) -- 0:01:01
Average standard deviation of split frequencies: 0.024164
140500 -- (-1472.725) (-1473.020) [-1475.855] (-1476.663) * (-1472.388) (-1470.949) (-1473.174) [-1472.383] -- 0:01:01
141000 -- (-1475.366) [-1473.243] (-1474.005) (-1471.757) * (-1471.455) [-1471.985] (-1473.522) (-1474.261) -- 0:01:00
141500 -- (-1474.580) (-1470.524) [-1474.526] (-1471.890) * (-1476.928) (-1472.742) (-1475.166) [-1474.590] -- 0:01:00
142000 -- (-1471.746) [-1474.184] (-1474.688) (-1471.268) * (-1472.120) (-1475.317) [-1473.350] (-1480.556) -- 0:01:00
142500 -- (-1474.319) (-1471.330) [-1473.716] (-1476.729) * (-1479.465) (-1471.274) [-1477.237] (-1471.550) -- 0:01:00
143000 -- (-1473.246) (-1474.310) [-1471.973] (-1476.764) * (-1474.761) (-1471.463) [-1472.950] (-1473.625) -- 0:00:59
143500 -- (-1473.685) [-1472.609] (-1475.824) (-1474.389) * (-1475.326) (-1471.382) (-1474.179) [-1471.615] -- 0:01:05
144000 -- (-1473.505) (-1473.647) [-1472.973] (-1486.537) * [-1474.500] (-1471.046) (-1473.904) (-1475.113) -- 0:01:05
144500 -- (-1477.282) [-1473.243] (-1471.189) (-1482.917) * (-1474.468) (-1471.718) [-1472.887] (-1472.141) -- 0:01:05
145000 -- (-1478.736) (-1472.308) (-1471.575) [-1472.939] * (-1476.019) (-1475.954) [-1473.723] (-1474.907) -- 0:01:04
Average standard deviation of split frequencies: 0.024471
145500 -- (-1475.701) (-1475.266) (-1472.461) [-1476.448] * (-1470.249) (-1476.991) (-1474.608) [-1475.653] -- 0:01:04
146000 -- (-1475.225) (-1474.092) [-1472.553] (-1474.543) * (-1474.120) (-1475.726) (-1473.832) [-1473.806] -- 0:01:04
146500 -- (-1472.270) [-1473.427] (-1476.750) (-1473.106) * (-1472.564) [-1471.586] (-1476.227) (-1474.109) -- 0:01:04
147000 -- (-1474.604) (-1478.208) [-1474.679] (-1470.923) * (-1473.500) [-1472.087] (-1480.506) (-1474.221) -- 0:01:03
147500 -- (-1480.768) (-1472.141) [-1474.582] (-1475.233) * (-1475.297) (-1476.034) [-1476.038] (-1474.117) -- 0:01:03
148000 -- (-1473.210) [-1472.388] (-1476.425) (-1472.859) * (-1472.382) (-1473.176) (-1479.542) [-1475.633] -- 0:01:03
148500 -- (-1471.421) (-1472.766) [-1472.690] (-1472.487) * (-1474.683) [-1473.387] (-1478.549) (-1478.008) -- 0:01:03
149000 -- [-1472.315] (-1474.207) (-1472.756) (-1470.637) * (-1470.627) [-1471.517] (-1476.313) (-1479.239) -- 0:01:02
149500 -- (-1473.284) (-1475.545) [-1472.636] (-1473.666) * (-1471.897) (-1475.919) (-1474.205) [-1471.262] -- 0:01:02
150000 -- [-1472.248] (-1471.677) (-1471.066) (-1471.329) * (-1470.519) (-1478.132) [-1472.105] (-1472.652) -- 0:01:02
Average standard deviation of split frequencies: 0.023713
150500 -- (-1470.138) [-1471.717] (-1471.738) (-1471.470) * (-1476.197) (-1476.050) [-1471.808] (-1470.898) -- 0:01:02
151000 -- [-1472.608] (-1473.915) (-1473.711) (-1477.216) * [-1471.586] (-1476.597) (-1474.945) (-1470.423) -- 0:01:01
151500 -- (-1470.269) (-1474.455) (-1471.210) [-1471.409] * (-1473.445) (-1475.527) [-1472.030] (-1470.360) -- 0:01:01
152000 -- [-1471.613] (-1474.955) (-1472.490) (-1470.370) * (-1474.188) (-1475.780) (-1471.859) [-1472.687] -- 0:01:01
152500 -- (-1472.554) (-1473.561) [-1471.499] (-1471.954) * (-1472.241) (-1475.453) (-1472.608) [-1473.870] -- 0:01:01
153000 -- (-1471.775) (-1473.625) (-1475.371) [-1473.315] * (-1473.110) (-1474.451) (-1474.669) [-1471.965] -- 0:01:00
153500 -- (-1477.377) (-1474.274) (-1472.948) [-1474.946] * (-1470.504) [-1477.595] (-1475.412) (-1472.082) -- 0:01:00
154000 -- (-1472.055) (-1471.320) (-1473.920) [-1472.912] * (-1472.293) (-1475.416) [-1472.889] (-1472.293) -- 0:01:00
154500 -- (-1474.141) (-1472.814) [-1472.267] (-1472.852) * [-1473.622] (-1477.181) (-1473.630) (-1471.084) -- 0:01:00
155000 -- [-1471.448] (-1476.589) (-1474.472) (-1474.550) * [-1475.232] (-1474.918) (-1471.501) (-1472.448) -- 0:00:59
Average standard deviation of split frequencies: 0.021630
155500 -- (-1473.869) [-1475.742] (-1472.760) (-1473.340) * (-1475.916) (-1475.186) [-1472.735] (-1475.764) -- 0:00:59
156000 -- [-1472.248] (-1481.229) (-1472.692) (-1473.301) * (-1476.387) (-1474.406) [-1475.057] (-1472.606) -- 0:00:59
156500 -- (-1471.290) (-1476.235) [-1471.685] (-1471.788) * [-1475.128] (-1475.002) (-1474.542) (-1474.669) -- 0:00:59
157000 -- (-1474.849) (-1473.064) (-1472.902) [-1473.708] * (-1472.447) (-1474.758) (-1476.944) [-1473.289] -- 0:00:59
157500 -- [-1472.197] (-1474.683) (-1472.827) (-1471.913) * [-1472.425] (-1474.184) (-1477.431) (-1474.481) -- 0:00:58
158000 -- (-1473.757) (-1474.628) [-1475.122] (-1474.424) * (-1471.217) (-1473.803) (-1472.187) [-1473.495] -- 0:00:58
158500 -- [-1470.974] (-1477.120) (-1474.935) (-1472.453) * (-1475.429) (-1471.734) [-1473.229] (-1473.379) -- 0:01:03
159000 -- (-1471.311) (-1473.571) [-1473.281] (-1474.695) * (-1471.049) (-1473.828) (-1471.282) [-1475.364] -- 0:01:03
159500 -- (-1472.752) (-1479.714) [-1471.209] (-1471.603) * [-1475.986] (-1479.122) (-1471.871) (-1472.438) -- 0:01:03
160000 -- (-1473.657) (-1473.611) (-1474.192) [-1472.649] * (-1474.783) [-1474.390] (-1474.648) (-1471.625) -- 0:01:02
Average standard deviation of split frequencies: 0.021002
160500 -- (-1475.230) [-1473.432] (-1474.569) (-1471.148) * (-1473.498) (-1472.757) (-1476.214) [-1474.162] -- 0:01:02
161000 -- (-1477.212) (-1474.966) [-1472.429] (-1471.816) * (-1479.759) (-1476.474) (-1474.580) [-1476.063] -- 0:01:02
161500 -- (-1476.190) (-1472.179) (-1473.209) [-1471.082] * (-1475.419) [-1475.968] (-1473.037) (-1470.469) -- 0:01:02
162000 -- [-1475.447] (-1473.453) (-1472.117) (-1473.865) * (-1472.997) (-1479.293) (-1472.443) [-1472.188] -- 0:01:02
162500 -- (-1473.557) (-1475.570) [-1472.458] (-1478.190) * (-1471.013) (-1473.840) [-1471.494] (-1474.145) -- 0:01:01
163000 -- (-1472.784) (-1477.369) (-1471.415) [-1473.297] * [-1474.406] (-1475.922) (-1473.129) (-1473.558) -- 0:01:01
163500 -- [-1472.770] (-1474.929) (-1475.355) (-1470.711) * (-1474.383) [-1473.139] (-1470.769) (-1473.238) -- 0:01:01
164000 -- (-1472.706) (-1475.635) (-1473.884) [-1472.927] * (-1476.722) (-1475.922) [-1471.574] (-1473.914) -- 0:01:01
164500 -- [-1472.265] (-1478.713) (-1473.181) (-1471.173) * (-1473.380) (-1476.043) (-1471.499) [-1473.550] -- 0:01:00
165000 -- (-1474.662) [-1475.776] (-1474.327) (-1473.125) * [-1470.934] (-1474.959) (-1470.467) (-1474.412) -- 0:01:00
Average standard deviation of split frequencies: 0.021822
165500 -- (-1475.964) (-1474.977) [-1473.092] (-1470.699) * (-1477.004) (-1475.400) (-1470.077) [-1474.960] -- 0:01:00
166000 -- (-1474.538) [-1471.050] (-1479.736) (-1472.495) * [-1476.932] (-1476.731) (-1474.926) (-1472.256) -- 0:01:00
166500 -- (-1478.795) [-1478.803] (-1473.069) (-1471.859) * [-1474.123] (-1476.375) (-1473.235) (-1475.789) -- 0:01:00
167000 -- (-1474.444) [-1471.848] (-1471.972) (-1471.959) * (-1475.962) (-1477.608) (-1471.050) [-1477.669] -- 0:00:59
167500 -- (-1472.694) (-1475.836) [-1472.083] (-1471.901) * (-1472.621) (-1471.643) [-1471.931] (-1473.333) -- 0:00:59
168000 -- (-1473.187) (-1474.174) [-1473.573] (-1475.457) * (-1483.829) (-1472.756) [-1471.999] (-1474.110) -- 0:00:59
168500 -- [-1474.788] (-1474.417) (-1476.893) (-1478.416) * (-1473.480) (-1478.486) (-1471.560) [-1470.975] -- 0:00:59
169000 -- (-1477.217) (-1471.891) (-1473.399) [-1476.207] * [-1472.017] (-1475.323) (-1474.957) (-1481.346) -- 0:00:59
169500 -- (-1473.349) (-1474.143) [-1474.526] (-1474.932) * (-1474.384) (-1476.743) (-1471.661) [-1473.921] -- 0:00:58
170000 -- (-1473.258) (-1471.571) (-1473.892) [-1480.132] * (-1472.585) (-1473.236) [-1474.922] (-1475.904) -- 0:00:58
Average standard deviation of split frequencies: 0.022097
170500 -- (-1475.628) (-1473.978) [-1474.692] (-1479.227) * (-1475.708) [-1473.029] (-1475.837) (-1473.512) -- 0:00:58
171000 -- (-1478.280) (-1475.322) [-1470.625] (-1472.432) * (-1474.867) (-1473.814) (-1479.974) [-1473.226] -- 0:00:58
171500 -- (-1472.632) (-1477.666) (-1473.204) [-1471.938] * (-1472.837) (-1471.115) [-1473.634] (-1476.002) -- 0:00:57
172000 -- [-1471.373] (-1474.261) (-1473.210) (-1470.156) * (-1472.813) (-1472.180) [-1472.992] (-1473.852) -- 0:00:57
172500 -- (-1470.814) (-1477.754) (-1473.690) [-1474.086] * (-1472.678) (-1472.370) (-1474.831) [-1472.055] -- 0:00:57
173000 -- (-1471.161) (-1475.170) (-1472.141) [-1473.286] * (-1475.509) (-1473.102) [-1472.169] (-1470.653) -- 0:00:57
173500 -- (-1473.343) [-1472.646] (-1473.167) (-1471.336) * (-1476.242) (-1471.425) (-1471.299) [-1474.436] -- 0:01:01
174000 -- [-1471.109] (-1473.770) (-1473.875) (-1473.640) * (-1474.723) (-1475.155) [-1472.035] (-1471.788) -- 0:01:01
174500 -- [-1473.352] (-1478.701) (-1473.284) (-1472.946) * (-1471.692) (-1474.010) [-1472.703] (-1474.148) -- 0:01:01
175000 -- (-1472.206) (-1478.418) (-1471.108) [-1474.221] * (-1475.517) [-1473.307] (-1474.664) (-1473.825) -- 0:01:01
Average standard deviation of split frequencies: 0.022978
175500 -- (-1474.583) (-1477.291) (-1471.867) [-1471.817] * (-1473.991) [-1474.997] (-1473.750) (-1479.742) -- 0:01:01
176000 -- (-1471.936) (-1478.845) [-1473.617] (-1471.727) * (-1475.360) [-1473.761] (-1477.354) (-1475.384) -- 0:01:00
176500 -- (-1473.974) (-1477.219) [-1472.843] (-1471.349) * (-1471.350) [-1471.539] (-1473.605) (-1474.062) -- 0:01:00
177000 -- [-1476.874] (-1475.239) (-1471.737) (-1475.494) * (-1470.793) (-1473.838) [-1470.486] (-1473.463) -- 0:01:00
177500 -- (-1472.593) (-1472.212) (-1471.392) [-1472.475] * (-1471.842) (-1477.344) [-1470.400] (-1476.842) -- 0:01:00
178000 -- [-1470.762] (-1475.131) (-1472.751) (-1470.367) * (-1473.892) (-1475.025) [-1472.334] (-1472.704) -- 0:01:00
178500 -- (-1471.860) (-1476.327) (-1475.577) [-1472.796] * [-1470.636] (-1473.774) (-1474.908) (-1473.795) -- 0:00:59
179000 -- (-1470.454) (-1475.640) (-1476.288) [-1470.342] * [-1471.281] (-1474.387) (-1477.316) (-1480.308) -- 0:00:59
179500 -- [-1475.185] (-1475.704) (-1472.202) (-1473.975) * (-1471.459) (-1473.852) [-1472.860] (-1476.421) -- 0:00:59
180000 -- [-1474.935] (-1476.953) (-1478.150) (-1473.347) * (-1470.119) [-1472.714] (-1473.848) (-1475.785) -- 0:00:59
Average standard deviation of split frequencies: 0.020874
180500 -- (-1474.521) (-1475.823) [-1472.594] (-1471.602) * (-1474.339) [-1474.898] (-1475.283) (-1472.543) -- 0:00:59
181000 -- [-1476.709] (-1477.679) (-1473.247) (-1474.920) * (-1476.729) (-1473.404) [-1470.554] (-1476.466) -- 0:00:58
181500 -- (-1478.081) [-1474.445] (-1474.512) (-1474.760) * (-1476.058) (-1474.054) [-1469.201] (-1473.848) -- 0:00:58
182000 -- (-1472.630) (-1476.647) (-1472.535) [-1473.103] * [-1471.838] (-1470.452) (-1473.287) (-1472.876) -- 0:00:58
182500 -- (-1470.859) [-1478.105] (-1473.516) (-1472.650) * (-1478.696) (-1482.127) (-1471.281) [-1472.303] -- 0:00:58
183000 -- [-1476.092] (-1476.163) (-1473.802) (-1473.134) * [-1470.394] (-1477.426) (-1471.888) (-1477.352) -- 0:00:58
183500 -- (-1472.675) (-1476.506) (-1473.623) [-1472.143] * [-1470.144] (-1477.286) (-1472.181) (-1473.866) -- 0:00:57
184000 -- (-1478.014) (-1476.078) (-1475.650) [-1471.648] * (-1471.654) [-1470.882] (-1475.455) (-1470.749) -- 0:00:57
184500 -- (-1476.414) [-1474.874] (-1473.222) (-1475.593) * (-1474.193) (-1471.128) [-1469.914] (-1474.346) -- 0:00:57
185000 -- (-1473.457) (-1474.821) [-1471.239] (-1476.077) * [-1472.092] (-1473.204) (-1473.690) (-1471.491) -- 0:00:57
Average standard deviation of split frequencies: 0.021844
185500 -- (-1472.351) (-1472.790) (-1472.220) [-1472.791] * [-1475.240] (-1476.943) (-1473.506) (-1471.159) -- 0:00:57
186000 -- [-1471.333] (-1471.849) (-1472.449) (-1475.022) * (-1472.041) (-1479.524) [-1474.138] (-1475.175) -- 0:00:56
186500 -- (-1469.996) (-1471.249) [-1474.021] (-1473.821) * [-1469.531] (-1476.191) (-1472.026) (-1471.407) -- 0:00:56
187000 -- (-1471.886) [-1471.556] (-1473.929) (-1471.337) * [-1471.777] (-1479.090) (-1471.766) (-1473.960) -- 0:00:56
187500 -- [-1477.154] (-1472.493) (-1474.120) (-1474.852) * (-1470.041) [-1475.403] (-1475.096) (-1473.606) -- 0:00:56
188000 -- [-1477.369] (-1470.236) (-1475.924) (-1473.467) * [-1476.170] (-1475.629) (-1473.527) (-1474.131) -- 0:01:00
188500 -- (-1477.233) [-1474.385] (-1476.327) (-1476.318) * (-1470.662) (-1473.889) (-1473.560) [-1473.168] -- 0:01:00
189000 -- (-1477.976) [-1473.839] (-1474.357) (-1473.922) * (-1472.655) (-1472.503) (-1473.771) [-1471.390] -- 0:01:00
189500 -- (-1476.505) (-1474.767) (-1476.445) [-1471.681] * (-1470.146) (-1473.982) (-1471.771) [-1470.608] -- 0:00:59
190000 -- (-1473.250) [-1474.467] (-1477.364) (-1472.006) * [-1472.121] (-1472.750) (-1475.558) (-1472.798) -- 0:00:59
Average standard deviation of split frequencies: 0.022499
190500 -- (-1469.743) (-1472.263) [-1481.370] (-1473.068) * [-1472.181] (-1476.543) (-1474.125) (-1473.255) -- 0:00:59
191000 -- (-1472.536) [-1470.951] (-1475.125) (-1474.161) * (-1473.581) (-1473.225) [-1474.700] (-1475.210) -- 0:00:59
191500 -- (-1471.617) [-1472.427] (-1475.280) (-1475.924) * (-1475.485) (-1471.717) [-1472.404] (-1473.988) -- 0:00:59
192000 -- (-1473.182) [-1472.305] (-1473.993) (-1476.941) * (-1472.458) [-1472.718] (-1476.787) (-1475.227) -- 0:00:58
192500 -- (-1478.826) (-1483.336) [-1474.350] (-1476.517) * (-1477.947) (-1471.703) [-1470.910] (-1473.271) -- 0:00:58
193000 -- [-1473.646] (-1471.478) (-1472.506) (-1471.428) * (-1473.839) (-1474.609) [-1471.586] (-1473.028) -- 0:00:58
193500 -- (-1473.851) (-1474.719) (-1474.691) [-1471.431] * [-1470.606] (-1471.747) (-1472.240) (-1473.725) -- 0:00:58
194000 -- [-1480.040] (-1472.802) (-1473.741) (-1475.167) * (-1471.838) [-1473.187] (-1471.115) (-1475.699) -- 0:00:58
194500 -- [-1470.060] (-1472.876) (-1473.968) (-1476.821) * (-1471.741) (-1471.893) [-1473.433] (-1476.551) -- 0:00:57
195000 -- (-1471.098) (-1471.504) [-1474.193] (-1472.090) * (-1473.685) [-1471.580] (-1471.934) (-1475.777) -- 0:00:57
Average standard deviation of split frequencies: 0.021393
195500 -- [-1472.591] (-1478.000) (-1473.291) (-1473.503) * (-1473.152) (-1472.427) (-1472.198) [-1474.579] -- 0:00:57
196000 -- (-1471.921) (-1478.176) (-1473.395) [-1472.186] * [-1472.455] (-1470.676) (-1473.447) (-1475.287) -- 0:00:57
196500 -- (-1473.502) (-1475.492) (-1472.254) [-1476.111] * (-1474.322) [-1474.788] (-1470.733) (-1479.162) -- 0:00:57
197000 -- (-1471.597) (-1472.180) (-1473.190) [-1473.615] * (-1473.482) (-1474.801) [-1471.030] (-1478.493) -- 0:00:57
197500 -- (-1474.095) (-1472.024) [-1472.031] (-1471.104) * (-1473.243) (-1476.763) (-1471.721) [-1474.618] -- 0:00:56
198000 -- (-1474.452) (-1470.274) (-1473.043) [-1472.841] * [-1471.543] (-1472.809) (-1470.614) (-1481.341) -- 0:00:56
198500 -- (-1471.968) [-1473.748] (-1474.961) (-1471.380) * [-1471.843] (-1473.234) (-1475.546) (-1473.774) -- 0:00:56
199000 -- (-1472.208) (-1477.379) (-1473.356) [-1471.305] * (-1472.423) (-1472.202) [-1475.012] (-1473.770) -- 0:00:56
199500 -- (-1475.213) (-1475.312) [-1478.780] (-1472.623) * [-1474.154] (-1473.317) (-1481.417) (-1473.523) -- 0:00:56
200000 -- (-1476.175) (-1479.667) (-1476.691) [-1472.036] * (-1471.344) [-1472.020] (-1481.937) (-1472.891) -- 0:00:55
Average standard deviation of split frequencies: 0.020648
200500 -- [-1475.516] (-1476.288) (-1475.006) (-1472.033) * (-1475.833) [-1471.290] (-1477.849) (-1473.059) -- 0:00:55
201000 -- [-1474.152] (-1475.434) (-1473.075) (-1471.003) * (-1475.936) [-1473.201] (-1474.950) (-1474.660) -- 0:00:55
201500 -- (-1477.854) (-1475.829) [-1472.408] (-1471.603) * (-1472.858) (-1474.593) [-1471.623] (-1473.934) -- 0:00:55
202000 -- (-1477.677) (-1472.144) (-1472.042) [-1471.040] * (-1471.168) (-1479.165) [-1469.919] (-1473.563) -- 0:00:55
202500 -- (-1477.242) (-1471.472) [-1473.690] (-1471.990) * (-1476.423) (-1471.181) (-1472.694) [-1472.698] -- 0:00:55
203000 -- (-1470.949) [-1471.882] (-1472.024) (-1473.622) * (-1473.377) (-1470.862) [-1471.310] (-1470.963) -- 0:00:58
203500 -- (-1471.061) (-1473.640) [-1470.264] (-1471.449) * [-1469.399] (-1472.181) (-1473.479) (-1474.795) -- 0:00:58
204000 -- (-1476.821) (-1475.013) (-1472.170) [-1473.903] * (-1473.936) (-1475.358) (-1473.469) [-1471.796] -- 0:00:58
204500 -- (-1476.037) (-1474.422) [-1472.888] (-1473.079) * (-1474.044) [-1472.276] (-1473.105) (-1474.031) -- 0:00:58
205000 -- (-1472.496) [-1472.242] (-1473.629) (-1472.846) * (-1475.234) [-1476.310] (-1471.528) (-1473.735) -- 0:00:58
Average standard deviation of split frequencies: 0.021920
205500 -- [-1472.901] (-1471.354) (-1475.640) (-1475.005) * (-1472.503) (-1478.158) [-1472.835] (-1474.052) -- 0:00:57
206000 -- [-1472.206] (-1469.743) (-1478.600) (-1472.140) * [-1478.613] (-1473.236) (-1470.026) (-1473.428) -- 0:00:57
206500 -- (-1471.689) [-1470.946] (-1476.201) (-1475.690) * (-1474.237) (-1473.373) (-1474.966) [-1470.765] -- 0:00:57
207000 -- (-1472.911) (-1473.164) [-1473.997] (-1476.633) * [-1470.548] (-1474.018) (-1473.546) (-1470.693) -- 0:00:57
207500 -- [-1470.865] (-1473.528) (-1473.870) (-1471.076) * (-1471.193) [-1472.851] (-1472.819) (-1475.508) -- 0:00:57
208000 -- (-1473.982) (-1470.909) (-1472.984) [-1473.385] * [-1472.644] (-1476.300) (-1477.604) (-1473.437) -- 0:00:57
208500 -- (-1476.205) [-1473.434] (-1474.194) (-1477.662) * (-1478.245) (-1474.140) [-1471.832] (-1473.399) -- 0:00:56
209000 -- (-1471.186) (-1474.350) [-1472.597] (-1477.112) * (-1471.999) (-1473.941) (-1476.443) [-1474.525] -- 0:00:56
209500 -- [-1476.549] (-1476.001) (-1475.284) (-1473.914) * (-1472.071) (-1475.808) [-1470.967] (-1473.640) -- 0:00:56
210000 -- (-1475.167) (-1471.650) [-1472.342] (-1483.650) * (-1472.409) (-1477.016) [-1470.543] (-1478.600) -- 0:00:56
Average standard deviation of split frequencies: 0.019803
210500 -- (-1475.177) [-1470.916] (-1474.497) (-1476.242) * [-1474.470] (-1477.598) (-1472.436) (-1482.988) -- 0:00:56
211000 -- (-1472.966) (-1471.567) (-1474.097) [-1473.257] * [-1477.219] (-1475.733) (-1470.809) (-1476.551) -- 0:00:56
211500 -- (-1472.833) (-1473.123) (-1476.148) [-1476.193] * (-1472.121) [-1470.771] (-1471.387) (-1474.754) -- 0:00:55
212000 -- (-1475.545) (-1475.517) [-1473.168] (-1472.828) * (-1473.134) [-1471.180] (-1473.774) (-1475.236) -- 0:00:55
212500 -- (-1474.423) [-1471.112] (-1474.076) (-1470.669) * [-1470.964] (-1470.557) (-1475.935) (-1477.549) -- 0:00:55
213000 -- (-1474.415) (-1471.208) [-1472.264] (-1471.979) * (-1471.801) (-1470.344) [-1474.420] (-1476.077) -- 0:00:55
213500 -- [-1472.676] (-1472.625) (-1477.370) (-1473.879) * [-1471.736] (-1476.834) (-1471.021) (-1475.723) -- 0:00:55
214000 -- (-1476.524) [-1474.810] (-1474.304) (-1473.818) * [-1473.942] (-1471.806) (-1474.196) (-1477.286) -- 0:00:55
214500 -- (-1472.922) (-1473.463) (-1479.985) [-1472.493] * [-1475.233] (-1474.203) (-1470.414) (-1473.862) -- 0:00:54
215000 -- (-1473.117) [-1471.131] (-1477.654) (-1472.383) * (-1475.560) (-1471.072) (-1471.899) [-1476.939] -- 0:00:54
Average standard deviation of split frequencies: 0.018838
215500 -- [-1474.045] (-1476.521) (-1474.510) (-1471.330) * (-1476.648) [-1470.697] (-1473.466) (-1477.890) -- 0:00:54
216000 -- (-1473.536) [-1475.974] (-1472.384) (-1472.806) * (-1473.874) [-1474.768] (-1474.332) (-1475.826) -- 0:00:54
216500 -- (-1473.398) (-1472.261) [-1470.688] (-1475.995) * (-1471.533) (-1472.684) (-1475.650) [-1472.677] -- 0:00:54
217000 -- (-1473.013) (-1472.644) [-1472.525] (-1476.490) * (-1470.579) (-1472.567) [-1475.810] (-1470.655) -- 0:00:54
217500 -- (-1472.097) [-1471.185] (-1476.972) (-1476.943) * (-1473.231) (-1472.990) (-1475.545) [-1473.069] -- 0:00:57
218000 -- (-1473.278) [-1474.089] (-1474.324) (-1474.058) * [-1471.270] (-1472.910) (-1474.265) (-1474.107) -- 0:00:57
218500 -- (-1472.266) [-1469.952] (-1472.477) (-1473.731) * (-1475.704) (-1472.837) (-1470.086) [-1473.654] -- 0:00:57
219000 -- (-1472.118) [-1471.495] (-1475.611) (-1471.847) * (-1475.243) (-1476.977) (-1473.300) [-1477.242] -- 0:00:57
219500 -- [-1471.464] (-1475.426) (-1476.415) (-1473.657) * (-1475.786) [-1472.849] (-1471.921) (-1474.506) -- 0:00:56
220000 -- (-1470.401) [-1473.001] (-1475.817) (-1471.921) * (-1477.626) (-1471.299) (-1475.642) [-1472.018] -- 0:00:56
Average standard deviation of split frequencies: 0.017209
220500 -- (-1477.489) (-1479.376) [-1471.327] (-1472.217) * (-1472.079) [-1472.573] (-1476.784) (-1476.136) -- 0:00:56
221000 -- (-1476.588) [-1472.703] (-1470.710) (-1472.666) * (-1472.585) (-1471.684) (-1476.196) [-1475.363] -- 0:00:56
221500 -- (-1471.318) (-1474.638) [-1470.317] (-1470.443) * (-1475.431) [-1471.388] (-1477.155) (-1476.351) -- 0:00:56
222000 -- [-1471.015] (-1471.160) (-1472.738) (-1469.913) * [-1474.833] (-1472.196) (-1472.588) (-1472.680) -- 0:00:56
222500 -- (-1476.720) [-1473.937] (-1472.760) (-1471.006) * (-1470.776) (-1471.885) (-1474.886) [-1470.930] -- 0:00:55
223000 -- (-1475.180) [-1472.982] (-1473.230) (-1477.554) * (-1476.349) (-1475.759) (-1472.702) [-1471.699] -- 0:00:55
223500 -- (-1471.549) [-1473.035] (-1472.727) (-1469.562) * [-1471.711] (-1477.289) (-1473.126) (-1472.894) -- 0:00:55
224000 -- [-1474.175] (-1479.193) (-1470.328) (-1472.604) * (-1472.025) (-1476.432) [-1469.638] (-1472.822) -- 0:00:55
224500 -- (-1473.992) [-1472.540] (-1472.260) (-1472.321) * [-1475.208] (-1475.076) (-1470.999) (-1474.618) -- 0:00:55
225000 -- [-1471.999] (-1472.746) (-1473.200) (-1472.345) * (-1474.806) [-1471.516] (-1471.030) (-1473.514) -- 0:00:55
Average standard deviation of split frequencies: 0.016803
225500 -- [-1473.695] (-1471.907) (-1473.487) (-1472.562) * [-1472.155] (-1472.685) (-1472.478) (-1473.582) -- 0:00:54
226000 -- (-1471.332) (-1475.124) [-1473.200] (-1473.931) * [-1472.660] (-1477.922) (-1477.118) (-1474.815) -- 0:00:54
226500 -- (-1472.581) (-1475.095) (-1476.058) [-1470.302] * (-1473.999) (-1476.525) (-1474.396) [-1473.356] -- 0:00:54
227000 -- (-1470.882) (-1472.300) [-1477.494] (-1471.801) * (-1472.996) (-1471.737) [-1473.993] (-1471.868) -- 0:00:54
227500 -- (-1473.220) (-1472.563) [-1472.529] (-1478.905) * (-1476.611) (-1478.271) [-1473.942] (-1476.115) -- 0:00:54
228000 -- (-1473.666) (-1475.966) [-1473.483] (-1471.094) * (-1475.103) (-1477.546) [-1471.937] (-1475.937) -- 0:00:54
228500 -- [-1472.762] (-1473.982) (-1473.837) (-1472.552) * (-1471.060) (-1473.139) (-1472.627) [-1476.943] -- 0:00:54
229000 -- (-1472.939) (-1475.330) [-1473.259] (-1472.313) * (-1471.373) (-1472.705) [-1471.357] (-1479.179) -- 0:00:53
229500 -- (-1473.863) (-1474.242) (-1472.348) [-1470.105] * (-1471.777) (-1474.595) [-1477.494] (-1471.346) -- 0:00:53
230000 -- (-1471.740) (-1474.336) (-1476.437) [-1475.065] * (-1472.563) (-1472.929) (-1473.353) [-1474.774] -- 0:00:53
Average standard deviation of split frequencies: 0.015267
230500 -- (-1470.932) (-1476.463) [-1475.729] (-1473.454) * [-1476.392] (-1472.142) (-1473.198) (-1476.206) -- 0:00:53
231000 -- [-1473.964] (-1476.901) (-1475.262) (-1479.576) * [-1478.605] (-1474.290) (-1471.776) (-1472.805) -- 0:00:53
231500 -- [-1474.040] (-1475.924) (-1475.138) (-1475.449) * (-1472.688) (-1475.929) [-1469.976] (-1475.069) -- 0:00:53
232000 -- [-1472.496] (-1473.012) (-1475.327) (-1475.516) * (-1471.965) (-1474.373) [-1472.142] (-1474.539) -- 0:00:52
232500 -- (-1475.110) [-1473.809] (-1476.228) (-1474.782) * (-1474.257) (-1473.603) [-1471.236] (-1470.384) -- 0:00:56
233000 -- (-1474.234) (-1472.903) [-1473.809] (-1473.107) * (-1476.294) [-1471.106] (-1473.128) (-1469.665) -- 0:00:55
233500 -- (-1473.564) [-1473.071] (-1476.363) (-1475.974) * (-1473.381) (-1470.657) (-1478.183) [-1472.996] -- 0:00:55
234000 -- [-1471.355] (-1474.703) (-1479.690) (-1472.188) * (-1474.094) (-1472.952) [-1473.591] (-1471.900) -- 0:00:55
234500 -- (-1474.574) (-1472.781) [-1472.623] (-1472.332) * [-1474.002] (-1473.918) (-1475.473) (-1471.700) -- 0:00:55
235000 -- [-1474.063] (-1471.313) (-1472.875) (-1477.304) * (-1471.421) [-1473.570] (-1472.150) (-1472.874) -- 0:00:55
Average standard deviation of split frequencies: 0.015745
235500 -- [-1473.759] (-1471.372) (-1472.140) (-1470.550) * (-1473.599) (-1476.785) (-1471.435) [-1475.315] -- 0:00:55
236000 -- (-1471.454) [-1477.839] (-1471.911) (-1472.866) * (-1473.228) [-1471.933] (-1472.432) (-1473.619) -- 0:00:55
236500 -- (-1472.960) (-1470.791) (-1474.127) [-1472.595] * (-1474.164) (-1474.777) (-1470.349) [-1472.022] -- 0:00:54
237000 -- (-1473.336) (-1471.013) (-1471.820) [-1472.477] * (-1473.811) [-1474.790] (-1476.955) (-1475.922) -- 0:00:54
237500 -- (-1472.488) (-1469.810) [-1471.719] (-1471.891) * (-1473.351) (-1474.538) [-1474.735] (-1473.381) -- 0:00:54
238000 -- (-1473.609) (-1471.953) (-1472.041) [-1474.336] * [-1471.437] (-1476.351) (-1474.800) (-1474.048) -- 0:00:54
238500 -- (-1472.418) [-1471.061] (-1472.456) (-1475.313) * (-1474.482) (-1475.841) [-1472.448] (-1474.791) -- 0:00:54
239000 -- (-1475.375) (-1475.961) (-1471.903) [-1473.190] * (-1482.192) [-1474.973] (-1474.619) (-1475.337) -- 0:00:54
239500 -- (-1474.203) [-1469.977] (-1472.914) (-1471.110) * (-1481.588) (-1473.787) (-1473.726) [-1472.845] -- 0:00:53
240000 -- (-1475.101) [-1474.348] (-1476.778) (-1471.357) * (-1478.282) (-1474.000) [-1471.404] (-1469.865) -- 0:00:53
Average standard deviation of split frequencies: 0.015555
240500 -- (-1471.196) [-1471.266] (-1476.405) (-1472.161) * (-1473.198) (-1476.500) [-1472.686] (-1472.377) -- 0:00:53
241000 -- (-1476.160) [-1470.302] (-1474.379) (-1472.504) * (-1473.063) (-1472.581) [-1474.690] (-1470.983) -- 0:00:53
241500 -- (-1476.685) (-1474.523) (-1478.181) [-1470.335] * (-1472.924) [-1473.905] (-1475.155) (-1471.065) -- 0:00:53
242000 -- [-1471.816] (-1471.653) (-1475.633) (-1474.582) * (-1471.382) (-1475.370) (-1473.645) [-1473.482] -- 0:00:53
242500 -- (-1475.157) (-1473.829) (-1473.301) [-1474.483] * [-1473.235] (-1470.046) (-1472.527) (-1474.500) -- 0:00:53
243000 -- (-1473.595) (-1473.314) (-1471.048) [-1472.201] * (-1470.082) (-1475.120) (-1473.082) [-1473.969] -- 0:00:52
243500 -- (-1472.804) (-1474.695) (-1472.395) [-1471.882] * (-1472.576) [-1474.233] (-1476.800) (-1472.839) -- 0:00:52
244000 -- (-1478.564) [-1471.479] (-1471.245) (-1471.997) * [-1472.088] (-1475.507) (-1481.325) (-1473.972) -- 0:00:52
244500 -- (-1480.662) (-1472.411) (-1470.226) [-1472.448] * (-1479.201) (-1477.404) [-1476.915] (-1474.153) -- 0:00:52
245000 -- (-1474.220) (-1472.283) (-1473.020) [-1472.079] * (-1474.503) [-1471.304] (-1475.508) (-1473.978) -- 0:00:52
Average standard deviation of split frequencies: 0.016182
245500 -- (-1474.814) (-1473.283) (-1475.876) [-1473.316] * (-1477.136) [-1472.397] (-1484.517) (-1471.017) -- 0:00:52
246000 -- [-1473.893] (-1471.755) (-1474.030) (-1475.939) * (-1472.667) [-1473.746] (-1478.641) (-1474.764) -- 0:00:52
246500 -- [-1471.699] (-1473.699) (-1474.713) (-1478.085) * (-1472.975) [-1475.914] (-1476.981) (-1472.605) -- 0:00:51
247000 -- (-1470.551) (-1474.351) (-1471.586) [-1471.844] * [-1471.337] (-1476.333) (-1472.630) (-1473.147) -- 0:00:54
247500 -- (-1473.688) (-1472.754) (-1471.477) [-1472.020] * (-1474.659) (-1474.164) (-1469.704) [-1471.577] -- 0:00:54
248000 -- [-1473.963] (-1473.788) (-1472.299) (-1473.023) * (-1473.004) (-1475.145) (-1471.792) [-1472.160] -- 0:00:54
248500 -- (-1473.818) (-1472.266) (-1473.162) [-1470.855] * [-1475.088] (-1473.291) (-1479.058) (-1471.943) -- 0:00:54
249000 -- (-1480.348) [-1471.420] (-1474.249) (-1473.360) * (-1472.684) (-1477.058) [-1473.935] (-1471.706) -- 0:00:54
249500 -- (-1474.968) [-1470.135] (-1471.732) (-1474.125) * (-1473.087) (-1476.034) (-1474.059) [-1470.872] -- 0:00:54
250000 -- (-1472.380) (-1473.176) [-1472.805] (-1478.225) * (-1472.518) (-1475.036) (-1475.346) [-1471.837] -- 0:00:54
Average standard deviation of split frequencies: 0.014105
250500 -- (-1474.805) (-1470.336) (-1472.564) [-1474.413] * (-1472.098) (-1474.656) (-1475.598) [-1472.806] -- 0:00:53
251000 -- [-1471.652] (-1471.971) (-1474.054) (-1474.505) * [-1470.462] (-1473.981) (-1475.464) (-1472.943) -- 0:00:53
251500 -- (-1472.267) (-1478.582) [-1473.625] (-1474.151) * (-1470.792) (-1474.028) (-1476.231) [-1470.883] -- 0:00:53
252000 -- (-1472.982) [-1477.112] (-1473.597) (-1474.543) * [-1469.912] (-1475.563) (-1473.629) (-1472.966) -- 0:00:53
252500 -- (-1477.864) (-1473.037) (-1476.664) [-1474.785] * (-1475.039) (-1472.268) [-1470.368] (-1473.185) -- 0:00:53
253000 -- [-1473.772] (-1474.802) (-1473.102) (-1473.985) * (-1475.571) [-1471.881] (-1471.663) (-1472.613) -- 0:00:53
253500 -- (-1473.974) (-1473.026) [-1470.441] (-1477.021) * (-1476.051) [-1472.823] (-1472.501) (-1476.398) -- 0:00:53
254000 -- (-1475.437) (-1473.041) [-1475.281] (-1473.426) * [-1477.655] (-1472.559) (-1472.613) (-1476.242) -- 0:00:52
254500 -- (-1480.699) (-1472.164) (-1477.167) [-1471.223] * (-1474.292) (-1474.399) [-1472.578] (-1475.596) -- 0:00:52
255000 -- [-1475.798] (-1473.557) (-1473.473) (-1472.313) * [-1472.118] (-1474.596) (-1474.675) (-1477.490) -- 0:00:52
Average standard deviation of split frequencies: 0.014846
255500 -- (-1475.811) (-1472.446) [-1471.907] (-1475.036) * [-1471.983] (-1477.286) (-1472.302) (-1473.325) -- 0:00:52
256000 -- (-1478.916) (-1472.488) [-1472.114] (-1472.612) * (-1473.695) (-1479.144) (-1471.734) [-1470.866] -- 0:00:52
256500 -- (-1475.585) (-1473.887) (-1469.704) [-1472.309] * (-1471.844) [-1478.194] (-1474.075) (-1475.028) -- 0:00:52
257000 -- (-1477.205) (-1472.617) [-1473.606] (-1474.096) * (-1473.186) (-1472.973) [-1471.844] (-1476.542) -- 0:00:52
257500 -- (-1476.421) [-1475.037] (-1474.253) (-1477.598) * (-1472.685) [-1476.710] (-1472.035) (-1470.976) -- 0:00:51
258000 -- (-1477.043) (-1471.145) [-1473.014] (-1474.306) * (-1473.211) [-1473.802] (-1475.597) (-1474.082) -- 0:00:51
258500 -- [-1474.123] (-1475.227) (-1472.165) (-1473.899) * (-1474.882) (-1474.968) (-1473.119) [-1474.285] -- 0:00:51
259000 -- (-1472.493) (-1471.581) (-1475.463) [-1471.227] * [-1470.719] (-1474.231) (-1473.822) (-1471.729) -- 0:00:51
259500 -- [-1473.898] (-1471.349) (-1475.459) (-1473.679) * [-1474.273] (-1476.051) (-1476.395) (-1475.427) -- 0:00:51
260000 -- (-1473.367) (-1478.136) [-1473.421] (-1473.477) * (-1473.196) (-1477.636) (-1474.661) [-1476.928] -- 0:00:51
Average standard deviation of split frequencies: 0.013297
260500 -- (-1473.796) [-1472.139] (-1469.329) (-1477.557) * [-1471.076] (-1476.222) (-1474.772) (-1474.769) -- 0:00:51
261000 -- (-1471.040) [-1470.468] (-1470.023) (-1477.409) * (-1472.513) [-1476.733] (-1471.978) (-1474.729) -- 0:00:50
261500 -- (-1471.418) (-1471.975) [-1468.823] (-1478.531) * (-1471.482) (-1475.827) [-1474.129] (-1470.634) -- 0:00:50
262000 -- (-1473.323) [-1472.356] (-1472.646) (-1472.447) * (-1474.996) (-1476.020) [-1472.417] (-1472.988) -- 0:00:53
262500 -- (-1474.106) [-1473.287] (-1472.623) (-1474.773) * (-1474.838) (-1474.848) [-1471.909] (-1475.731) -- 0:00:53
263000 -- (-1472.119) (-1472.238) [-1473.280] (-1475.123) * (-1470.908) (-1471.528) [-1473.000] (-1474.167) -- 0:00:53
263500 -- [-1474.689] (-1473.042) (-1472.837) (-1473.370) * (-1471.772) (-1475.017) [-1471.074] (-1478.001) -- 0:00:53
264000 -- (-1475.200) [-1473.055] (-1475.975) (-1471.143) * [-1472.910] (-1473.340) (-1471.380) (-1470.897) -- 0:00:52
264500 -- (-1475.829) [-1472.500] (-1471.877) (-1470.239) * [-1474.202] (-1472.734) (-1471.162) (-1472.713) -- 0:00:52
265000 -- (-1475.930) [-1472.365] (-1473.511) (-1474.697) * (-1473.334) (-1472.723) (-1476.457) [-1471.082] -- 0:00:52
Average standard deviation of split frequencies: 0.014571
265500 -- (-1476.480) (-1471.884) [-1473.615] (-1470.612) * [-1471.190] (-1474.672) (-1474.221) (-1477.572) -- 0:00:52
266000 -- [-1474.201] (-1473.642) (-1470.634) (-1473.404) * [-1471.167] (-1477.547) (-1478.872) (-1476.532) -- 0:00:52
266500 -- (-1474.631) [-1471.895] (-1475.376) (-1475.399) * [-1472.346] (-1477.358) (-1477.601) (-1473.193) -- 0:00:52
267000 -- (-1478.986) (-1469.524) [-1473.108] (-1475.886) * (-1474.566) [-1474.729] (-1470.662) (-1472.435) -- 0:00:52
267500 -- (-1476.480) [-1472.750] (-1470.563) (-1474.857) * (-1471.484) (-1475.919) (-1471.544) [-1474.492] -- 0:00:52
268000 -- (-1474.582) [-1471.771] (-1473.997) (-1473.501) * (-1472.603) (-1474.000) (-1469.279) [-1474.521] -- 0:00:51
268500 -- (-1474.553) [-1470.244] (-1472.565) (-1473.987) * (-1474.580) (-1477.179) [-1474.652] (-1474.318) -- 0:00:51
269000 -- (-1473.541) [-1475.455] (-1471.500) (-1474.929) * (-1476.409) (-1477.462) [-1475.253] (-1475.115) -- 0:00:51
269500 -- (-1473.306) [-1473.119] (-1474.268) (-1471.754) * [-1472.455] (-1476.601) (-1474.574) (-1469.919) -- 0:00:51
270000 -- (-1472.834) (-1476.576) [-1475.739] (-1472.994) * (-1472.367) (-1476.174) [-1475.099] (-1474.356) -- 0:00:51
Average standard deviation of split frequencies: 0.015367
270500 -- [-1474.776] (-1471.108) (-1477.432) (-1470.288) * (-1473.818) (-1476.845) (-1476.684) [-1473.618] -- 0:00:51
271000 -- (-1474.285) [-1471.161] (-1472.358) (-1472.586) * (-1473.068) (-1472.919) (-1474.452) [-1471.411] -- 0:00:51
271500 -- (-1475.585) [-1472.796] (-1475.568) (-1478.307) * (-1481.439) (-1473.053) [-1471.996] (-1473.536) -- 0:00:50
272000 -- (-1471.753) [-1471.590] (-1472.413) (-1477.170) * (-1481.344) [-1472.964] (-1470.750) (-1472.504) -- 0:00:50
272500 -- (-1472.230) (-1471.483) [-1472.184] (-1474.554) * (-1471.311) [-1472.289] (-1474.288) (-1474.024) -- 0:00:50
273000 -- [-1475.468] (-1474.000) (-1475.523) (-1478.744) * [-1474.337] (-1472.394) (-1477.708) (-1470.528) -- 0:00:50
273500 -- (-1473.397) [-1473.491] (-1474.430) (-1471.809) * [-1472.698] (-1474.721) (-1473.142) (-1473.497) -- 0:00:50
274000 -- (-1472.807) (-1474.985) (-1473.503) [-1475.580] * (-1473.435) (-1474.137) (-1471.940) [-1475.890] -- 0:00:50
274500 -- [-1477.440] (-1472.136) (-1478.334) (-1473.195) * (-1470.079) [-1472.650] (-1471.726) (-1471.845) -- 0:00:50
275000 -- [-1473.023] (-1470.574) (-1472.927) (-1472.840) * [-1472.810] (-1478.145) (-1471.109) (-1476.799) -- 0:00:50
Average standard deviation of split frequencies: 0.015271
275500 -- (-1476.531) (-1473.211) (-1474.034) [-1473.172] * [-1470.495] (-1475.373) (-1471.588) (-1473.436) -- 0:00:49
276000 -- (-1471.627) (-1473.655) (-1472.977) [-1471.656] * (-1473.005) [-1480.197] (-1474.649) (-1474.036) -- 0:00:49
276500 -- (-1475.215) [-1472.173] (-1476.561) (-1471.564) * (-1475.503) (-1473.359) [-1475.417] (-1471.780) -- 0:00:49
277000 -- [-1475.282] (-1474.968) (-1477.850) (-1476.328) * (-1470.216) (-1473.835) [-1475.134] (-1471.699) -- 0:00:52
277500 -- [-1472.276] (-1472.510) (-1474.310) (-1473.830) * [-1469.930] (-1475.294) (-1472.522) (-1473.527) -- 0:00:52
278000 -- [-1474.532] (-1473.448) (-1474.917) (-1472.929) * (-1473.542) (-1473.884) (-1475.471) [-1473.888] -- 0:00:51
278500 -- (-1484.727) (-1472.176) (-1480.995) [-1473.057] * [-1471.102] (-1472.001) (-1473.892) (-1470.801) -- 0:00:51
279000 -- (-1476.866) (-1475.761) [-1471.838] (-1471.858) * (-1470.394) (-1474.177) (-1475.629) [-1469.511] -- 0:00:51
279500 -- (-1472.558) (-1473.746) (-1470.618) [-1475.509] * (-1472.713) [-1471.623] (-1471.907) (-1470.977) -- 0:00:51
280000 -- [-1473.200] (-1471.195) (-1476.979) (-1474.287) * (-1474.768) [-1474.395] (-1471.409) (-1471.116) -- 0:00:51
Average standard deviation of split frequencies: 0.015116
280500 -- (-1472.042) [-1472.491] (-1473.504) (-1473.656) * (-1472.848) (-1474.307) [-1472.859] (-1475.011) -- 0:00:51
281000 -- (-1471.642) [-1475.004] (-1472.722) (-1472.763) * (-1472.388) (-1474.748) (-1471.449) [-1477.800] -- 0:00:51
281500 -- (-1470.097) (-1473.693) [-1470.264] (-1472.659) * (-1473.141) (-1479.545) (-1472.185) [-1471.305] -- 0:00:51
282000 -- (-1475.629) [-1472.978] (-1473.539) (-1474.018) * [-1474.649] (-1482.869) (-1474.904) (-1469.876) -- 0:00:50
282500 -- (-1470.717) (-1472.044) (-1471.043) [-1474.515] * (-1473.534) [-1475.157] (-1473.467) (-1470.656) -- 0:00:50
283000 -- [-1473.381] (-1471.834) (-1470.909) (-1473.514) * [-1473.985] (-1471.277) (-1478.733) (-1475.935) -- 0:00:50
283500 -- (-1473.572) [-1471.672] (-1470.156) (-1473.383) * (-1470.834) [-1475.390] (-1474.147) (-1474.121) -- 0:00:50
284000 -- [-1469.955] (-1478.678) (-1471.072) (-1474.321) * (-1472.220) (-1472.990) (-1476.297) [-1476.025] -- 0:00:50
284500 -- [-1474.854] (-1481.112) (-1472.888) (-1473.552) * (-1472.677) (-1474.965) [-1478.624] (-1473.473) -- 0:00:50
285000 -- [-1470.873] (-1475.728) (-1473.166) (-1475.878) * (-1474.289) (-1474.181) (-1473.420) [-1472.069] -- 0:00:50
Average standard deviation of split frequencies: 0.015222
285500 -- (-1470.758) (-1474.898) [-1470.120] (-1477.470) * (-1472.896) (-1473.823) (-1472.568) [-1472.457] -- 0:00:50
286000 -- (-1473.175) (-1475.596) (-1474.467) [-1473.311] * (-1473.264) (-1475.319) [-1476.664] (-1473.715) -- 0:00:49
286500 -- (-1472.438) (-1474.196) [-1475.687] (-1475.329) * (-1474.524) [-1473.000] (-1476.225) (-1473.312) -- 0:00:49
287000 -- (-1474.659) [-1474.701] (-1475.928) (-1474.937) * [-1473.643] (-1474.759) (-1476.708) (-1474.550) -- 0:00:49
287500 -- (-1474.573) (-1475.270) [-1475.078] (-1473.853) * (-1471.810) [-1473.024] (-1479.342) (-1473.261) -- 0:00:49
288000 -- (-1471.326) (-1474.499) [-1475.995] (-1473.752) * (-1474.028) [-1475.495] (-1476.473) (-1471.076) -- 0:00:49
288500 -- (-1471.064) (-1471.578) (-1475.709) [-1471.591] * (-1473.869) (-1476.977) (-1473.612) [-1474.468] -- 0:00:49
289000 -- (-1471.267) (-1474.058) (-1477.918) [-1472.663] * (-1471.706) (-1473.659) (-1476.928) [-1474.040] -- 0:00:49
289500 -- [-1471.142] (-1472.244) (-1477.554) (-1475.556) * [-1470.758] (-1474.571) (-1477.505) (-1474.000) -- 0:00:49
290000 -- [-1471.537] (-1470.781) (-1477.381) (-1472.424) * (-1469.518) (-1475.223) [-1474.683] (-1475.679) -- 0:00:48
Average standard deviation of split frequencies: 0.013583
290500 -- [-1471.101] (-1474.060) (-1475.841) (-1476.483) * (-1469.554) (-1478.017) (-1471.470) [-1472.445] -- 0:00:48
291000 -- (-1476.708) (-1474.717) [-1474.090] (-1476.323) * [-1472.241] (-1479.223) (-1472.046) (-1475.897) -- 0:00:48
291500 -- (-1475.353) [-1474.606] (-1475.517) (-1474.631) * [-1471.035] (-1472.548) (-1475.975) (-1473.282) -- 0:00:51
292000 -- (-1472.276) [-1475.358] (-1477.442) (-1471.767) * (-1471.463) [-1473.213] (-1472.665) (-1473.353) -- 0:00:50
292500 -- [-1472.990] (-1471.434) (-1473.984) (-1473.201) * (-1473.353) (-1471.704) [-1474.460] (-1475.563) -- 0:00:50
293000 -- [-1473.039] (-1479.044) (-1473.584) (-1474.109) * (-1477.323) (-1472.478) [-1475.480] (-1476.322) -- 0:00:50
293500 -- [-1472.030] (-1471.766) (-1470.778) (-1477.769) * (-1470.326) (-1473.064) [-1475.513] (-1476.419) -- 0:00:50
294000 -- (-1472.947) (-1473.826) (-1474.373) [-1478.247] * (-1471.870) (-1471.586) (-1472.044) [-1474.383] -- 0:00:50
294500 -- [-1473.269] (-1471.493) (-1473.911) (-1477.741) * (-1472.672) (-1471.307) (-1472.252) [-1474.984] -- 0:00:50
295000 -- [-1473.856] (-1474.926) (-1472.118) (-1475.697) * [-1470.708] (-1473.062) (-1475.830) (-1471.851) -- 0:00:50
Average standard deviation of split frequencies: 0.013238
295500 -- (-1472.389) (-1470.822) (-1471.081) [-1475.859] * (-1471.254) (-1477.842) (-1472.195) [-1473.051] -- 0:00:50
296000 -- [-1472.633] (-1473.937) (-1473.069) (-1476.999) * (-1470.128) (-1473.034) [-1472.494] (-1472.672) -- 0:00:49
296500 -- (-1473.780) [-1474.196] (-1471.602) (-1479.417) * (-1474.542) (-1471.647) (-1471.566) [-1475.831] -- 0:00:49
297000 -- [-1472.871] (-1475.816) (-1470.592) (-1478.758) * (-1470.632) (-1471.006) (-1472.019) [-1473.653] -- 0:00:49
297500 -- [-1472.952] (-1477.434) (-1478.294) (-1473.056) * (-1474.496) (-1473.156) (-1473.155) [-1473.409] -- 0:00:49
298000 -- [-1475.102] (-1484.434) (-1476.846) (-1474.019) * (-1474.345) [-1472.347] (-1472.848) (-1474.278) -- 0:00:49
298500 -- (-1475.054) [-1475.339] (-1473.040) (-1474.832) * (-1471.794) (-1471.844) [-1472.796] (-1482.841) -- 0:00:49
299000 -- (-1475.030) [-1473.981] (-1472.660) (-1475.293) * [-1472.112] (-1473.292) (-1477.388) (-1472.501) -- 0:00:49
299500 -- (-1473.300) (-1472.383) (-1472.164) [-1474.191] * (-1473.611) (-1474.923) [-1474.468] (-1473.003) -- 0:00:49
300000 -- (-1475.134) (-1472.272) (-1472.531) [-1475.952] * [-1472.742] (-1477.219) (-1471.871) (-1475.621) -- 0:00:48
Average standard deviation of split frequencies: 0.012727
300500 -- (-1472.008) (-1473.747) (-1473.592) [-1470.038] * [-1469.832] (-1472.762) (-1470.416) (-1474.805) -- 0:00:48
301000 -- [-1471.264] (-1474.589) (-1472.367) (-1472.055) * (-1472.668) (-1475.128) [-1470.726] (-1474.463) -- 0:00:48
301500 -- (-1470.899) [-1471.737] (-1473.220) (-1473.472) * (-1472.838) [-1475.649] (-1474.013) (-1477.475) -- 0:00:48
302000 -- (-1472.687) [-1471.983] (-1474.248) (-1475.395) * (-1470.647) (-1475.211) (-1473.855) [-1472.315] -- 0:00:48
302500 -- (-1471.334) [-1470.515] (-1474.980) (-1478.120) * (-1473.377) (-1472.756) (-1472.082) [-1471.874] -- 0:00:48
303000 -- (-1472.912) (-1471.863) [-1472.568] (-1475.611) * (-1473.757) (-1472.717) [-1471.413] (-1473.093) -- 0:00:48
303500 -- (-1472.881) (-1472.191) (-1475.710) [-1473.564] * (-1472.614) (-1474.733) [-1473.010] (-1474.983) -- 0:00:48
304000 -- [-1473.160] (-1474.171) (-1476.818) (-1472.340) * (-1474.266) [-1475.663] (-1474.377) (-1474.099) -- 0:00:48
304500 -- (-1472.142) (-1472.628) (-1474.171) [-1473.846] * (-1474.341) (-1474.249) (-1473.946) [-1474.640] -- 0:00:47
305000 -- (-1473.040) (-1476.539) [-1473.182] (-1474.070) * [-1471.862] (-1473.372) (-1471.823) (-1475.067) -- 0:00:47
Average standard deviation of split frequencies: 0.011871
305500 -- (-1473.161) [-1471.492] (-1475.498) (-1473.421) * [-1472.569] (-1471.558) (-1473.633) (-1474.716) -- 0:00:47
306000 -- (-1474.959) [-1476.603] (-1475.707) (-1474.274) * [-1472.506] (-1473.330) (-1472.871) (-1475.908) -- 0:00:47
306500 -- (-1472.854) (-1477.071) (-1475.446) [-1476.787] * (-1474.239) (-1483.222) [-1472.389] (-1470.799) -- 0:00:49
307000 -- [-1471.781] (-1472.140) (-1473.213) (-1475.216) * (-1477.284) (-1477.927) (-1474.659) [-1474.657] -- 0:00:49
307500 -- [-1471.037] (-1472.842) (-1475.736) (-1476.916) * (-1475.736) (-1476.554) (-1471.132) [-1472.793] -- 0:00:49
308000 -- (-1473.425) (-1471.803) (-1473.060) [-1476.121] * (-1472.137) (-1476.798) (-1470.551) [-1471.160] -- 0:00:49
308500 -- (-1473.685) (-1472.145) [-1474.717] (-1476.047) * [-1473.369] (-1475.580) (-1471.726) (-1473.536) -- 0:00:49
309000 -- (-1471.951) [-1471.718] (-1478.085) (-1477.598) * [-1472.468] (-1473.211) (-1473.564) (-1474.720) -- 0:00:49
309500 -- (-1470.681) (-1478.474) (-1475.824) [-1474.174] * [-1474.031] (-1470.803) (-1473.223) (-1471.238) -- 0:00:49
310000 -- [-1475.964] (-1473.836) (-1477.089) (-1475.190) * (-1472.262) [-1470.853] (-1473.393) (-1474.982) -- 0:00:48
Average standard deviation of split frequencies: 0.011001
310500 -- (-1475.391) (-1475.870) (-1479.968) [-1473.664] * [-1473.089] (-1477.311) (-1472.854) (-1471.264) -- 0:00:48
311000 -- (-1473.993) (-1475.526) [-1475.479] (-1476.036) * (-1475.695) (-1473.398) (-1472.683) [-1472.639] -- 0:00:48
311500 -- (-1475.576) [-1473.732] (-1477.319) (-1478.971) * (-1470.550) (-1471.992) [-1473.487] (-1473.890) -- 0:00:48
312000 -- (-1473.717) (-1471.717) [-1473.107] (-1477.521) * (-1474.217) (-1470.833) (-1474.775) [-1471.592] -- 0:00:48
312500 -- (-1473.757) [-1472.586] (-1472.587) (-1474.719) * (-1471.270) (-1473.494) (-1471.423) [-1472.177] -- 0:00:48
313000 -- (-1472.957) [-1474.115] (-1472.556) (-1475.536) * (-1472.280) (-1473.061) (-1472.570) [-1473.549] -- 0:00:48
313500 -- (-1473.205) (-1474.803) [-1476.154] (-1475.434) * [-1473.938] (-1474.752) (-1473.008) (-1474.767) -- 0:00:48
314000 -- (-1474.624) (-1475.607) (-1472.188) [-1472.293] * (-1472.573) (-1473.365) (-1472.865) [-1470.837] -- 0:00:48
314500 -- (-1471.958) (-1477.255) [-1476.082] (-1473.791) * [-1472.447] (-1476.768) (-1474.221) (-1472.213) -- 0:00:47
315000 -- (-1470.559) (-1475.935) (-1475.820) [-1472.218] * (-1476.779) (-1478.008) (-1472.242) [-1473.777] -- 0:00:47
Average standard deviation of split frequencies: 0.011232
315500 -- (-1472.894) (-1479.023) [-1472.178] (-1472.699) * (-1478.638) [-1475.751] (-1473.154) (-1471.655) -- 0:00:47
316000 -- [-1471.743] (-1487.401) (-1472.894) (-1476.113) * (-1472.048) (-1481.094) (-1473.404) [-1470.325] -- 0:00:47
316500 -- [-1471.529] (-1473.447) (-1475.125) (-1476.392) * (-1475.391) (-1473.783) [-1473.574] (-1473.971) -- 0:00:47
317000 -- (-1473.581) [-1471.397] (-1476.181) (-1475.081) * (-1475.598) [-1476.271] (-1472.526) (-1475.656) -- 0:00:47
317500 -- (-1474.326) [-1475.960] (-1477.214) (-1475.415) * (-1477.159) (-1473.784) (-1473.021) [-1474.269] -- 0:00:47
318000 -- (-1471.345) (-1474.272) [-1474.544] (-1472.686) * (-1475.133) (-1476.734) [-1475.331] (-1474.062) -- 0:00:47
318500 -- [-1472.592] (-1474.732) (-1478.080) (-1475.292) * [-1471.662] (-1474.795) (-1473.059) (-1473.579) -- 0:00:47
319000 -- [-1472.475] (-1482.483) (-1479.689) (-1472.755) * [-1472.734] (-1476.099) (-1475.019) (-1474.521) -- 0:00:46
319500 -- [-1474.103] (-1480.573) (-1472.134) (-1473.227) * (-1473.335) (-1475.738) (-1477.470) [-1475.688] -- 0:00:46
320000 -- (-1482.414) (-1473.713) [-1470.824] (-1472.753) * [-1471.456] (-1471.729) (-1475.407) (-1475.190) -- 0:00:46
Average standard deviation of split frequencies: 0.011485
320500 -- (-1470.293) (-1472.839) [-1473.443] (-1472.467) * (-1473.797) [-1472.046] (-1473.291) (-1477.747) -- 0:00:46
321000 -- (-1470.208) [-1472.394] (-1478.016) (-1473.034) * (-1477.739) [-1476.396] (-1475.059) (-1477.023) -- 0:00:48
321500 -- [-1477.835] (-1474.077) (-1477.003) (-1474.557) * (-1474.638) (-1474.202) (-1472.257) [-1471.650] -- 0:00:48
322000 -- (-1478.753) (-1473.053) (-1475.065) [-1472.356] * (-1477.943) (-1474.612) [-1472.034] (-1472.445) -- 0:00:48
322500 -- (-1472.871) [-1473.207] (-1476.943) (-1475.104) * [-1475.005] (-1474.341) (-1473.221) (-1471.862) -- 0:00:48
323000 -- (-1472.202) [-1476.639] (-1473.995) (-1475.038) * [-1472.996] (-1472.238) (-1473.231) (-1476.897) -- 0:00:48
323500 -- (-1473.318) (-1474.787) [-1477.956] (-1473.020) * [-1470.555] (-1471.578) (-1474.702) (-1475.332) -- 0:00:48
324000 -- [-1475.139] (-1472.089) (-1478.292) (-1477.392) * (-1474.246) (-1478.607) [-1473.747] (-1476.557) -- 0:00:47
324500 -- (-1472.909) (-1475.206) [-1473.674] (-1476.127) * (-1474.366) (-1473.368) (-1474.326) [-1474.471] -- 0:00:47
325000 -- (-1473.986) [-1471.249] (-1473.186) (-1477.772) * (-1474.162) (-1474.691) (-1471.597) [-1471.602] -- 0:00:47
Average standard deviation of split frequencies: 0.011478
325500 -- (-1472.492) [-1470.718] (-1474.645) (-1478.066) * (-1475.271) (-1474.811) (-1474.268) [-1472.176] -- 0:00:47
326000 -- [-1474.055] (-1470.627) (-1476.838) (-1471.692) * (-1470.316) [-1473.860] (-1475.600) (-1473.883) -- 0:00:47
326500 -- (-1476.343) (-1471.715) (-1475.803) [-1474.855] * (-1472.490) [-1475.495] (-1474.739) (-1473.703) -- 0:00:47
327000 -- (-1471.502) (-1473.685) (-1472.965) [-1471.868] * (-1473.299) [-1472.322] (-1475.281) (-1473.003) -- 0:00:47
327500 -- (-1474.771) (-1476.074) [-1471.199] (-1471.766) * [-1477.150] (-1473.145) (-1475.356) (-1477.150) -- 0:00:47
328000 -- [-1472.798] (-1474.599) (-1472.211) (-1471.755) * (-1473.005) (-1472.579) (-1478.171) [-1471.817] -- 0:00:47
328500 -- (-1473.070) (-1471.989) (-1476.224) [-1471.464] * (-1472.083) (-1470.985) (-1476.297) [-1474.567] -- 0:00:47
329000 -- (-1471.860) [-1478.114] (-1475.922) (-1474.268) * (-1473.032) (-1474.709) (-1472.035) [-1472.312] -- 0:00:46
329500 -- (-1475.353) [-1473.665] (-1477.346) (-1470.803) * (-1471.080) (-1476.232) [-1472.833] (-1476.966) -- 0:00:46
330000 -- (-1477.171) (-1475.877) (-1481.085) [-1472.288] * [-1472.474] (-1474.896) (-1472.230) (-1474.901) -- 0:00:46
Average standard deviation of split frequencies: 0.011227
330500 -- [-1470.968] (-1475.032) (-1479.221) (-1472.181) * (-1473.031) (-1472.676) (-1476.340) [-1473.016] -- 0:00:46
331000 -- (-1476.968) (-1477.132) (-1472.547) [-1473.549] * (-1472.428) [-1470.202] (-1474.756) (-1478.513) -- 0:00:46
331500 -- (-1472.094) (-1473.833) (-1475.574) [-1472.936] * (-1472.928) [-1472.440] (-1474.881) (-1474.965) -- 0:00:46
332000 -- (-1471.156) (-1474.677) [-1472.959] (-1474.741) * [-1475.021] (-1478.180) (-1475.336) (-1475.002) -- 0:00:46
332500 -- [-1474.029] (-1473.823) (-1475.002) (-1473.947) * [-1472.446] (-1474.104) (-1472.941) (-1476.998) -- 0:00:46
333000 -- (-1474.808) (-1475.871) [-1472.208] (-1478.315) * (-1473.847) [-1471.256] (-1473.957) (-1474.450) -- 0:00:46
333500 -- (-1472.029) (-1473.245) [-1472.263] (-1474.366) * [-1474.969] (-1472.135) (-1473.557) (-1472.221) -- 0:00:45
334000 -- (-1476.538) (-1476.065) (-1471.061) [-1471.496] * (-1470.659) [-1471.377] (-1478.192) (-1474.155) -- 0:00:45
334500 -- [-1476.132] (-1471.996) (-1473.075) (-1477.274) * (-1471.102) (-1472.028) (-1474.601) [-1474.974] -- 0:00:45
335000 -- [-1474.864] (-1472.155) (-1472.714) (-1474.160) * (-1470.152) (-1474.214) [-1470.314] (-1473.233) -- 0:00:45
Average standard deviation of split frequencies: 0.011049
335500 -- [-1474.804] (-1472.181) (-1472.293) (-1470.293) * (-1470.185) (-1475.899) (-1469.864) [-1472.978] -- 0:00:47
336000 -- (-1473.139) [-1473.567] (-1476.449) (-1473.745) * (-1474.076) (-1472.271) [-1471.787] (-1469.368) -- 0:00:47
336500 -- (-1474.681) [-1475.617] (-1474.426) (-1472.168) * (-1470.173) [-1472.611] (-1475.303) (-1473.832) -- 0:00:47
337000 -- (-1477.583) (-1474.848) (-1475.908) [-1471.991] * (-1471.198) [-1471.875] (-1477.339) (-1476.869) -- 0:00:47
337500 -- [-1476.346] (-1471.039) (-1474.633) (-1474.001) * (-1476.602) (-1472.718) [-1472.032] (-1472.840) -- 0:00:47
338000 -- (-1472.622) [-1472.223] (-1472.332) (-1472.089) * [-1471.123] (-1474.928) (-1472.750) (-1476.542) -- 0:00:47
338500 -- (-1475.810) (-1472.763) (-1476.588) [-1474.553] * (-1475.530) [-1475.597] (-1475.077) (-1472.743) -- 0:00:46
339000 -- (-1476.557) [-1471.647] (-1475.691) (-1474.337) * (-1478.820) [-1472.509] (-1472.032) (-1476.625) -- 0:00:46
339500 -- [-1474.095] (-1470.984) (-1476.204) (-1471.705) * (-1472.311) (-1472.267) (-1473.017) [-1472.292] -- 0:00:46
340000 -- (-1472.205) [-1475.080] (-1479.501) (-1476.179) * (-1471.699) (-1476.659) (-1471.147) [-1471.830] -- 0:00:46
Average standard deviation of split frequencies: 0.011589
340500 -- (-1472.652) (-1473.825) (-1473.007) [-1472.745] * (-1472.937) [-1472.815] (-1471.690) (-1472.893) -- 0:00:46
341000 -- [-1472.058] (-1471.411) (-1473.179) (-1472.017) * (-1469.214) (-1471.036) [-1473.507] (-1473.821) -- 0:00:46
341500 -- (-1475.141) (-1475.710) [-1473.466] (-1473.291) * (-1471.633) (-1472.466) (-1472.882) [-1474.712] -- 0:00:46
342000 -- (-1479.980) [-1470.049] (-1473.841) (-1477.073) * (-1470.704) (-1471.364) [-1473.348] (-1475.703) -- 0:00:46
342500 -- (-1475.442) [-1471.253] (-1475.165) (-1473.740) * [-1472.909] (-1474.718) (-1480.655) (-1475.449) -- 0:00:46
343000 -- [-1473.308] (-1476.901) (-1473.615) (-1474.682) * (-1472.660) [-1472.553] (-1473.503) (-1472.709) -- 0:00:45
343500 -- (-1477.383) (-1480.633) (-1471.722) [-1476.402] * [-1472.577] (-1474.145) (-1471.636) (-1476.610) -- 0:00:45
344000 -- [-1474.172] (-1472.339) (-1471.643) (-1474.205) * [-1474.121] (-1472.737) (-1473.944) (-1472.753) -- 0:00:45
344500 -- [-1472.083] (-1472.308) (-1475.584) (-1474.241) * (-1473.587) [-1472.284] (-1476.388) (-1475.961) -- 0:00:45
345000 -- (-1469.786) (-1471.517) [-1473.227] (-1472.322) * [-1471.753] (-1472.200) (-1470.532) (-1473.906) -- 0:00:45
Average standard deviation of split frequencies: 0.011070
345500 -- (-1477.777) (-1471.624) (-1474.379) [-1472.610] * (-1474.505) (-1472.030) [-1473.611] (-1472.864) -- 0:00:45
346000 -- [-1472.304] (-1471.804) (-1476.161) (-1475.592) * (-1473.709) (-1472.643) [-1471.027] (-1472.710) -- 0:00:45
346500 -- (-1473.869) [-1471.505] (-1473.325) (-1474.034) * (-1472.840) (-1471.136) [-1469.702] (-1473.457) -- 0:00:45
347000 -- (-1472.225) (-1474.673) [-1475.823] (-1472.298) * (-1471.618) (-1475.697) (-1475.498) [-1472.777] -- 0:00:45
347500 -- [-1472.324] (-1473.051) (-1472.884) (-1472.386) * [-1473.518] (-1476.291) (-1472.331) (-1471.342) -- 0:00:45
348000 -- (-1470.853) (-1482.490) [-1471.238] (-1476.606) * (-1471.530) [-1471.923] (-1474.270) (-1471.800) -- 0:00:44
348500 -- [-1471.842] (-1474.912) (-1470.125) (-1471.706) * (-1474.669) (-1477.154) (-1473.298) [-1471.054] -- 0:00:44
349000 -- (-1469.588) [-1472.554] (-1476.400) (-1472.507) * (-1473.693) (-1472.271) [-1473.758] (-1473.687) -- 0:00:44
349500 -- [-1470.987] (-1471.271) (-1471.621) (-1471.991) * [-1474.888] (-1475.720) (-1473.991) (-1472.950) -- 0:00:44
350000 -- [-1471.914] (-1473.195) (-1473.779) (-1472.285) * (-1477.018) [-1474.665] (-1477.367) (-1470.632) -- 0:00:44
Average standard deviation of split frequencies: 0.011007
350500 -- (-1472.734) (-1471.705) [-1474.386] (-1470.807) * [-1473.080] (-1475.078) (-1474.090) (-1473.424) -- 0:00:46
351000 -- (-1478.725) [-1472.012] (-1473.266) (-1473.294) * (-1473.371) (-1473.394) [-1475.363] (-1474.939) -- 0:00:46
351500 -- (-1477.656) (-1472.171) (-1472.434) [-1474.322] * (-1472.663) (-1472.953) (-1479.126) [-1471.686] -- 0:00:46
352000 -- (-1473.722) (-1470.385) [-1473.886] (-1475.620) * (-1473.344) (-1473.942) [-1474.112] (-1472.419) -- 0:00:46
352500 -- (-1471.594) [-1470.113] (-1470.840) (-1474.880) * (-1471.803) [-1476.138] (-1473.467) (-1474.816) -- 0:00:45
353000 -- (-1470.656) (-1472.496) [-1470.969] (-1471.623) * (-1475.419) [-1473.307] (-1471.804) (-1477.033) -- 0:00:45
353500 -- (-1472.590) (-1473.292) [-1470.939] (-1480.664) * (-1473.417) (-1479.336) (-1473.296) [-1471.908] -- 0:00:45
354000 -- (-1471.807) (-1473.541) [-1471.625] (-1476.148) * (-1473.882) (-1474.524) [-1474.950] (-1474.360) -- 0:00:45
354500 -- (-1475.095) (-1475.950) [-1472.920] (-1472.897) * [-1473.480] (-1474.705) (-1470.760) (-1473.014) -- 0:00:45
355000 -- [-1472.714] (-1478.312) (-1478.956) (-1477.426) * [-1471.154] (-1472.351) (-1472.964) (-1473.929) -- 0:00:45
Average standard deviation of split frequencies: 0.010511
355500 -- [-1476.482] (-1476.639) (-1473.959) (-1472.920) * (-1471.770) [-1473.128] (-1477.909) (-1474.676) -- 0:00:45
356000 -- (-1471.433) (-1476.878) [-1473.903] (-1472.092) * [-1470.846] (-1474.810) (-1472.276) (-1472.852) -- 0:00:45
356500 -- (-1471.786) (-1477.207) (-1474.382) [-1472.719] * [-1474.866] (-1472.026) (-1475.816) (-1476.365) -- 0:00:45
357000 -- (-1473.515) (-1476.172) (-1472.264) [-1474.002] * [-1471.659] (-1471.920) (-1473.203) (-1479.534) -- 0:00:45
357500 -- (-1472.779) (-1476.824) (-1474.665) [-1474.405] * [-1474.124] (-1470.814) (-1470.479) (-1476.045) -- 0:00:44
358000 -- [-1471.588] (-1472.966) (-1475.194) (-1471.799) * (-1471.455) (-1475.301) (-1471.775) [-1472.334] -- 0:00:44
358500 -- [-1470.977] (-1473.133) (-1475.449) (-1475.296) * (-1475.268) [-1475.058] (-1472.790) (-1477.364) -- 0:00:44
359000 -- (-1475.458) (-1476.247) (-1475.788) [-1471.726] * (-1472.725) (-1471.760) (-1475.116) [-1475.256] -- 0:00:44
359500 -- (-1471.962) [-1473.813] (-1474.352) (-1470.156) * (-1473.470) (-1471.907) [-1474.925] (-1474.554) -- 0:00:44
360000 -- (-1470.731) (-1474.908) (-1474.343) [-1470.925] * (-1476.120) [-1470.989] (-1475.426) (-1477.653) -- 0:00:44
Average standard deviation of split frequencies: 0.009884
360500 -- (-1472.006) [-1470.522] (-1478.051) (-1472.239) * [-1473.375] (-1476.528) (-1472.607) (-1477.918) -- 0:00:44
361000 -- (-1471.165) (-1473.429) [-1475.371] (-1471.365) * (-1472.361) (-1473.326) [-1472.191] (-1482.448) -- 0:00:44
361500 -- (-1473.652) [-1474.898] (-1473.905) (-1475.385) * (-1475.778) (-1477.240) [-1472.759] (-1474.439) -- 0:00:44
362000 -- (-1472.629) (-1471.781) (-1474.549) [-1472.223] * [-1472.717] (-1473.808) (-1471.133) (-1473.529) -- 0:00:44
362500 -- (-1471.072) (-1472.655) (-1476.019) [-1475.154] * (-1474.292) [-1472.185] (-1473.244) (-1474.303) -- 0:00:43
363000 -- (-1473.325) (-1473.410) (-1476.276) [-1471.821] * (-1472.071) (-1475.779) [-1471.149] (-1474.253) -- 0:00:43
363500 -- (-1474.550) (-1473.133) [-1474.165] (-1475.883) * (-1475.554) [-1469.748] (-1474.594) (-1471.460) -- 0:00:43
364000 -- [-1471.632] (-1474.165) (-1473.695) (-1473.679) * (-1471.033) (-1473.256) [-1475.784] (-1471.687) -- 0:00:43
364500 -- (-1473.556) (-1473.325) [-1475.078] (-1478.989) * [-1472.593] (-1475.085) (-1470.807) (-1470.579) -- 0:00:43
365000 -- (-1472.294) (-1478.167) [-1472.492] (-1474.482) * (-1474.499) (-1470.276) [-1471.566] (-1476.400) -- 0:00:43
Average standard deviation of split frequencies: 0.010304
365500 -- (-1470.995) (-1475.884) (-1473.540) [-1473.310] * [-1471.795] (-1471.547) (-1472.151) (-1474.320) -- 0:00:45
366000 -- (-1473.602) (-1474.732) (-1474.704) [-1474.085] * (-1473.416) (-1471.120) [-1474.030] (-1476.121) -- 0:00:45
366500 -- (-1470.591) (-1474.907) [-1474.206] (-1473.656) * [-1470.634] (-1471.120) (-1471.883) (-1473.470) -- 0:00:44
367000 -- [-1470.963] (-1475.202) (-1473.127) (-1471.632) * [-1472.793] (-1472.134) (-1474.955) (-1472.975) -- 0:00:44
367500 -- (-1474.796) (-1474.329) (-1477.199) [-1469.985] * (-1471.458) (-1475.599) (-1474.761) [-1473.515] -- 0:00:44
368000 -- [-1473.682] (-1477.638) (-1475.531) (-1470.948) * (-1471.675) (-1472.086) [-1474.542] (-1475.103) -- 0:00:44
368500 -- (-1471.978) (-1475.865) [-1475.649] (-1471.278) * (-1472.880) (-1475.200) (-1473.093) [-1474.418] -- 0:00:44
369000 -- (-1474.501) (-1476.475) (-1477.799) [-1472.906] * [-1476.460] (-1471.685) (-1473.083) (-1473.599) -- 0:00:44
369500 -- (-1472.491) (-1475.049) (-1475.547) [-1472.688] * (-1473.791) (-1473.071) (-1470.951) [-1471.373] -- 0:00:44
370000 -- (-1473.890) [-1473.038] (-1475.674) (-1472.071) * (-1474.241) (-1471.961) (-1472.354) [-1474.183] -- 0:00:44
Average standard deviation of split frequencies: 0.009538
370500 -- (-1474.906) (-1473.439) (-1475.794) [-1472.537] * (-1473.657) (-1471.541) [-1471.076] (-1472.556) -- 0:00:44
371000 -- (-1475.861) [-1472.302] (-1476.376) (-1471.331) * (-1474.745) (-1472.785) (-1474.422) [-1472.916] -- 0:00:44
371500 -- (-1475.249) (-1472.115) [-1472.460] (-1472.136) * [-1474.477] (-1470.915) (-1477.638) (-1475.683) -- 0:00:43
372000 -- (-1474.011) [-1474.864] (-1475.941) (-1472.813) * [-1473.210] (-1473.315) (-1472.502) (-1472.488) -- 0:00:43
372500 -- (-1477.107) [-1475.950] (-1472.978) (-1471.260) * (-1473.635) [-1472.111] (-1474.982) (-1472.570) -- 0:00:43
373000 -- (-1475.436) (-1473.873) [-1475.293] (-1472.769) * (-1475.732) (-1473.703) (-1470.083) [-1474.077] -- 0:00:43
373500 -- (-1474.059) (-1475.740) [-1475.378] (-1473.952) * (-1476.015) [-1473.124] (-1475.220) (-1472.328) -- 0:00:43
374000 -- (-1471.051) (-1476.922) [-1474.272] (-1475.613) * (-1475.211) [-1472.014] (-1472.257) (-1469.649) -- 0:00:43
374500 -- (-1474.341) [-1479.103] (-1478.313) (-1472.613) * (-1473.530) (-1478.791) (-1473.337) [-1472.925] -- 0:00:43
375000 -- (-1471.546) (-1479.068) (-1475.058) [-1469.852] * (-1473.319) (-1473.496) [-1471.217] (-1472.231) -- 0:00:43
Average standard deviation of split frequencies: 0.009011
375500 -- [-1472.987] (-1475.635) (-1475.350) (-1472.169) * (-1473.278) [-1475.855] (-1471.794) (-1473.524) -- 0:00:43
376000 -- (-1471.522) (-1479.065) (-1470.551) [-1473.818] * (-1472.640) [-1476.207] (-1471.729) (-1476.975) -- 0:00:43
376500 -- [-1473.694] (-1477.714) (-1474.723) (-1471.801) * (-1472.556) [-1476.950] (-1474.113) (-1474.824) -- 0:00:43
377000 -- [-1473.736] (-1474.663) (-1472.600) (-1472.531) * (-1473.989) [-1474.152] (-1474.218) (-1471.761) -- 0:00:42
377500 -- [-1472.495] (-1476.206) (-1476.285) (-1475.914) * (-1472.642) (-1470.598) [-1470.648] (-1476.890) -- 0:00:42
378000 -- (-1471.024) (-1476.121) (-1472.612) [-1470.489] * (-1477.978) [-1476.066] (-1471.761) (-1476.819) -- 0:00:42
378500 -- [-1470.855] (-1475.599) (-1473.315) (-1476.445) * (-1471.737) (-1475.356) [-1473.116] (-1472.105) -- 0:00:42
379000 -- [-1473.345] (-1475.120) (-1477.906) (-1473.594) * (-1475.528) (-1474.668) [-1473.177] (-1474.417) -- 0:00:42
379500 -- [-1475.535] (-1472.022) (-1474.252) (-1473.343) * (-1481.139) (-1471.614) (-1476.671) [-1471.055] -- 0:00:42
380000 -- (-1471.727) (-1472.073) [-1471.540] (-1471.343) * (-1478.158) (-1473.217) (-1476.381) [-1473.850] -- 0:00:42
Average standard deviation of split frequencies: 0.008436
380500 -- (-1474.886) (-1474.480) [-1474.239] (-1471.030) * (-1469.961) (-1473.821) (-1470.803) [-1471.912] -- 0:00:43
381000 -- [-1472.665] (-1475.125) (-1471.699) (-1474.273) * (-1469.937) [-1475.642] (-1476.683) (-1475.781) -- 0:00:43
381500 -- [-1470.768] (-1475.466) (-1471.720) (-1474.423) * (-1470.721) (-1472.925) (-1471.526) [-1474.782] -- 0:00:43
382000 -- (-1471.932) (-1475.143) [-1472.851] (-1473.695) * (-1475.703) [-1470.098] (-1472.514) (-1474.677) -- 0:00:43
382500 -- (-1473.970) [-1474.585] (-1472.131) (-1472.063) * (-1473.152) [-1472.790] (-1473.474) (-1472.576) -- 0:00:43
383000 -- (-1474.507) [-1476.728] (-1475.698) (-1472.536) * (-1473.548) [-1470.249] (-1473.380) (-1470.868) -- 0:00:43
383500 -- [-1476.927] (-1473.578) (-1477.298) (-1472.796) * (-1479.655) (-1474.774) (-1473.814) [-1471.455] -- 0:00:43
384000 -- (-1472.687) (-1473.017) (-1476.472) [-1473.588] * (-1475.358) (-1475.700) (-1476.800) [-1474.875] -- 0:00:43
384500 -- (-1473.192) [-1471.456] (-1474.612) (-1474.408) * (-1475.117) [-1471.694] (-1476.928) (-1474.221) -- 0:00:43
385000 -- [-1476.126] (-1472.188) (-1475.844) (-1474.984) * (-1473.727) (-1471.260) (-1474.379) [-1471.947] -- 0:00:43
Average standard deviation of split frequencies: 0.008854
385500 -- [-1476.571] (-1475.952) (-1473.096) (-1472.307) * (-1472.607) (-1471.994) (-1472.467) [-1472.783] -- 0:00:43
386000 -- (-1476.455) (-1475.570) [-1473.845] (-1472.935) * [-1472.509] (-1474.118) (-1473.645) (-1473.853) -- 0:00:42
386500 -- [-1472.094] (-1475.564) (-1474.393) (-1473.389) * (-1473.979) (-1476.881) [-1473.049] (-1473.947) -- 0:00:42
387000 -- [-1471.173] (-1477.405) (-1472.784) (-1475.688) * (-1473.706) (-1474.748) (-1476.542) [-1473.843] -- 0:00:42
387500 -- (-1476.032) (-1474.578) (-1470.806) [-1473.930] * (-1474.530) (-1473.759) (-1478.388) [-1470.842] -- 0:00:42
388000 -- (-1471.205) (-1472.981) [-1476.620] (-1475.688) * (-1473.043) [-1474.748] (-1474.281) (-1470.348) -- 0:00:42
388500 -- [-1471.176] (-1475.803) (-1480.151) (-1472.928) * (-1473.733) [-1471.752] (-1471.223) (-1473.107) -- 0:00:42
389000 -- [-1470.708] (-1477.050) (-1474.318) (-1475.424) * (-1471.544) (-1472.146) [-1470.646] (-1473.432) -- 0:00:42
389500 -- (-1475.399) (-1478.127) [-1471.558] (-1473.463) * [-1473.340] (-1478.081) (-1475.324) (-1475.722) -- 0:00:42
390000 -- (-1474.574) (-1478.278) [-1477.576] (-1473.768) * (-1471.672) (-1475.628) (-1472.712) [-1477.322] -- 0:00:42
Average standard deviation of split frequencies: 0.008371
390500 -- (-1473.962) (-1476.399) [-1471.310] (-1475.049) * (-1473.193) (-1472.294) (-1471.100) [-1478.794] -- 0:00:42
391000 -- (-1474.141) (-1473.817) [-1473.172] (-1474.036) * [-1471.525] (-1472.226) (-1472.792) (-1478.124) -- 0:00:42
391500 -- (-1470.570) (-1474.610) [-1472.525] (-1474.044) * (-1472.460) (-1471.673) [-1471.591] (-1473.463) -- 0:00:41
392000 -- [-1471.928] (-1474.851) (-1475.181) (-1475.976) * (-1472.851) [-1473.264] (-1473.782) (-1472.757) -- 0:00:41
392500 -- [-1474.256] (-1473.561) (-1475.632) (-1476.761) * [-1471.841] (-1472.578) (-1473.041) (-1472.723) -- 0:00:41
393000 -- (-1472.428) [-1474.441] (-1473.298) (-1476.920) * (-1472.440) (-1472.212) [-1471.483] (-1474.016) -- 0:00:41
393500 -- (-1476.006) [-1473.933] (-1476.232) (-1471.908) * (-1474.413) (-1472.011) (-1471.031) [-1476.301] -- 0:00:41
394000 -- (-1473.411) (-1475.501) (-1481.229) [-1474.285] * (-1472.070) [-1472.064] (-1471.296) (-1471.564) -- 0:00:41
394500 -- (-1474.013) (-1475.947) (-1478.498) [-1476.039] * (-1475.965) [-1472.136] (-1473.361) (-1470.119) -- 0:00:41
395000 -- (-1472.059) (-1472.211) [-1474.096] (-1473.497) * (-1471.862) (-1473.121) [-1472.252] (-1475.180) -- 0:00:42
Average standard deviation of split frequencies: 0.008015
395500 -- [-1471.623] (-1473.388) (-1473.484) (-1475.669) * (-1472.617) (-1476.254) [-1471.877] (-1477.317) -- 0:00:42
396000 -- (-1476.621) (-1474.737) [-1473.067] (-1476.985) * [-1471.992] (-1479.536) (-1475.259) (-1472.258) -- 0:00:42
396500 -- (-1472.174) (-1476.060) [-1470.283] (-1473.101) * (-1472.758) (-1477.354) (-1474.179) [-1473.414] -- 0:00:42
397000 -- (-1472.596) [-1471.395] (-1473.292) (-1469.683) * [-1475.552] (-1476.825) (-1475.249) (-1472.058) -- 0:00:42
397500 -- (-1478.917) (-1473.276) [-1474.084] (-1475.441) * (-1474.825) [-1476.936] (-1478.976) (-1472.744) -- 0:00:42
398000 -- (-1474.842) (-1475.265) [-1471.862] (-1471.244) * [-1473.572] (-1474.522) (-1472.076) (-1471.081) -- 0:00:42
398500 -- (-1472.384) [-1474.764] (-1474.884) (-1475.363) * (-1474.360) (-1472.619) [-1472.432] (-1474.857) -- 0:00:42
399000 -- (-1472.148) (-1477.831) [-1479.196] (-1475.347) * [-1472.625] (-1473.189) (-1472.513) (-1472.127) -- 0:00:42
399500 -- [-1475.622] (-1473.416) (-1472.752) (-1472.949) * [-1471.988] (-1474.751) (-1475.012) (-1470.943) -- 0:00:42
400000 -- (-1475.619) (-1471.144) (-1475.941) [-1474.323] * (-1472.280) (-1472.051) [-1473.989] (-1470.663) -- 0:00:41
Average standard deviation of split frequencies: 0.009412
400500 -- (-1473.356) (-1472.760) [-1472.489] (-1472.311) * (-1475.362) (-1472.008) [-1472.355] (-1471.669) -- 0:00:41
401000 -- (-1473.608) [-1472.097] (-1474.344) (-1472.034) * (-1471.164) [-1472.772] (-1472.904) (-1471.789) -- 0:00:41
401500 -- (-1475.849) [-1471.906] (-1474.372) (-1472.739) * (-1472.911) [-1471.001] (-1474.719) (-1477.292) -- 0:00:41
402000 -- (-1474.929) [-1470.540] (-1476.002) (-1472.708) * (-1474.235) (-1470.998) (-1471.401) [-1470.960] -- 0:00:41
402500 -- (-1478.326) (-1472.907) (-1477.174) [-1476.235] * (-1475.336) (-1469.746) [-1471.685] (-1472.167) -- 0:00:41
403000 -- (-1474.156) (-1470.708) [-1475.949] (-1471.695) * (-1475.964) [-1472.042] (-1475.001) (-1474.970) -- 0:00:41
403500 -- [-1472.947] (-1471.675) (-1475.759) (-1474.615) * [-1476.055] (-1474.194) (-1477.304) (-1471.881) -- 0:00:41
404000 -- (-1472.771) [-1473.773] (-1477.372) (-1470.836) * (-1475.466) (-1474.426) [-1477.038] (-1475.322) -- 0:00:41
404500 -- [-1472.073] (-1474.218) (-1477.465) (-1473.474) * (-1476.129) (-1477.496) [-1471.573] (-1473.643) -- 0:00:41
405000 -- [-1471.827] (-1481.916) (-1472.879) (-1475.580) * (-1477.400) (-1482.562) (-1476.796) [-1474.097] -- 0:00:41
Average standard deviation of split frequencies: 0.009211
405500 -- [-1471.233] (-1472.779) (-1471.988) (-1472.068) * (-1472.163) (-1473.767) (-1475.358) [-1472.716] -- 0:00:41
406000 -- [-1472.000] (-1473.784) (-1479.654) (-1475.802) * (-1473.624) (-1476.555) (-1476.023) [-1470.511] -- 0:00:40
406500 -- [-1473.543] (-1471.870) (-1473.530) (-1471.983) * (-1474.061) (-1476.570) (-1474.785) [-1476.192] -- 0:00:40
407000 -- (-1476.931) [-1474.778] (-1476.837) (-1471.273) * (-1474.382) (-1476.543) [-1472.286] (-1475.979) -- 0:00:40
407500 -- (-1478.318) (-1472.839) (-1473.011) [-1472.261] * (-1473.313) [-1474.173] (-1476.720) (-1475.204) -- 0:00:40
408000 -- [-1474.019] (-1471.682) (-1475.796) (-1471.463) * (-1473.312) (-1469.298) [-1475.671] (-1475.359) -- 0:00:40
408500 -- [-1471.577] (-1473.766) (-1474.037) (-1472.327) * [-1473.712] (-1470.279) (-1476.293) (-1476.703) -- 0:00:40
409000 -- [-1472.618] (-1473.864) (-1470.696) (-1472.001) * (-1475.897) (-1474.129) [-1476.686] (-1478.017) -- 0:00:40
409500 -- (-1472.963) (-1471.867) (-1472.695) [-1475.693] * [-1478.817] (-1475.649) (-1474.456) (-1477.691) -- 0:00:40
410000 -- (-1473.193) [-1472.115] (-1471.896) (-1470.979) * (-1475.063) (-1473.068) (-1476.168) [-1474.911] -- 0:00:41
Average standard deviation of split frequencies: 0.009872
410500 -- (-1473.156) (-1472.040) [-1472.357] (-1473.309) * (-1471.071) [-1470.277] (-1475.965) (-1472.904) -- 0:00:41
411000 -- (-1473.312) [-1473.340] (-1472.265) (-1474.138) * [-1475.964] (-1471.879) (-1473.473) (-1482.309) -- 0:00:41
411500 -- (-1473.712) (-1474.968) [-1478.071] (-1473.731) * (-1475.410) (-1469.998) [-1479.655] (-1474.735) -- 0:00:41
412000 -- [-1474.646] (-1477.090) (-1471.944) (-1477.027) * (-1474.548) (-1471.249) [-1472.959] (-1471.391) -- 0:00:41
412500 -- (-1476.215) (-1473.091) (-1472.119) [-1476.297] * (-1473.742) [-1472.133] (-1475.844) (-1475.630) -- 0:00:41
413000 -- [-1472.552] (-1479.343) (-1470.384) (-1475.487) * (-1472.703) (-1473.384) [-1476.480] (-1476.432) -- 0:00:41
413500 -- (-1475.810) (-1475.694) (-1472.785) [-1471.537] * [-1475.514] (-1471.796) (-1476.568) (-1473.692) -- 0:00:41
414000 -- (-1471.533) [-1475.119] (-1474.651) (-1471.931) * [-1472.464] (-1473.449) (-1476.226) (-1475.593) -- 0:00:41
414500 -- (-1472.138) (-1473.518) [-1472.499] (-1472.895) * (-1479.889) [-1474.547] (-1473.462) (-1473.716) -- 0:00:40
415000 -- (-1472.606) [-1476.821] (-1471.935) (-1471.132) * (-1473.260) (-1472.333) [-1476.735] (-1475.999) -- 0:00:40
Average standard deviation of split frequencies: 0.008914
415500 -- [-1473.052] (-1473.779) (-1472.677) (-1474.328) * (-1471.092) (-1477.631) (-1474.075) [-1471.695] -- 0:00:40
416000 -- (-1472.031) [-1474.968] (-1477.058) (-1473.695) * (-1473.383) (-1476.784) (-1475.122) [-1471.558] -- 0:00:40
416500 -- (-1471.968) (-1477.187) [-1472.028] (-1475.490) * (-1472.538) [-1476.088] (-1472.063) (-1476.033) -- 0:00:40
417000 -- (-1472.723) (-1479.585) [-1471.337] (-1476.922) * [-1472.791] (-1472.122) (-1476.359) (-1473.821) -- 0:00:40
417500 -- (-1475.010) (-1473.743) [-1472.478] (-1474.931) * [-1472.200] (-1471.616) (-1471.735) (-1478.485) -- 0:00:40
418000 -- (-1470.881) [-1473.615] (-1475.184) (-1471.956) * (-1473.258) [-1473.402] (-1471.447) (-1473.792) -- 0:00:40
418500 -- (-1468.686) [-1470.904] (-1474.887) (-1474.489) * [-1472.859] (-1474.330) (-1475.179) (-1474.526) -- 0:00:40
419000 -- [-1476.576] (-1472.783) (-1474.314) (-1473.316) * (-1473.210) [-1471.948] (-1471.990) (-1471.868) -- 0:00:40
419500 -- (-1475.588) [-1477.886] (-1470.673) (-1472.556) * [-1473.770] (-1472.791) (-1476.100) (-1473.007) -- 0:00:40
420000 -- [-1471.198] (-1473.979) (-1471.615) (-1472.817) * (-1473.357) (-1476.721) (-1477.788) [-1472.150] -- 0:00:40
Average standard deviation of split frequencies: 0.009040
420500 -- (-1472.324) (-1470.401) [-1475.307] (-1472.246) * (-1477.333) (-1475.321) (-1471.827) [-1471.669] -- 0:00:39
421000 -- [-1469.237] (-1473.273) (-1479.314) (-1472.343) * (-1471.397) (-1471.982) [-1472.168] (-1470.375) -- 0:00:39
421500 -- (-1472.198) (-1475.934) (-1472.676) [-1472.048] * (-1474.764) (-1472.586) (-1480.738) [-1470.865] -- 0:00:39
422000 -- [-1471.292] (-1474.415) (-1474.741) (-1473.365) * (-1474.747) (-1474.885) [-1474.145] (-1475.885) -- 0:00:39
422500 -- (-1472.695) [-1472.987] (-1476.928) (-1471.149) * (-1475.445) (-1474.014) [-1478.372] (-1475.356) -- 0:00:39
423000 -- [-1474.262] (-1471.049) (-1473.811) (-1470.447) * [-1475.482] (-1472.112) (-1477.442) (-1473.258) -- 0:00:39
423500 -- (-1474.536) [-1474.036] (-1473.737) (-1478.862) * (-1476.273) [-1472.412] (-1478.994) (-1471.762) -- 0:00:39
424000 -- [-1474.508] (-1473.771) (-1470.469) (-1475.893) * (-1475.476) (-1471.339) (-1475.979) [-1470.869] -- 0:00:39
424500 -- [-1471.527] (-1474.089) (-1474.095) (-1473.356) * (-1472.839) [-1471.542] (-1473.511) (-1474.459) -- 0:00:39
425000 -- (-1477.253) (-1472.596) [-1472.681] (-1474.445) * [-1470.375] (-1472.250) (-1473.682) (-1474.690) -- 0:00:40
Average standard deviation of split frequencies: 0.008705
425500 -- (-1475.295) (-1471.752) [-1474.703] (-1470.916) * (-1472.824) [-1473.566] (-1471.149) (-1472.322) -- 0:00:40
426000 -- (-1471.007) (-1471.806) [-1477.454] (-1470.726) * (-1474.696) (-1474.689) [-1472.122] (-1476.098) -- 0:00:40
426500 -- [-1476.557] (-1475.224) (-1474.571) (-1471.350) * (-1476.792) [-1470.824] (-1471.194) (-1471.711) -- 0:00:40
427000 -- (-1473.512) (-1474.954) [-1476.053] (-1473.938) * [-1475.939] (-1473.128) (-1473.199) (-1473.914) -- 0:00:40
427500 -- (-1472.053) (-1472.292) (-1473.243) [-1471.925] * (-1476.297) (-1473.638) (-1475.640) [-1477.660] -- 0:00:40
428000 -- (-1475.326) (-1473.725) [-1471.034] (-1477.595) * (-1478.749) (-1473.346) (-1473.889) [-1472.457] -- 0:00:40
428500 -- (-1474.396) (-1472.897) [-1471.684] (-1475.224) * (-1470.092) (-1474.392) (-1471.866) [-1471.678] -- 0:00:40
429000 -- (-1473.598) (-1474.728) (-1472.326) [-1474.658] * [-1471.346] (-1469.759) (-1475.188) (-1472.194) -- 0:00:39
429500 -- [-1471.797] (-1472.692) (-1476.764) (-1475.121) * (-1473.058) [-1472.290] (-1475.990) (-1472.284) -- 0:00:39
430000 -- [-1473.027] (-1475.225) (-1476.414) (-1471.091) * (-1469.609) (-1473.675) (-1480.806) [-1473.543] -- 0:00:39
Average standard deviation of split frequencies: 0.008684
430500 -- (-1475.469) (-1473.380) (-1477.171) [-1472.673] * [-1469.930] (-1476.095) (-1476.053) (-1473.319) -- 0:00:39
431000 -- (-1475.940) [-1474.280] (-1481.573) (-1472.201) * (-1469.901) (-1481.628) [-1471.480] (-1471.563) -- 0:00:39
431500 -- (-1474.733) [-1473.760] (-1478.914) (-1471.093) * (-1472.738) (-1473.075) (-1473.481) [-1476.147] -- 0:00:39
432000 -- (-1475.774) [-1473.608] (-1476.954) (-1472.878) * (-1474.394) (-1477.041) (-1476.600) [-1472.279] -- 0:00:39
432500 -- (-1472.278) (-1477.375) [-1471.848] (-1471.989) * (-1472.140) (-1476.809) [-1471.682] (-1469.538) -- 0:00:39
433000 -- [-1472.426] (-1478.165) (-1480.558) (-1472.044) * (-1471.395) (-1476.174) (-1472.392) [-1475.220] -- 0:00:39
433500 -- (-1476.600) (-1476.637) (-1472.525) [-1470.216] * (-1474.747) [-1475.603] (-1479.602) (-1473.350) -- 0:00:39
434000 -- (-1472.466) (-1476.977) (-1476.884) [-1471.036] * (-1473.223) (-1472.460) [-1471.699] (-1474.460) -- 0:00:39
434500 -- (-1474.113) [-1472.026] (-1476.192) (-1470.852) * (-1472.080) (-1473.349) (-1471.775) [-1470.972] -- 0:00:39
435000 -- (-1472.976) (-1473.667) (-1475.156) [-1471.542] * (-1473.506) (-1472.941) (-1472.096) [-1470.022] -- 0:00:38
Average standard deviation of split frequencies: 0.009082
435500 -- (-1471.743) (-1474.944) [-1472.706] (-1470.049) * (-1474.062) [-1477.552] (-1471.734) (-1476.305) -- 0:00:38
436000 -- (-1471.296) (-1474.963) (-1473.945) [-1471.079] * (-1471.731) (-1477.458) (-1470.537) [-1474.285] -- 0:00:38
436500 -- [-1473.199] (-1473.230) (-1473.597) (-1470.675) * (-1476.988) [-1475.252] (-1474.606) (-1473.585) -- 0:00:38
437000 -- (-1474.131) [-1471.603] (-1473.740) (-1471.243) * (-1472.656) [-1471.884] (-1474.310) (-1472.908) -- 0:00:38
437500 -- (-1474.572) [-1469.187] (-1472.093) (-1471.312) * (-1473.892) (-1473.422) [-1470.243] (-1473.770) -- 0:00:38
438000 -- (-1473.310) (-1469.990) (-1472.019) [-1474.659] * (-1471.426) (-1473.688) (-1478.129) [-1472.288] -- 0:00:38
438500 -- (-1475.228) (-1469.783) (-1473.870) [-1471.441] * (-1471.412) (-1474.408) (-1472.771) [-1471.051] -- 0:00:38
439000 -- [-1472.357] (-1474.359) (-1472.926) (-1473.001) * (-1471.131) (-1473.553) [-1472.733] (-1474.678) -- 0:00:38
439500 -- (-1473.250) [-1474.685] (-1474.586) (-1474.117) * [-1470.682] (-1472.210) (-1474.524) (-1472.496) -- 0:00:39
440000 -- (-1474.498) [-1477.275] (-1475.098) (-1471.200) * [-1471.653] (-1471.499) (-1476.678) (-1473.383) -- 0:00:39
Average standard deviation of split frequencies: 0.009414
440500 -- (-1474.390) (-1470.973) (-1477.580) [-1470.948] * (-1472.856) (-1475.251) [-1474.186] (-1474.203) -- 0:00:39
441000 -- [-1477.100] (-1476.618) (-1474.881) (-1471.803) * [-1472.694] (-1472.116) (-1475.455) (-1472.867) -- 0:00:39
441500 -- (-1476.044) (-1472.867) [-1472.764] (-1471.448) * (-1476.612) (-1472.387) [-1472.414] (-1473.041) -- 0:00:39
442000 -- (-1474.288) (-1472.384) [-1475.503] (-1470.683) * (-1471.190) (-1474.497) (-1472.831) [-1471.568] -- 0:00:39
442500 -- (-1474.850) (-1475.057) (-1473.875) [-1472.001] * (-1471.632) (-1473.962) (-1475.187) [-1470.993] -- 0:00:39
443000 -- (-1473.148) [-1472.100] (-1473.154) (-1472.007) * (-1476.610) (-1475.995) [-1470.559] (-1469.827) -- 0:00:38
443500 -- (-1475.533) (-1476.888) (-1472.982) [-1471.736] * (-1473.963) [-1472.159] (-1470.475) (-1472.978) -- 0:00:38
444000 -- (-1472.501) (-1476.595) [-1473.781] (-1472.679) * (-1474.122) (-1472.667) (-1475.152) [-1474.376] -- 0:00:38
444500 -- (-1475.451) (-1473.206) (-1475.316) [-1473.738] * (-1477.798) [-1472.712] (-1475.730) (-1476.052) -- 0:00:38
445000 -- (-1474.729) (-1472.810) (-1474.954) [-1472.656] * [-1473.972] (-1475.990) (-1474.744) (-1474.112) -- 0:00:38
Average standard deviation of split frequencies: 0.009090
445500 -- (-1475.080) [-1470.494] (-1475.344) (-1473.260) * [-1470.080] (-1474.246) (-1475.360) (-1472.944) -- 0:00:38
446000 -- (-1472.770) [-1475.598] (-1472.423) (-1476.044) * [-1470.380] (-1476.224) (-1475.475) (-1470.539) -- 0:00:38
446500 -- (-1474.129) (-1475.785) [-1472.659] (-1473.402) * (-1472.342) (-1473.825) (-1471.345) [-1471.736] -- 0:00:38
447000 -- (-1474.635) (-1471.595) (-1471.509) [-1471.058] * (-1472.463) (-1471.151) [-1473.437] (-1474.868) -- 0:00:38
447500 -- (-1475.663) [-1474.487] (-1473.817) (-1471.395) * (-1476.638) (-1474.585) [-1472.849] (-1474.826) -- 0:00:38
448000 -- (-1473.154) (-1474.090) [-1473.392] (-1470.813) * (-1476.815) (-1476.439) [-1473.686] (-1471.539) -- 0:00:38
448500 -- (-1475.413) [-1473.749] (-1475.127) (-1473.396) * (-1477.683) [-1474.188] (-1475.252) (-1472.764) -- 0:00:38
449000 -- (-1473.924) [-1475.225] (-1475.125) (-1470.170) * (-1473.558) (-1472.709) [-1475.868] (-1472.539) -- 0:00:38
449500 -- [-1472.497] (-1479.066) (-1474.309) (-1472.736) * [-1470.308] (-1473.386) (-1475.631) (-1470.392) -- 0:00:37
450000 -- (-1474.859) (-1472.943) (-1480.139) [-1473.910] * [-1472.503] (-1473.819) (-1480.416) (-1471.459) -- 0:00:37
Average standard deviation of split frequencies: 0.008438
450500 -- (-1471.906) [-1471.322] (-1475.161) (-1473.233) * (-1471.398) (-1476.351) (-1479.963) [-1473.860] -- 0:00:37
451000 -- (-1472.799) (-1472.714) (-1474.533) [-1470.580] * (-1470.505) [-1473.725] (-1479.831) (-1472.973) -- 0:00:37
451500 -- [-1474.849] (-1476.509) (-1472.782) (-1470.533) * (-1471.541) [-1471.268] (-1479.442) (-1475.638) -- 0:00:37
452000 -- (-1471.115) (-1473.692) [-1474.141] (-1473.519) * (-1472.108) (-1471.115) (-1476.860) [-1471.299] -- 0:00:37
452500 -- (-1473.350) (-1477.618) [-1474.607] (-1472.566) * (-1474.522) (-1470.885) (-1477.184) [-1472.023] -- 0:00:37
453000 -- (-1475.663) (-1478.040) [-1472.930] (-1470.421) * (-1472.337) (-1475.013) (-1472.221) [-1472.329] -- 0:00:37
453500 -- [-1473.488] (-1473.971) (-1473.430) (-1470.827) * (-1483.105) [-1472.858] (-1474.272) (-1473.277) -- 0:00:37
454000 -- (-1473.157) (-1477.418) (-1476.144) [-1474.600] * [-1471.641] (-1471.826) (-1477.289) (-1471.445) -- 0:00:37
454500 -- [-1471.665] (-1472.459) (-1476.461) (-1471.856) * (-1474.836) (-1473.904) (-1479.203) [-1475.879] -- 0:00:38
455000 -- (-1473.648) (-1471.765) [-1474.376] (-1473.153) * (-1473.646) (-1472.491) (-1475.312) [-1471.452] -- 0:00:38
Average standard deviation of split frequencies: 0.008339
455500 -- (-1478.733) [-1473.901] (-1479.546) (-1475.505) * [-1473.806] (-1478.014) (-1474.206) (-1472.300) -- 0:00:38
456000 -- (-1474.234) (-1474.672) [-1473.516] (-1471.762) * (-1473.139) (-1473.648) (-1473.746) [-1474.998] -- 0:00:38
456500 -- (-1476.846) (-1475.817) [-1471.577] (-1472.307) * [-1471.174] (-1471.582) (-1473.952) (-1472.109) -- 0:00:38
457000 -- (-1480.661) [-1473.801] (-1471.079) (-1471.035) * (-1472.274) (-1472.342) (-1474.903) [-1470.816] -- 0:00:38
457500 -- (-1473.751) [-1472.284] (-1473.518) (-1472.624) * (-1472.823) [-1473.491] (-1472.118) (-1473.872) -- 0:00:37
458000 -- (-1475.769) [-1474.686] (-1476.703) (-1471.170) * (-1473.443) [-1470.990] (-1472.141) (-1473.302) -- 0:00:37
458500 -- (-1478.290) (-1474.064) (-1474.856) [-1472.588] * (-1474.810) (-1474.783) [-1471.432] (-1472.095) -- 0:00:37
459000 -- (-1476.233) (-1476.143) (-1471.506) [-1474.634] * [-1474.006] (-1472.198) (-1480.638) (-1471.035) -- 0:00:37
459500 -- (-1475.203) (-1472.117) (-1475.007) [-1473.845] * (-1473.741) [-1470.372] (-1476.413) (-1472.955) -- 0:00:37
460000 -- (-1476.887) [-1472.590] (-1472.125) (-1474.947) * (-1476.648) (-1472.523) (-1471.891) [-1471.322] -- 0:00:37
Average standard deviation of split frequencies: 0.007914
460500 -- [-1471.038] (-1471.141) (-1474.090) (-1472.826) * (-1476.833) (-1471.501) (-1476.616) [-1475.571] -- 0:00:37
461000 -- (-1478.436) [-1472.555] (-1475.294) (-1470.687) * (-1475.197) (-1471.006) [-1471.350] (-1476.955) -- 0:00:37
461500 -- (-1473.984) (-1474.042) (-1474.805) [-1472.886] * (-1470.886) (-1471.414) (-1471.894) [-1477.307] -- 0:00:37
462000 -- (-1472.790) (-1473.482) [-1470.794] (-1475.210) * (-1470.994) (-1471.700) (-1472.224) [-1470.488] -- 0:00:37
462500 -- (-1472.889) [-1472.488] (-1475.671) (-1473.846) * [-1475.352] (-1474.232) (-1473.324) (-1470.157) -- 0:00:37
463000 -- (-1477.023) (-1470.653) [-1471.001] (-1471.240) * (-1470.500) (-1471.581) (-1476.074) [-1471.215] -- 0:00:37
463500 -- (-1473.736) [-1476.057] (-1472.903) (-1471.768) * (-1470.728) (-1473.166) (-1474.724) [-1471.571] -- 0:00:37
464000 -- (-1472.184) (-1476.080) [-1470.441] (-1473.544) * [-1471.262] (-1472.507) (-1475.550) (-1476.408) -- 0:00:36
464500 -- (-1471.607) (-1475.178) (-1473.217) [-1471.236] * (-1470.603) [-1474.021] (-1476.391) (-1471.931) -- 0:00:36
465000 -- (-1472.049) (-1474.813) (-1472.598) [-1471.587] * [-1472.352] (-1474.311) (-1472.604) (-1475.214) -- 0:00:36
Average standard deviation of split frequencies: 0.007756
465500 -- (-1472.378) (-1476.065) [-1475.777] (-1478.222) * (-1471.026) [-1476.435] (-1474.738) (-1471.828) -- 0:00:36
466000 -- [-1472.618] (-1472.697) (-1474.726) (-1473.111) * (-1471.811) (-1475.263) [-1474.541] (-1471.569) -- 0:00:36
466500 -- (-1479.337) [-1473.398] (-1476.683) (-1474.023) * [-1471.465] (-1473.373) (-1473.239) (-1471.579) -- 0:00:36
467000 -- [-1475.842] (-1471.688) (-1475.716) (-1470.591) * (-1471.679) (-1471.707) [-1473.706] (-1477.013) -- 0:00:36
467500 -- [-1472.092] (-1473.002) (-1472.337) (-1474.993) * (-1473.474) (-1474.101) [-1476.583] (-1476.935) -- 0:00:36
468000 -- [-1472.919] (-1473.468) (-1474.209) (-1472.261) * (-1476.702) [-1472.251] (-1477.796) (-1472.925) -- 0:00:36
468500 -- (-1474.667) [-1471.446] (-1471.848) (-1476.089) * (-1474.478) (-1470.795) (-1474.656) [-1475.271] -- 0:00:36
469000 -- (-1472.094) (-1471.748) (-1473.162) [-1471.299] * (-1471.752) (-1474.732) [-1473.784] (-1470.849) -- 0:00:37
469500 -- (-1476.344) (-1476.079) (-1472.492) [-1471.818] * (-1472.111) [-1478.041] (-1472.907) (-1472.243) -- 0:00:37
470000 -- (-1472.375) (-1472.278) (-1473.376) [-1470.687] * (-1474.649) [-1473.483] (-1477.858) (-1471.768) -- 0:00:37
Average standard deviation of split frequencies: 0.007278
470500 -- (-1474.847) [-1472.295] (-1473.292) (-1476.819) * (-1472.947) (-1475.686) [-1472.479] (-1471.802) -- 0:00:37
471000 -- (-1472.539) (-1481.482) [-1471.950] (-1473.783) * (-1475.483) (-1472.183) (-1472.027) [-1472.591] -- 0:00:37
471500 -- (-1472.510) (-1473.444) [-1473.681] (-1473.948) * [-1470.825] (-1473.988) (-1474.144) (-1473.797) -- 0:00:36
472000 -- (-1471.611) (-1471.309) (-1471.044) [-1471.388] * [-1475.766] (-1471.752) (-1472.354) (-1472.459) -- 0:00:36
472500 -- [-1476.715] (-1476.220) (-1480.937) (-1472.174) * [-1471.914] (-1473.121) (-1479.418) (-1474.186) -- 0:00:36
473000 -- (-1476.426) (-1472.443) (-1479.422) [-1473.113] * (-1472.117) (-1473.005) (-1473.679) [-1472.558] -- 0:00:36
473500 -- [-1474.565] (-1474.921) (-1476.528) (-1471.807) * [-1471.071] (-1473.805) (-1472.568) (-1473.148) -- 0:00:36
474000 -- (-1476.068) (-1472.242) [-1470.146] (-1473.948) * (-1472.926) [-1472.038] (-1472.228) (-1476.988) -- 0:00:36
474500 -- (-1472.120) (-1474.080) [-1473.534] (-1476.049) * [-1469.582] (-1470.498) (-1474.841) (-1480.888) -- 0:00:36
475000 -- (-1473.260) [-1472.207] (-1475.441) (-1476.043) * (-1472.387) [-1471.520] (-1473.622) (-1476.153) -- 0:00:36
Average standard deviation of split frequencies: 0.007923
475500 -- [-1472.568] (-1472.128) (-1474.248) (-1474.389) * [-1471.699] (-1475.498) (-1475.071) (-1471.516) -- 0:00:36
476000 -- [-1471.575] (-1477.734) (-1470.350) (-1474.528) * [-1473.816] (-1473.061) (-1473.226) (-1473.874) -- 0:00:36
476500 -- (-1474.194) (-1474.540) [-1472.450] (-1471.194) * (-1470.808) (-1471.866) [-1471.428] (-1470.861) -- 0:00:36
477000 -- (-1472.475) [-1478.810] (-1474.884) (-1473.122) * (-1473.066) [-1470.748] (-1478.369) (-1472.757) -- 0:00:36
477500 -- (-1473.830) (-1475.547) [-1472.440] (-1474.720) * [-1474.045] (-1471.751) (-1475.759) (-1472.046) -- 0:00:36
478000 -- [-1472.997] (-1474.699) (-1474.404) (-1474.010) * (-1473.685) (-1472.474) [-1477.380] (-1470.862) -- 0:00:36
478500 -- (-1471.841) (-1476.093) [-1470.585] (-1475.801) * (-1472.439) (-1473.960) (-1474.292) [-1470.262] -- 0:00:35
479000 -- (-1472.026) (-1474.571) [-1471.549] (-1470.491) * [-1472.028] (-1472.463) (-1477.156) (-1473.646) -- 0:00:35
479500 -- (-1473.461) (-1476.194) (-1473.041) [-1471.471] * (-1473.489) [-1471.937] (-1474.692) (-1471.410) -- 0:00:35
480000 -- (-1474.804) [-1474.144] (-1472.576) (-1472.153) * (-1471.630) [-1471.081] (-1472.439) (-1472.468) -- 0:00:35
Average standard deviation of split frequencies: 0.007846
480500 -- (-1472.766) (-1471.641) (-1473.312) [-1474.958] * (-1473.586) (-1473.617) (-1473.823) [-1472.392] -- 0:00:35
481000 -- (-1474.533) [-1474.067] (-1473.956) (-1473.803) * (-1475.103) (-1474.653) (-1473.204) [-1471.780] -- 0:00:35
481500 -- (-1472.377) (-1474.059) (-1473.254) [-1473.545] * (-1471.957) (-1475.912) [-1473.144] (-1473.808) -- 0:00:35
482000 -- (-1473.561) (-1474.108) (-1471.553) [-1472.995] * [-1470.709] (-1474.579) (-1474.332) (-1471.586) -- 0:00:35
482500 -- (-1472.455) [-1473.397] (-1476.203) (-1471.867) * [-1470.936] (-1472.726) (-1471.980) (-1473.574) -- 0:00:35
483000 -- (-1472.677) (-1475.567) [-1473.510] (-1471.433) * (-1470.039) (-1474.749) [-1473.383] (-1477.962) -- 0:00:35
483500 -- (-1471.156) (-1472.665) (-1473.116) [-1473.636] * (-1472.398) [-1473.232] (-1473.428) (-1473.619) -- 0:00:35
484000 -- (-1476.969) [-1473.991] (-1474.629) (-1473.442) * (-1470.604) [-1472.952] (-1474.554) (-1477.983) -- 0:00:36
484500 -- [-1470.616] (-1475.637) (-1474.282) (-1473.803) * (-1476.444) [-1473.421] (-1477.443) (-1469.800) -- 0:00:36
485000 -- (-1473.323) (-1470.970) [-1472.526] (-1474.267) * [-1473.580] (-1471.492) (-1476.201) (-1472.347) -- 0:00:36
Average standard deviation of split frequencies: 0.007695
485500 -- (-1478.262) (-1473.084) (-1470.614) [-1473.833] * [-1473.633] (-1470.740) (-1473.067) (-1475.358) -- 0:00:36
486000 -- [-1473.154] (-1471.811) (-1472.761) (-1474.098) * (-1473.472) [-1471.003] (-1474.203) (-1471.877) -- 0:00:35
486500 -- [-1470.409] (-1472.477) (-1480.878) (-1479.321) * (-1472.191) [-1471.959] (-1475.095) (-1471.221) -- 0:00:35
487000 -- (-1472.774) (-1473.750) (-1476.985) [-1475.281] * [-1472.039] (-1471.776) (-1475.073) (-1474.155) -- 0:00:35
487500 -- (-1473.021) (-1475.375) (-1471.210) [-1476.094] * (-1471.438) [-1473.019] (-1475.335) (-1471.450) -- 0:00:35
488000 -- [-1470.969] (-1474.469) (-1472.103) (-1473.453) * [-1473.471] (-1470.933) (-1478.818) (-1470.454) -- 0:00:35
488500 -- (-1472.891) (-1472.392) (-1475.008) [-1471.405] * (-1475.762) (-1475.383) (-1474.580) [-1469.856] -- 0:00:35
489000 -- (-1472.905) (-1474.549) [-1471.269] (-1473.174) * (-1470.586) [-1473.683] (-1475.797) (-1473.414) -- 0:00:35
489500 -- [-1474.917] (-1472.711) (-1471.179) (-1475.822) * [-1471.453] (-1470.633) (-1477.998) (-1473.747) -- 0:00:35
490000 -- (-1472.162) (-1471.422) (-1471.762) [-1471.451] * (-1472.340) (-1472.477) [-1473.969] (-1472.739) -- 0:00:35
Average standard deviation of split frequencies: 0.008134
490500 -- (-1476.818) [-1470.445] (-1472.512) (-1472.440) * (-1473.199) (-1472.675) (-1474.242) [-1476.087] -- 0:00:35
491000 -- [-1473.173] (-1472.952) (-1473.741) (-1473.262) * (-1473.417) (-1474.351) (-1478.039) [-1472.701] -- 0:00:35
491500 -- [-1472.522] (-1472.559) (-1474.530) (-1473.022) * (-1475.968) [-1475.018] (-1475.407) (-1471.037) -- 0:00:35
492000 -- (-1473.239) (-1473.959) (-1473.072) [-1471.561] * (-1473.170) (-1475.815) [-1475.498] (-1475.305) -- 0:00:35
492500 -- (-1474.774) (-1476.307) [-1473.891] (-1479.678) * (-1472.375) (-1474.532) (-1473.967) [-1472.460] -- 0:00:35
493000 -- (-1478.278) [-1472.774] (-1476.093) (-1472.841) * (-1472.059) (-1475.686) [-1471.385] (-1472.609) -- 0:00:34
493500 -- (-1478.280) (-1475.799) (-1475.971) [-1472.150] * [-1472.522] (-1473.997) (-1475.312) (-1477.835) -- 0:00:34
494000 -- (-1470.912) (-1472.342) [-1470.811] (-1483.755) * (-1472.834) (-1479.587) [-1472.809] (-1471.043) -- 0:00:34
494500 -- (-1474.871) (-1477.351) [-1471.562] (-1480.646) * [-1472.210] (-1471.592) (-1474.363) (-1471.633) -- 0:00:34
495000 -- (-1472.161) (-1475.627) (-1475.058) [-1475.305] * (-1474.733) (-1475.214) [-1474.261] (-1471.869) -- 0:00:34
Average standard deviation of split frequencies: 0.008110
495500 -- (-1471.610) [-1472.966] (-1474.019) (-1472.578) * (-1473.359) (-1476.776) [-1475.169] (-1472.220) -- 0:00:34
496000 -- [-1470.033] (-1475.926) (-1470.113) (-1474.505) * (-1474.823) (-1473.156) [-1471.849] (-1474.193) -- 0:00:34
496500 -- (-1477.595) [-1474.245] (-1476.637) (-1474.890) * (-1473.946) [-1473.544] (-1471.789) (-1474.852) -- 0:00:34
497000 -- (-1470.504) [-1473.856] (-1474.446) (-1472.999) * [-1472.401] (-1477.205) (-1474.603) (-1473.875) -- 0:00:34
497500 -- (-1476.548) (-1475.865) [-1469.571] (-1479.616) * (-1476.873) [-1477.049] (-1471.213) (-1470.576) -- 0:00:34
498000 -- (-1473.588) (-1480.106) [-1471.426] (-1480.142) * [-1475.527] (-1473.869) (-1478.732) (-1476.891) -- 0:00:34
498500 -- (-1472.653) [-1474.189] (-1474.154) (-1472.590) * [-1477.018] (-1473.291) (-1472.046) (-1471.662) -- 0:00:34
499000 -- (-1471.809) [-1471.691] (-1472.715) (-1475.403) * (-1475.718) (-1478.570) (-1472.994) [-1472.661] -- 0:00:35
499500 -- (-1474.909) (-1473.713) [-1471.937] (-1471.932) * (-1476.165) (-1477.025) [-1471.912] (-1470.287) -- 0:00:35
500000 -- (-1472.810) (-1473.306) [-1471.529] (-1472.884) * (-1475.083) (-1476.552) (-1472.400) [-1471.841] -- 0:00:35
Average standard deviation of split frequencies: 0.007784
500500 -- (-1477.075) (-1474.609) [-1471.703] (-1472.377) * (-1473.016) (-1477.511) [-1472.341] (-1470.408) -- 0:00:34
501000 -- (-1471.712) (-1475.638) [-1474.308] (-1472.648) * (-1477.648) (-1477.420) [-1474.560] (-1474.645) -- 0:00:34
501500 -- [-1471.756] (-1474.527) (-1470.165) (-1472.155) * (-1473.979) (-1476.256) (-1476.000) [-1472.696] -- 0:00:34
502000 -- [-1469.909] (-1473.921) (-1472.657) (-1475.189) * (-1477.414) (-1474.258) (-1474.589) [-1471.751] -- 0:00:34
502500 -- (-1470.919) (-1476.848) (-1477.129) [-1475.978] * [-1473.034] (-1477.790) (-1473.045) (-1472.881) -- 0:00:34
503000 -- (-1473.560) (-1475.616) (-1478.379) [-1472.073] * [-1469.735] (-1477.027) (-1474.414) (-1472.221) -- 0:00:34
503500 -- (-1475.894) [-1474.087] (-1474.971) (-1475.484) * [-1473.505] (-1477.612) (-1472.773) (-1472.100) -- 0:00:34
504000 -- [-1477.070] (-1473.913) (-1475.777) (-1472.004) * (-1473.121) [-1473.940] (-1476.678) (-1473.880) -- 0:00:34
504500 -- [-1475.997] (-1477.260) (-1471.490) (-1473.444) * [-1472.537] (-1472.975) (-1472.746) (-1476.379) -- 0:00:34
505000 -- (-1471.760) (-1476.614) [-1471.509] (-1472.397) * [-1470.368] (-1472.417) (-1474.320) (-1477.470) -- 0:00:34
Average standard deviation of split frequencies: 0.008501
505500 -- (-1473.382) (-1472.967) [-1472.626] (-1476.660) * [-1473.186] (-1474.729) (-1472.624) (-1472.751) -- 0:00:34
506000 -- (-1474.463) (-1475.153) (-1470.200) [-1474.112] * [-1471.159] (-1474.228) (-1475.739) (-1472.996) -- 0:00:34
506500 -- (-1472.908) (-1472.237) (-1473.252) [-1472.398] * (-1473.821) (-1473.744) [-1475.237] (-1474.292) -- 0:00:34
507000 -- (-1471.333) [-1473.473] (-1473.183) (-1473.741) * [-1472.323] (-1470.580) (-1473.295) (-1473.300) -- 0:00:34
507500 -- [-1470.419] (-1472.892) (-1473.744) (-1473.691) * (-1472.508) (-1470.228) [-1472.663] (-1471.828) -- 0:00:33
508000 -- [-1475.058] (-1473.714) (-1475.379) (-1478.889) * (-1472.871) (-1477.330) (-1474.765) [-1476.111] -- 0:00:33
508500 -- [-1473.665] (-1471.055) (-1471.046) (-1475.039) * (-1473.871) [-1473.748] (-1475.323) (-1475.859) -- 0:00:33
509000 -- [-1473.688] (-1473.987) (-1473.568) (-1474.667) * (-1471.086) [-1472.539] (-1476.582) (-1471.667) -- 0:00:33
509500 -- (-1476.625) (-1472.941) (-1475.002) [-1472.253] * [-1471.662] (-1473.037) (-1473.705) (-1473.764) -- 0:00:33
510000 -- (-1470.376) (-1473.177) [-1475.983] (-1474.263) * (-1475.214) (-1471.707) [-1472.771] (-1477.176) -- 0:00:33
Average standard deviation of split frequencies: 0.008366
510500 -- (-1473.984) (-1474.034) (-1473.739) [-1472.392] * [-1471.049] (-1473.192) (-1471.910) (-1474.988) -- 0:00:33
511000 -- [-1475.364] (-1472.170) (-1472.970) (-1473.062) * [-1472.615] (-1473.439) (-1471.051) (-1473.831) -- 0:00:33
511500 -- (-1472.022) (-1471.163) [-1470.555] (-1473.350) * (-1473.611) (-1473.721) (-1474.897) [-1478.238] -- 0:00:33
512000 -- [-1474.270] (-1472.984) (-1471.542) (-1473.938) * (-1472.690) [-1474.075] (-1474.879) (-1471.405) -- 0:00:33
512500 -- [-1474.538] (-1473.899) (-1475.644) (-1473.265) * (-1472.639) (-1472.685) [-1472.100] (-1474.736) -- 0:00:33
513000 -- (-1476.383) [-1473.467] (-1472.551) (-1472.502) * (-1474.031) (-1471.332) (-1474.259) [-1471.661] -- 0:00:33
513500 -- (-1473.770) (-1471.658) (-1476.337) [-1474.165] * (-1472.835) (-1478.456) (-1475.039) [-1472.282] -- 0:00:34
514000 -- (-1471.800) [-1474.641] (-1471.091) (-1473.938) * (-1471.640) (-1471.678) (-1478.281) [-1471.194] -- 0:00:34
514500 -- [-1474.657] (-1471.976) (-1474.575) (-1474.840) * (-1471.998) [-1471.509] (-1479.504) (-1475.255) -- 0:00:33
515000 -- [-1471.654] (-1472.823) (-1474.442) (-1479.741) * (-1473.645) (-1475.933) [-1477.601] (-1474.661) -- 0:00:33
Average standard deviation of split frequencies: 0.007765
515500 -- (-1473.890) [-1470.579] (-1471.754) (-1474.403) * (-1473.138) (-1471.967) [-1474.139] (-1473.892) -- 0:00:33
516000 -- (-1471.973) [-1472.601] (-1471.942) (-1474.797) * (-1472.681) [-1473.453] (-1472.871) (-1471.167) -- 0:00:33
516500 -- [-1473.634] (-1481.354) (-1472.900) (-1477.308) * (-1474.885) [-1475.571] (-1477.027) (-1475.212) -- 0:00:33
517000 -- [-1470.583] (-1477.047) (-1472.599) (-1476.332) * [-1476.060] (-1471.509) (-1473.834) (-1471.232) -- 0:00:33
517500 -- (-1473.928) (-1479.658) (-1473.715) [-1475.685] * (-1473.694) [-1472.064] (-1472.401) (-1472.987) -- 0:00:33
518000 -- [-1470.429] (-1475.830) (-1471.578) (-1473.347) * (-1471.770) (-1472.779) [-1473.588] (-1478.323) -- 0:00:33
518500 -- (-1473.355) (-1472.966) [-1472.023] (-1474.462) * [-1473.768] (-1474.284) (-1471.582) (-1471.069) -- 0:00:33
519000 -- (-1472.891) [-1470.078] (-1471.690) (-1474.595) * (-1473.986) (-1472.340) [-1473.733] (-1472.553) -- 0:00:33
519500 -- (-1471.783) (-1471.997) (-1474.654) [-1472.470] * (-1474.945) [-1471.956] (-1475.447) (-1473.918) -- 0:00:33
520000 -- [-1471.774] (-1474.691) (-1474.239) (-1476.250) * [-1477.786] (-1474.584) (-1473.703) (-1473.369) -- 0:00:33
Average standard deviation of split frequencies: 0.007979
520500 -- (-1472.390) (-1478.226) [-1475.095] (-1476.110) * [-1478.840] (-1475.027) (-1475.998) (-1472.624) -- 0:00:33
521000 -- (-1471.872) (-1475.006) (-1472.532) [-1476.047] * (-1476.186) (-1473.758) [-1471.737] (-1473.997) -- 0:00:33
521500 -- [-1471.268] (-1472.647) (-1470.797) (-1477.310) * (-1473.477) (-1474.393) (-1476.856) [-1474.824] -- 0:00:33
522000 -- [-1472.301] (-1471.374) (-1475.395) (-1475.851) * [-1472.410] (-1472.051) (-1476.648) (-1472.335) -- 0:00:32
522500 -- (-1475.183) (-1474.556) [-1472.724] (-1473.994) * (-1472.848) (-1471.039) [-1474.682] (-1471.981) -- 0:00:32
523000 -- (-1475.025) (-1473.459) (-1470.213) [-1473.360] * [-1472.479] (-1473.238) (-1473.728) (-1473.187) -- 0:00:32
523500 -- (-1474.581) (-1476.253) (-1472.491) [-1472.466] * [-1475.382] (-1473.527) (-1472.789) (-1474.058) -- 0:00:32
524000 -- [-1472.003] (-1471.728) (-1472.731) (-1473.279) * (-1472.147) [-1476.169] (-1474.821) (-1473.489) -- 0:00:32
524500 -- (-1472.481) (-1473.592) [-1472.902] (-1473.127) * (-1471.730) [-1471.002] (-1473.235) (-1474.611) -- 0:00:32
525000 -- (-1471.298) (-1472.284) [-1471.242] (-1471.500) * (-1472.153) (-1474.925) [-1474.698] (-1475.900) -- 0:00:32
Average standard deviation of split frequencies: 0.008066
525500 -- [-1472.607] (-1470.225) (-1470.716) (-1475.836) * (-1475.554) [-1473.909] (-1474.706) (-1473.418) -- 0:00:32
526000 -- (-1470.313) (-1474.319) [-1472.741] (-1473.122) * [-1474.360] (-1471.586) (-1470.536) (-1474.944) -- 0:00:32
526500 -- [-1472.673] (-1470.530) (-1471.034) (-1474.621) * (-1473.192) (-1475.330) [-1470.868] (-1476.104) -- 0:00:32
527000 -- (-1475.310) (-1474.132) [-1470.838] (-1475.074) * (-1474.232) (-1473.402) (-1470.594) [-1478.129] -- 0:00:32
527500 -- (-1473.195) [-1474.626] (-1477.566) (-1471.328) * (-1473.121) (-1473.944) [-1471.939] (-1480.928) -- 0:00:32
528000 -- [-1469.950] (-1475.158) (-1472.787) (-1471.788) * (-1478.640) (-1470.430) (-1473.110) [-1470.915] -- 0:00:33
528500 -- (-1479.124) (-1473.781) (-1474.353) [-1470.739] * (-1475.089) (-1474.262) [-1474.178] (-1473.709) -- 0:00:33
529000 -- (-1471.911) (-1478.913) (-1474.514) [-1472.018] * (-1473.454) [-1476.753] (-1475.502) (-1472.386) -- 0:00:32
529500 -- [-1471.473] (-1475.407) (-1475.899) (-1474.882) * (-1470.983) (-1475.365) [-1474.336] (-1473.967) -- 0:00:32
530000 -- (-1471.121) [-1474.249] (-1475.358) (-1476.309) * (-1471.183) (-1474.818) [-1477.690] (-1472.220) -- 0:00:32
Average standard deviation of split frequencies: 0.007939
530500 -- [-1471.910] (-1473.517) (-1471.942) (-1474.249) * (-1473.279) (-1472.246) [-1471.566] (-1473.503) -- 0:00:32
531000 -- (-1472.507) [-1475.183] (-1472.286) (-1475.505) * (-1473.774) (-1472.409) (-1470.726) [-1473.572] -- 0:00:32
531500 -- (-1470.944) (-1478.301) [-1473.686] (-1479.060) * [-1473.663] (-1474.726) (-1472.814) (-1474.544) -- 0:00:32
532000 -- (-1470.446) (-1478.012) [-1480.324] (-1474.921) * [-1473.206] (-1474.029) (-1472.812) (-1477.167) -- 0:00:32
532500 -- (-1472.356) [-1471.841] (-1478.329) (-1474.989) * (-1473.711) (-1474.821) (-1474.073) [-1474.114] -- 0:00:32
533000 -- (-1476.261) [-1472.680] (-1472.235) (-1472.379) * [-1475.358] (-1481.634) (-1473.264) (-1475.271) -- 0:00:32
533500 -- [-1471.749] (-1472.366) (-1475.042) (-1474.181) * [-1472.903] (-1472.693) (-1473.525) (-1472.923) -- 0:00:32
534000 -- (-1471.479) [-1472.416] (-1474.697) (-1474.257) * (-1478.155) [-1472.086] (-1470.151) (-1474.818) -- 0:00:32
534500 -- (-1472.556) (-1473.876) [-1474.278] (-1474.758) * (-1477.032) [-1472.360] (-1474.216) (-1472.359) -- 0:00:32
535000 -- [-1473.203] (-1474.295) (-1474.231) (-1474.647) * [-1476.422] (-1475.885) (-1479.220) (-1476.052) -- 0:00:32
Average standard deviation of split frequencies: 0.007750
535500 -- (-1473.341) [-1470.850] (-1476.090) (-1473.242) * (-1476.098) [-1471.280] (-1474.283) (-1472.908) -- 0:00:32
536000 -- (-1473.329) (-1470.414) (-1478.336) [-1472.480] * (-1472.374) (-1472.188) [-1475.664] (-1475.953) -- 0:00:32
536500 -- (-1472.755) (-1473.067) [-1476.420] (-1476.318) * (-1474.863) (-1475.296) (-1473.595) [-1473.470] -- 0:00:31
537000 -- (-1470.409) [-1473.657] (-1478.221) (-1474.038) * (-1474.690) (-1471.132) [-1475.537] (-1473.441) -- 0:00:31
537500 -- (-1471.496) [-1473.410] (-1475.961) (-1475.141) * (-1472.993) (-1471.288) [-1470.656] (-1473.652) -- 0:00:31
538000 -- (-1477.247) (-1473.794) [-1473.981] (-1478.083) * (-1474.414) (-1471.581) (-1474.162) [-1474.576] -- 0:00:31
538500 -- [-1473.399] (-1472.092) (-1471.503) (-1475.255) * [-1472.505] (-1472.340) (-1469.891) (-1477.051) -- 0:00:31
539000 -- (-1473.681) (-1472.295) [-1472.490] (-1471.183) * (-1473.520) (-1473.066) [-1471.129] (-1474.034) -- 0:00:31
539500 -- [-1472.456] (-1471.358) (-1475.999) (-1480.485) * [-1473.189] (-1475.597) (-1471.293) (-1469.555) -- 0:00:31
540000 -- (-1471.546) (-1472.447) [-1474.607] (-1477.632) * (-1472.789) (-1473.106) (-1474.408) [-1472.680] -- 0:00:31
Average standard deviation of split frequencies: 0.007030
540500 -- (-1472.257) [-1472.359] (-1476.665) (-1478.466) * [-1472.526] (-1472.166) (-1473.018) (-1470.229) -- 0:00:31
541000 -- (-1475.083) [-1471.500] (-1474.716) (-1473.395) * (-1475.310) (-1475.269) (-1472.736) [-1472.308] -- 0:00:31
541500 -- (-1475.115) [-1473.345] (-1473.632) (-1474.915) * (-1471.895) (-1472.061) [-1475.404] (-1472.979) -- 0:00:31
542000 -- (-1473.013) (-1474.937) (-1473.154) [-1473.241] * (-1471.321) [-1472.923] (-1473.444) (-1472.858) -- 0:00:31
542500 -- (-1472.091) (-1472.775) (-1473.773) [-1471.557] * (-1474.745) (-1475.640) [-1472.498] (-1475.549) -- 0:00:31
543000 -- (-1473.256) (-1476.323) [-1471.333] (-1472.571) * [-1472.027] (-1474.256) (-1472.867) (-1473.697) -- 0:00:31
543500 -- (-1472.656) (-1473.792) [-1470.334] (-1475.518) * (-1475.204) (-1472.555) (-1472.893) [-1472.195] -- 0:00:31
544000 -- (-1473.079) (-1474.544) (-1477.715) [-1471.748] * [-1473.503] (-1472.034) (-1475.237) (-1474.530) -- 0:00:31
544500 -- [-1475.910] (-1475.383) (-1474.859) (-1472.081) * (-1478.618) [-1471.930] (-1473.582) (-1472.322) -- 0:00:31
545000 -- (-1473.232) (-1475.949) [-1470.414] (-1471.978) * (-1474.781) (-1477.556) (-1476.129) [-1471.475] -- 0:00:31
Average standard deviation of split frequencies: 0.007716
545500 -- (-1478.545) [-1472.100] (-1475.443) (-1471.809) * (-1475.807) (-1472.289) [-1471.933] (-1474.732) -- 0:00:31
546000 -- (-1475.128) (-1472.518) [-1469.611] (-1473.689) * (-1474.187) (-1474.544) (-1472.961) [-1473.551] -- 0:00:31
546500 -- (-1480.030) (-1472.207) [-1471.960] (-1473.393) * (-1473.769) (-1475.736) [-1472.848] (-1477.031) -- 0:00:31
547000 -- (-1473.098) (-1472.562) [-1471.508] (-1474.428) * (-1472.113) (-1477.913) [-1472.215] (-1472.964) -- 0:00:31
547500 -- (-1472.752) (-1477.867) [-1474.291] (-1472.403) * (-1475.276) (-1475.778) [-1472.654] (-1477.054) -- 0:00:31
548000 -- (-1472.231) [-1477.743] (-1476.418) (-1473.779) * (-1472.223) [-1474.054] (-1474.898) (-1473.519) -- 0:00:31
548500 -- (-1476.527) (-1474.424) (-1473.183) [-1472.831] * (-1478.586) [-1472.861] (-1475.087) (-1474.041) -- 0:00:31
549000 -- (-1475.572) (-1474.258) [-1471.960] (-1473.469) * (-1475.997) (-1474.261) (-1483.679) [-1471.214] -- 0:00:31
549500 -- [-1472.142] (-1471.014) (-1472.441) (-1474.577) * (-1480.986) (-1475.081) [-1478.889] (-1471.873) -- 0:00:31
550000 -- (-1470.028) (-1473.707) [-1473.735] (-1474.010) * (-1472.044) (-1473.737) (-1475.199) [-1473.776] -- 0:00:31
Average standard deviation of split frequencies: 0.008079
550500 -- [-1474.883] (-1480.694) (-1471.221) (-1475.693) * (-1473.699) [-1475.910] (-1472.220) (-1474.661) -- 0:00:31
551000 -- [-1472.486] (-1473.063) (-1472.759) (-1472.698) * (-1473.628) (-1473.690) (-1473.888) [-1472.959] -- 0:00:30
551500 -- [-1471.390] (-1471.286) (-1473.791) (-1477.808) * (-1473.340) [-1473.135] (-1473.442) (-1472.603) -- 0:00:30
552000 -- (-1471.599) (-1471.098) [-1471.708] (-1477.005) * (-1477.869) (-1474.069) (-1470.776) [-1471.884] -- 0:00:30
552500 -- [-1470.552] (-1477.499) (-1472.138) (-1474.526) * [-1470.873] (-1471.463) (-1475.864) (-1472.309) -- 0:00:30
553000 -- (-1473.161) [-1470.414] (-1475.835) (-1473.723) * (-1473.054) (-1473.732) (-1475.883) [-1472.308] -- 0:00:30
553500 -- (-1468.973) (-1472.431) (-1475.702) [-1472.887] * (-1472.524) [-1473.122] (-1473.084) (-1472.278) -- 0:00:30
554000 -- [-1473.065] (-1475.617) (-1475.936) (-1472.606) * [-1473.776] (-1471.768) (-1476.227) (-1472.574) -- 0:00:30
554500 -- (-1474.408) (-1473.916) (-1472.224) [-1471.658] * (-1475.769) (-1473.118) (-1475.994) [-1473.440] -- 0:00:30
555000 -- (-1475.953) (-1472.200) [-1474.201] (-1475.458) * (-1475.489) [-1475.889] (-1477.878) (-1472.927) -- 0:00:30
Average standard deviation of split frequencies: 0.007843
555500 -- (-1480.276) (-1471.254) (-1474.518) [-1474.984] * (-1472.611) [-1473.364] (-1475.946) (-1472.916) -- 0:00:30
556000 -- (-1470.772) [-1472.101] (-1475.665) (-1475.191) * (-1473.194) [-1471.482] (-1476.917) (-1472.630) -- 0:00:30
556500 -- [-1471.096] (-1472.353) (-1478.174) (-1476.253) * (-1475.992) (-1470.605) (-1475.030) [-1471.705] -- 0:00:30
557000 -- (-1471.023) (-1471.781) (-1472.040) [-1472.360] * [-1473.728] (-1471.799) (-1471.080) (-1474.198) -- 0:00:30
557500 -- [-1469.845] (-1471.360) (-1472.311) (-1474.209) * (-1469.865) (-1475.349) [-1472.146] (-1475.946) -- 0:00:30
558000 -- (-1473.371) [-1475.033] (-1471.475) (-1473.411) * [-1470.957] (-1478.910) (-1474.018) (-1472.693) -- 0:00:30
558500 -- (-1474.329) (-1474.556) [-1472.134] (-1478.961) * (-1471.930) (-1474.415) [-1472.779] (-1471.865) -- 0:00:30
559000 -- (-1474.515) [-1475.383] (-1472.443) (-1476.456) * [-1471.968] (-1473.603) (-1475.025) (-1474.378) -- 0:00:30
559500 -- (-1476.853) (-1471.524) (-1474.214) [-1479.181] * (-1472.912) [-1469.979] (-1478.686) (-1472.909) -- 0:00:30
560000 -- (-1476.206) [-1473.742] (-1475.175) (-1472.739) * [-1472.035] (-1473.769) (-1478.337) (-1470.708) -- 0:00:30
Average standard deviation of split frequencies: 0.008040
560500 -- (-1471.170) (-1471.402) [-1477.754] (-1474.301) * [-1468.787] (-1472.327) (-1476.048) (-1474.007) -- 0:00:30
561000 -- [-1471.993] (-1479.349) (-1471.865) (-1475.695) * (-1473.547) (-1476.791) (-1476.934) [-1471.749] -- 0:00:30
561500 -- (-1470.317) [-1473.915] (-1472.515) (-1476.595) * (-1471.535) (-1477.687) (-1473.462) [-1471.434] -- 0:00:30
562000 -- (-1472.150) [-1476.677] (-1475.553) (-1479.765) * [-1472.506] (-1473.826) (-1477.047) (-1470.783) -- 0:00:30
562500 -- (-1473.336) (-1473.656) [-1476.274] (-1477.738) * [-1474.309] (-1472.541) (-1474.491) (-1472.736) -- 0:00:30
563000 -- (-1473.373) (-1474.760) (-1472.967) [-1475.345] * (-1472.138) (-1472.990) (-1472.105) [-1472.290] -- 0:00:30
563500 -- (-1475.144) (-1476.772) [-1474.906] (-1475.467) * (-1474.598) (-1472.188) (-1475.748) [-1471.444] -- 0:00:30
564000 -- (-1472.254) (-1472.814) [-1473.835] (-1472.131) * (-1473.642) (-1473.983) [-1478.123] (-1478.839) -- 0:00:30
564500 -- [-1473.263] (-1471.533) (-1474.570) (-1475.054) * [-1477.503] (-1474.915) (-1476.450) (-1476.016) -- 0:00:30
565000 -- [-1471.786] (-1472.091) (-1474.760) (-1474.099) * (-1473.105) (-1476.888) (-1478.485) [-1473.476] -- 0:00:30
Average standard deviation of split frequencies: 0.008068
565500 -- [-1472.184] (-1472.989) (-1475.022) (-1475.538) * (-1474.397) (-1474.700) [-1476.309] (-1475.410) -- 0:00:29
566000 -- (-1471.436) [-1473.133] (-1477.138) (-1476.946) * [-1476.067] (-1472.667) (-1474.608) (-1472.887) -- 0:00:29
566500 -- (-1472.424) (-1476.396) (-1475.920) [-1471.927] * (-1477.164) (-1474.557) (-1477.316) [-1472.268] -- 0:00:29
567000 -- (-1474.005) [-1473.149] (-1471.007) (-1472.070) * (-1471.986) (-1474.039) [-1471.719] (-1474.037) -- 0:00:29
567500 -- (-1474.664) (-1472.716) [-1471.000] (-1477.012) * [-1471.038] (-1474.757) (-1473.982) (-1473.611) -- 0:00:29
568000 -- (-1477.396) [-1475.569] (-1471.717) (-1474.348) * (-1470.361) (-1473.301) (-1475.288) [-1469.998] -- 0:00:29
568500 -- (-1479.673) [-1471.869] (-1475.904) (-1475.953) * (-1470.578) (-1470.780) (-1473.876) [-1474.764] -- 0:00:29
569000 -- [-1473.680] (-1475.293) (-1473.684) (-1475.011) * (-1475.952) (-1471.609) [-1470.249] (-1474.519) -- 0:00:29
569500 -- [-1475.612] (-1473.067) (-1472.894) (-1474.140) * (-1476.157) (-1471.252) (-1472.024) [-1473.844] -- 0:00:29
570000 -- (-1474.452) [-1474.556] (-1472.125) (-1474.092) * (-1472.384) (-1475.997) [-1472.695] (-1475.448) -- 0:00:29
Average standard deviation of split frequencies: 0.008209
570500 -- [-1473.063] (-1472.028) (-1471.885) (-1476.900) * (-1473.139) (-1472.242) [-1471.108] (-1474.396) -- 0:00:29
571000 -- [-1477.637] (-1477.199) (-1471.070) (-1475.766) * (-1471.043) (-1472.949) (-1475.499) [-1471.732] -- 0:00:29
571500 -- (-1473.212) (-1477.142) [-1473.647] (-1476.312) * (-1471.689) (-1472.504) [-1471.740] (-1473.904) -- 0:00:29
572000 -- (-1477.249) (-1474.925) (-1470.844) [-1473.284] * [-1472.830] (-1474.627) (-1474.627) (-1473.663) -- 0:00:29
572500 -- (-1472.228) (-1472.183) (-1471.709) [-1471.728] * [-1474.662] (-1471.570) (-1475.948) (-1471.821) -- 0:00:29
573000 -- (-1474.169) (-1478.038) [-1469.946] (-1472.663) * (-1473.080) (-1472.806) [-1472.839] (-1472.096) -- 0:00:29
573500 -- (-1477.591) (-1472.152) (-1476.037) [-1473.946] * [-1472.778] (-1473.006) (-1473.253) (-1473.960) -- 0:00:29
574000 -- [-1471.820] (-1473.893) (-1470.999) (-1473.549) * [-1471.732] (-1475.931) (-1471.477) (-1473.550) -- 0:00:29
574500 -- (-1474.551) (-1473.830) (-1473.102) [-1473.638] * (-1471.342) (-1475.015) [-1473.954] (-1473.411) -- 0:00:29
575000 -- [-1470.676] (-1470.947) (-1474.201) (-1473.771) * (-1475.038) (-1471.560) (-1473.115) [-1473.435] -- 0:00:29
Average standard deviation of split frequencies: 0.007584
575500 -- (-1474.580) [-1474.680] (-1472.870) (-1473.389) * [-1476.769] (-1474.058) (-1473.488) (-1476.835) -- 0:00:29
576000 -- (-1475.339) (-1472.008) [-1471.063] (-1474.596) * [-1472.075] (-1471.160) (-1472.544) (-1474.056) -- 0:00:29
576500 -- (-1477.431) (-1474.609) [-1476.609] (-1476.717) * [-1474.862] (-1471.003) (-1476.975) (-1476.597) -- 0:00:29
577000 -- [-1472.904] (-1471.178) (-1477.014) (-1476.981) * (-1472.127) [-1474.473] (-1473.349) (-1476.320) -- 0:00:29
577500 -- [-1475.895] (-1472.742) (-1477.446) (-1479.830) * [-1473.465] (-1475.813) (-1472.920) (-1470.525) -- 0:00:29
578000 -- [-1482.398] (-1470.627) (-1480.347) (-1474.694) * (-1472.287) (-1472.834) (-1472.643) [-1476.548] -- 0:00:29
578500 -- (-1478.435) [-1471.871] (-1474.413) (-1474.437) * (-1472.768) [-1473.265] (-1471.547) (-1475.053) -- 0:00:29
579000 -- (-1476.542) (-1475.372) [-1477.069] (-1474.743) * [-1471.525] (-1474.747) (-1476.598) (-1479.154) -- 0:00:29
579500 -- (-1477.959) [-1474.642] (-1476.634) (-1472.898) * (-1469.631) [-1471.957] (-1472.519) (-1473.757) -- 0:00:29
580000 -- (-1478.099) (-1472.184) (-1477.210) [-1474.014] * (-1472.886) [-1470.238] (-1473.133) (-1476.150) -- 0:00:28
Average standard deviation of split frequencies: 0.007523
580500 -- (-1472.877) [-1472.954] (-1476.633) (-1476.795) * [-1473.390] (-1474.500) (-1473.025) (-1473.714) -- 0:00:28
581000 -- (-1474.389) (-1472.837) (-1475.550) [-1475.063] * [-1471.905] (-1474.065) (-1471.084) (-1472.315) -- 0:00:28
581500 -- (-1474.486) [-1473.299] (-1475.341) (-1477.043) * [-1472.749] (-1470.252) (-1471.330) (-1477.012) -- 0:00:28
582000 -- (-1473.237) [-1476.058] (-1470.817) (-1480.070) * (-1474.121) (-1472.454) [-1470.771] (-1476.832) -- 0:00:28
582500 -- (-1472.578) (-1470.739) [-1473.383] (-1471.127) * (-1471.269) (-1472.484) [-1472.206] (-1476.106) -- 0:00:28
583000 -- [-1472.184] (-1472.860) (-1473.623) (-1473.464) * [-1472.667] (-1473.579) (-1474.562) (-1475.191) -- 0:00:28
583500 -- (-1475.526) (-1473.877) (-1472.195) [-1470.121] * (-1473.029) (-1472.776) [-1471.155] (-1474.375) -- 0:00:28
584000 -- (-1470.999) (-1473.330) (-1475.419) [-1470.566] * (-1472.066) (-1474.366) [-1475.586] (-1474.700) -- 0:00:28
584500 -- [-1471.157] (-1473.122) (-1475.173) (-1473.770) * (-1472.433) (-1472.878) [-1470.469] (-1473.771) -- 0:00:28
585000 -- (-1475.009) [-1471.786] (-1473.379) (-1476.192) * (-1474.956) [-1474.460] (-1475.540) (-1470.530) -- 0:00:28
Average standard deviation of split frequencies: 0.008346
585500 -- [-1473.929] (-1473.198) (-1474.273) (-1471.530) * (-1471.364) (-1470.164) (-1472.537) [-1474.008] -- 0:00:28
586000 -- (-1474.638) (-1473.754) [-1472.355] (-1473.794) * (-1472.394) (-1470.454) [-1471.156] (-1476.185) -- 0:00:28
586500 -- (-1471.222) (-1471.998) (-1472.974) [-1471.769] * (-1475.781) (-1473.444) [-1473.049] (-1478.304) -- 0:00:28
587000 -- (-1471.623) [-1470.563] (-1473.636) (-1472.227) * (-1471.883) (-1475.407) [-1472.237] (-1482.349) -- 0:00:28
587500 -- [-1472.820] (-1471.890) (-1476.876) (-1473.529) * (-1477.943) [-1474.481] (-1482.422) (-1475.343) -- 0:00:28
588000 -- (-1471.512) (-1474.314) [-1474.948] (-1477.073) * [-1475.554] (-1472.049) (-1476.883) (-1474.588) -- 0:00:28
588500 -- (-1472.854) (-1473.418) (-1473.519) [-1476.588] * (-1473.755) (-1471.225) (-1473.136) [-1474.020] -- 0:00:28
589000 -- [-1472.905] (-1471.784) (-1475.655) (-1471.335) * (-1472.813) (-1472.723) [-1475.068] (-1476.781) -- 0:00:28
589500 -- (-1470.389) (-1473.204) [-1475.766] (-1471.300) * (-1475.744) (-1475.551) [-1472.623] (-1476.418) -- 0:00:28
590000 -- [-1476.675] (-1474.497) (-1472.582) (-1470.966) * (-1470.396) (-1473.236) [-1473.978] (-1474.166) -- 0:00:28
Average standard deviation of split frequencies: 0.008829
590500 -- (-1472.688) (-1472.656) (-1476.392) [-1474.258] * (-1472.899) (-1474.087) [-1472.670] (-1470.363) -- 0:00:28
591000 -- (-1474.762) (-1475.474) [-1476.759] (-1474.357) * (-1476.581) (-1478.664) [-1473.316] (-1474.242) -- 0:00:28
591500 -- (-1476.026) (-1478.289) [-1469.710] (-1476.705) * (-1474.988) (-1476.099) (-1475.608) [-1472.303] -- 0:00:28
592000 -- (-1474.542) [-1474.562] (-1474.225) (-1471.087) * [-1476.265] (-1470.809) (-1475.487) (-1473.169) -- 0:00:28
592500 -- (-1474.557) [-1476.630] (-1470.884) (-1472.123) * (-1473.715) (-1472.538) [-1471.640] (-1471.205) -- 0:00:28
593000 -- (-1473.261) (-1472.386) [-1473.361] (-1477.584) * [-1471.044] (-1472.117) (-1476.111) (-1472.629) -- 0:00:28
593500 -- [-1472.815] (-1471.077) (-1473.408) (-1471.715) * (-1472.521) (-1473.764) [-1472.180] (-1473.719) -- 0:00:28
594000 -- [-1472.250] (-1476.595) (-1475.215) (-1471.739) * [-1473.202] (-1473.303) (-1472.500) (-1472.299) -- 0:00:28
594500 -- (-1472.030) (-1474.325) (-1469.584) [-1473.571] * (-1473.703) (-1475.684) [-1472.059] (-1471.842) -- 0:00:27
595000 -- (-1472.122) (-1474.767) [-1475.772] (-1472.466) * (-1472.023) [-1471.356] (-1475.907) (-1476.736) -- 0:00:27
Average standard deviation of split frequencies: 0.008887
595500 -- (-1471.404) (-1476.149) [-1472.419] (-1474.185) * [-1470.213] (-1471.251) (-1473.280) (-1474.559) -- 0:00:27
596000 -- (-1473.154) (-1476.175) [-1471.956] (-1475.836) * (-1474.127) [-1472.314] (-1473.632) (-1472.558) -- 0:00:27
596500 -- (-1476.814) [-1471.111] (-1472.154) (-1474.662) * (-1479.602) [-1476.186] (-1475.979) (-1475.820) -- 0:00:27
597000 -- (-1472.317) (-1474.744) [-1472.125] (-1470.459) * (-1474.135) (-1473.112) (-1475.936) [-1476.016] -- 0:00:27
597500 -- (-1473.920) (-1476.333) (-1472.011) [-1473.211] * [-1472.417] (-1479.342) (-1471.446) (-1477.031) -- 0:00:27
598000 -- (-1476.075) [-1474.597] (-1474.518) (-1471.092) * (-1472.982) (-1475.248) (-1471.865) [-1476.747] -- 0:00:27
598500 -- [-1476.044] (-1472.779) (-1475.828) (-1470.959) * [-1472.936] (-1471.463) (-1474.962) (-1475.070) -- 0:00:27
599000 -- (-1474.284) (-1472.574) (-1472.113) [-1471.422] * (-1472.892) (-1470.149) [-1473.884] (-1474.697) -- 0:00:27
599500 -- (-1476.577) [-1473.544] (-1476.348) (-1475.769) * (-1475.875) (-1472.927) (-1473.130) [-1471.665] -- 0:00:27
600000 -- (-1475.370) (-1474.422) (-1472.496) [-1475.228] * (-1471.730) (-1475.311) [-1473.001] (-1475.963) -- 0:00:27
Average standard deviation of split frequencies: 0.008240
600500 -- [-1472.709] (-1470.905) (-1474.251) (-1471.752) * (-1473.283) (-1471.773) (-1477.703) [-1474.004] -- 0:00:27
601000 -- (-1471.320) (-1479.044) [-1476.868] (-1471.163) * [-1477.247] (-1471.498) (-1475.418) (-1471.574) -- 0:00:27
601500 -- (-1471.410) (-1470.843) (-1471.886) [-1472.544] * (-1475.864) (-1472.017) (-1476.991) [-1471.269] -- 0:00:27
602000 -- [-1470.679] (-1476.428) (-1473.608) (-1474.272) * (-1474.667) (-1472.413) [-1476.080] (-1471.419) -- 0:00:27
602500 -- (-1471.451) [-1476.900] (-1477.914) (-1474.309) * [-1476.406] (-1474.595) (-1476.415) (-1473.246) -- 0:00:27
603000 -- [-1478.211] (-1473.119) (-1473.617) (-1476.777) * (-1471.351) [-1473.434] (-1475.964) (-1469.868) -- 0:00:27
603500 -- (-1472.505) [-1472.244] (-1471.702) (-1472.786) * (-1475.579) (-1476.713) [-1474.101] (-1473.896) -- 0:00:27
604000 -- (-1473.839) (-1476.602) [-1470.179] (-1472.984) * (-1474.545) (-1476.068) (-1475.516) [-1470.862] -- 0:00:27
604500 -- (-1470.671) (-1471.496) [-1470.767] (-1472.877) * [-1472.251] (-1473.733) (-1475.144) (-1471.990) -- 0:00:27
605000 -- (-1472.637) (-1475.510) [-1474.226] (-1470.884) * (-1471.851) (-1473.937) (-1475.462) [-1471.080] -- 0:00:27
Average standard deviation of split frequencies: 0.008008
605500 -- (-1471.705) (-1474.559) [-1470.010] (-1474.115) * (-1475.883) [-1473.129] (-1475.324) (-1472.382) -- 0:00:27
606000 -- [-1472.825] (-1474.418) (-1469.768) (-1475.011) * (-1477.461) (-1472.344) [-1474.066] (-1472.316) -- 0:00:27
606500 -- (-1475.679) (-1473.103) [-1472.975] (-1472.522) * (-1474.499) (-1471.998) (-1473.205) [-1471.097] -- 0:00:27
607000 -- (-1473.829) (-1473.086) (-1473.070) [-1474.994] * (-1476.169) [-1473.512] (-1473.730) (-1471.013) -- 0:00:27
607500 -- (-1475.645) [-1473.384] (-1475.515) (-1471.192) * [-1471.477] (-1471.806) (-1472.776) (-1471.344) -- 0:00:27
608000 -- (-1473.926) (-1474.972) [-1474.224] (-1472.344) * (-1473.399) [-1470.087] (-1475.338) (-1474.721) -- 0:00:27
608500 -- (-1477.230) (-1473.295) [-1472.131] (-1476.068) * (-1475.270) [-1470.652] (-1477.607) (-1474.921) -- 0:00:27
609000 -- (-1470.503) (-1474.421) (-1474.098) [-1470.661] * (-1477.597) (-1474.526) (-1475.143) [-1472.879] -- 0:00:26
609500 -- (-1478.106) [-1475.946] (-1473.414) (-1475.372) * (-1478.024) (-1474.117) [-1470.773] (-1470.806) -- 0:00:26
610000 -- [-1472.113] (-1473.833) (-1471.615) (-1471.795) * (-1479.324) [-1472.763] (-1473.160) (-1473.724) -- 0:00:26
Average standard deviation of split frequencies: 0.007947
610500 -- (-1474.232) (-1473.435) [-1475.047] (-1472.387) * (-1472.150) [-1471.493] (-1475.577) (-1473.419) -- 0:00:26
611000 -- (-1474.311) [-1476.131] (-1475.997) (-1472.228) * (-1472.381) (-1471.682) [-1474.753] (-1470.582) -- 0:00:26
611500 -- (-1471.746) (-1476.428) [-1470.789] (-1474.454) * (-1473.993) (-1471.739) (-1477.169) [-1471.087] -- 0:00:26
612000 -- (-1470.899) (-1476.623) (-1472.947) [-1469.985] * (-1473.447) [-1474.667] (-1473.726) (-1472.740) -- 0:00:26
612500 -- (-1473.609) (-1473.069) (-1475.482) [-1472.565] * (-1472.958) (-1472.277) [-1474.610] (-1473.375) -- 0:00:26
613000 -- (-1476.258) (-1472.328) [-1474.724] (-1475.396) * (-1473.597) (-1475.488) (-1473.197) [-1475.001] -- 0:00:26
613500 -- (-1475.336) [-1470.996] (-1472.528) (-1472.964) * [-1475.066] (-1476.884) (-1478.356) (-1477.431) -- 0:00:26
614000 -- (-1471.655) [-1476.004] (-1472.776) (-1471.833) * (-1475.795) (-1482.663) (-1471.450) [-1472.962] -- 0:00:26
614500 -- (-1474.757) (-1474.256) (-1475.894) [-1473.011] * (-1477.920) (-1473.024) [-1474.223] (-1473.724) -- 0:00:26
615000 -- [-1472.289] (-1472.847) (-1471.654) (-1471.595) * [-1470.755] (-1470.833) (-1471.227) (-1474.562) -- 0:00:26
Average standard deviation of split frequencies: 0.007748
615500 -- (-1476.278) (-1470.518) [-1473.742] (-1474.030) * (-1472.470) [-1473.263] (-1474.572) (-1470.624) -- 0:00:26
616000 -- (-1470.487) (-1475.078) (-1475.730) [-1469.481] * (-1472.843) (-1471.657) (-1478.967) [-1473.181] -- 0:00:26
616500 -- (-1471.627) [-1473.153] (-1475.413) (-1471.127) * (-1472.774) (-1469.165) [-1470.792] (-1472.449) -- 0:00:26
617000 -- (-1473.404) (-1472.906) [-1473.959] (-1475.196) * (-1472.453) [-1469.893] (-1480.559) (-1478.051) -- 0:00:26
617500 -- [-1472.113] (-1472.103) (-1476.217) (-1470.822) * (-1474.439) (-1471.129) [-1474.232] (-1479.547) -- 0:00:26
618000 -- (-1480.392) (-1476.125) [-1474.637] (-1474.187) * [-1471.887] (-1473.037) (-1472.610) (-1475.071) -- 0:00:26
618500 -- [-1477.297] (-1478.495) (-1472.220) (-1471.970) * (-1473.805) (-1475.327) (-1472.880) [-1473.873] -- 0:00:26
619000 -- [-1470.930] (-1474.195) (-1478.685) (-1475.424) * [-1472.164] (-1472.108) (-1480.909) (-1474.165) -- 0:00:26
619500 -- [-1471.881] (-1473.643) (-1480.738) (-1476.989) * (-1472.606) [-1472.834] (-1476.116) (-1473.994) -- 0:00:26
620000 -- [-1472.763] (-1474.118) (-1472.489) (-1480.953) * [-1473.091] (-1470.579) (-1473.169) (-1473.646) -- 0:00:26
Average standard deviation of split frequencies: 0.008131
620500 -- [-1469.767] (-1473.717) (-1474.095) (-1476.177) * (-1472.166) [-1473.113] (-1475.520) (-1477.098) -- 0:00:26
621000 -- (-1475.348) (-1470.653) (-1471.486) [-1472.413] * (-1472.483) (-1472.396) (-1470.452) [-1471.885] -- 0:00:26
621500 -- (-1473.262) (-1475.913) (-1472.958) [-1471.686] * (-1474.274) (-1473.022) [-1472.747] (-1476.994) -- 0:00:26
622000 -- [-1475.298] (-1478.926) (-1476.753) (-1471.648) * (-1477.370) [-1471.989] (-1472.106) (-1477.860) -- 0:00:26
622500 -- (-1474.172) (-1475.209) [-1475.726] (-1472.665) * (-1473.972) (-1471.326) [-1473.744] (-1478.933) -- 0:00:26
623000 -- (-1474.440) (-1472.137) [-1475.949] (-1473.220) * (-1473.718) [-1473.409] (-1472.578) (-1472.544) -- 0:00:26
623500 -- (-1476.413) [-1476.022] (-1475.697) (-1472.911) * [-1471.932] (-1476.984) (-1473.051) (-1471.941) -- 0:00:25
624000 -- [-1473.914] (-1478.335) (-1474.173) (-1471.536) * [-1471.985] (-1472.744) (-1475.966) (-1472.721) -- 0:00:25
624500 -- (-1474.171) (-1477.418) (-1470.944) [-1473.079] * (-1473.259) [-1470.908] (-1474.832) (-1471.954) -- 0:00:25
625000 -- (-1477.283) [-1472.118] (-1475.796) (-1476.707) * (-1472.887) (-1473.788) [-1472.549] (-1471.492) -- 0:00:25
Average standard deviation of split frequencies: 0.007752
625500 -- (-1475.570) (-1475.639) (-1476.306) [-1473.653] * (-1475.267) (-1474.766) [-1475.074] (-1474.493) -- 0:00:25
626000 -- (-1474.383) (-1476.378) [-1476.781] (-1470.915) * (-1476.761) (-1474.280) [-1472.436] (-1476.800) -- 0:00:25
626500 -- (-1480.523) [-1475.564] (-1472.529) (-1472.821) * [-1476.286] (-1473.758) (-1474.663) (-1474.077) -- 0:00:25
627000 -- (-1476.073) (-1473.991) [-1471.004] (-1470.113) * (-1478.659) [-1471.973] (-1476.469) (-1470.693) -- 0:00:25
627500 -- (-1475.090) [-1472.681] (-1474.870) (-1472.588) * (-1475.151) (-1475.954) (-1473.065) [-1472.786] -- 0:00:25
628000 -- [-1481.082] (-1472.609) (-1472.016) (-1471.780) * [-1475.112] (-1471.336) (-1473.043) (-1478.639) -- 0:00:25
628500 -- (-1476.127) (-1470.996) (-1471.421) [-1473.296] * (-1474.898) (-1475.797) [-1471.115] (-1484.106) -- 0:00:25
629000 -- (-1476.449) (-1472.633) [-1471.740] (-1473.054) * (-1473.836) [-1471.489] (-1471.031) (-1480.049) -- 0:00:25
629500 -- (-1476.162) [-1474.182] (-1476.234) (-1479.272) * (-1472.245) [-1473.597] (-1473.399) (-1471.989) -- 0:00:25
630000 -- (-1473.894) (-1476.900) [-1471.301] (-1471.927) * (-1472.393) (-1471.760) (-1475.032) [-1474.122] -- 0:00:25
Average standard deviation of split frequencies: 0.007914
630500 -- (-1471.948) (-1476.434) (-1470.561) [-1471.168] * (-1473.594) (-1475.350) [-1471.196] (-1472.770) -- 0:00:25
631000 -- (-1471.879) (-1474.577) [-1475.651] (-1471.301) * (-1475.862) (-1471.240) (-1475.959) [-1471.672] -- 0:00:25
631500 -- [-1473.554] (-1473.228) (-1474.958) (-1476.152) * (-1474.976) [-1472.407] (-1474.094) (-1475.729) -- 0:00:25
632000 -- (-1475.353) (-1472.415) (-1471.787) [-1475.826] * [-1472.784] (-1471.079) (-1473.979) (-1474.430) -- 0:00:25
632500 -- (-1475.113) [-1472.139] (-1474.081) (-1472.812) * (-1473.158) [-1473.441] (-1474.398) (-1474.753) -- 0:00:25
633000 -- (-1472.705) (-1477.093) (-1470.687) [-1472.350] * (-1472.823) (-1472.840) [-1474.212] (-1471.228) -- 0:00:25
633500 -- [-1472.662] (-1472.170) (-1471.696) (-1475.707) * (-1471.348) (-1474.958) (-1472.559) [-1470.608] -- 0:00:25
634000 -- (-1472.728) (-1473.156) [-1471.391] (-1474.925) * (-1478.957) (-1472.718) [-1472.405] (-1472.448) -- 0:00:25
634500 -- (-1472.221) [-1472.995] (-1470.961) (-1474.485) * (-1477.768) (-1474.378) [-1474.022] (-1478.705) -- 0:00:25
635000 -- (-1473.105) (-1471.241) (-1472.354) [-1471.719] * (-1474.806) (-1474.582) (-1473.050) [-1470.150] -- 0:00:25
Average standard deviation of split frequencies: 0.008061
635500 -- (-1472.447) [-1472.710] (-1473.218) (-1474.366) * (-1476.967) [-1473.959] (-1472.894) (-1471.751) -- 0:00:25
636000 -- (-1474.784) (-1474.250) (-1472.594) [-1469.835] * (-1472.334) (-1471.757) [-1473.054] (-1471.623) -- 0:00:25
636500 -- (-1472.539) [-1474.350] (-1475.342) (-1470.542) * [-1472.776] (-1470.625) (-1474.515) (-1476.256) -- 0:00:25
637000 -- [-1474.473] (-1473.482) (-1471.641) (-1472.966) * (-1475.518) (-1472.696) (-1471.280) [-1469.980] -- 0:00:25
637500 -- [-1474.616] (-1473.759) (-1471.669) (-1472.030) * (-1473.661) (-1475.625) (-1478.051) [-1471.026] -- 0:00:25
638000 -- (-1472.942) (-1471.677) [-1472.773] (-1476.474) * [-1471.540] (-1474.460) (-1473.369) (-1476.913) -- 0:00:24
638500 -- [-1473.668] (-1472.511) (-1472.740) (-1476.363) * [-1476.129] (-1475.827) (-1475.076) (-1471.317) -- 0:00:24
639000 -- (-1472.514) (-1473.512) [-1470.967] (-1475.753) * (-1477.647) [-1477.372] (-1472.797) (-1474.349) -- 0:00:24
639500 -- [-1470.752] (-1471.545) (-1469.973) (-1477.240) * (-1478.078) (-1471.166) (-1477.372) [-1475.396] -- 0:00:24
640000 -- (-1474.346) [-1473.451] (-1472.832) (-1472.495) * (-1472.217) [-1472.994] (-1474.749) (-1478.231) -- 0:00:24
Average standard deviation of split frequencies: 0.007680
640500 -- [-1472.806] (-1471.494) (-1472.449) (-1473.469) * [-1474.553] (-1478.666) (-1474.122) (-1473.507) -- 0:00:24
641000 -- [-1472.309] (-1477.783) (-1483.476) (-1470.879) * (-1471.876) (-1471.777) (-1476.219) [-1472.954] -- 0:00:24
641500 -- (-1475.861) [-1474.940] (-1472.686) (-1470.959) * (-1478.678) [-1471.802] (-1473.005) (-1474.138) -- 0:00:24
642000 -- (-1471.192) (-1475.039) (-1471.436) [-1472.095] * (-1477.200) (-1477.134) (-1476.179) [-1471.651] -- 0:00:24
642500 -- (-1472.500) [-1474.392] (-1472.082) (-1470.721) * (-1470.267) (-1475.971) (-1475.160) [-1471.897] -- 0:00:24
643000 -- (-1473.400) (-1472.178) [-1474.580] (-1472.195) * (-1472.105) [-1476.722] (-1474.916) (-1473.187) -- 0:00:24
643500 -- [-1473.784] (-1473.181) (-1473.720) (-1474.163) * [-1473.097] (-1470.059) (-1474.070) (-1470.843) -- 0:00:24
644000 -- (-1472.859) (-1475.049) [-1476.652] (-1473.363) * [-1470.881] (-1473.898) (-1477.724) (-1475.224) -- 0:00:24
644500 -- (-1474.852) (-1476.712) [-1474.959] (-1473.554) * (-1473.675) [-1475.290] (-1476.230) (-1474.642) -- 0:00:24
645000 -- (-1475.905) (-1472.723) [-1473.226] (-1475.482) * (-1472.276) [-1472.814] (-1471.116) (-1473.428) -- 0:00:24
Average standard deviation of split frequencies: 0.007890
645500 -- (-1473.553) [-1478.453] (-1474.682) (-1472.067) * (-1471.820) (-1470.023) (-1481.523) [-1472.752] -- 0:00:24
646000 -- (-1473.194) (-1477.038) (-1473.624) [-1470.728] * (-1474.585) [-1470.246] (-1472.601) (-1480.214) -- 0:00:24
646500 -- (-1472.096) (-1478.522) (-1474.290) [-1473.880] * (-1473.907) (-1474.812) (-1474.433) [-1473.733] -- 0:00:24
647000 -- (-1472.174) [-1475.294] (-1473.272) (-1474.883) * [-1474.745] (-1479.006) (-1473.640) (-1475.670) -- 0:00:24
647500 -- (-1472.262) (-1475.969) (-1473.505) [-1472.833] * (-1471.547) (-1476.271) [-1476.349] (-1473.268) -- 0:00:24
648000 -- (-1473.740) (-1474.060) (-1477.679) [-1472.994] * (-1473.813) (-1472.811) (-1471.867) [-1473.668] -- 0:00:24
648500 -- (-1469.962) (-1472.109) (-1470.952) [-1475.025] * (-1472.986) (-1473.025) [-1476.542] (-1472.153) -- 0:00:24
649000 -- (-1475.933) (-1476.262) (-1479.338) [-1475.204] * (-1474.349) [-1474.602] (-1474.793) (-1480.289) -- 0:00:24
649500 -- (-1475.323) (-1476.099) (-1474.564) [-1473.803] * [-1469.901] (-1473.548) (-1472.886) (-1472.229) -- 0:00:24
650000 -- [-1473.456] (-1476.500) (-1473.554) (-1475.121) * (-1475.102) [-1475.219] (-1475.036) (-1472.571) -- 0:00:24
Average standard deviation of split frequencies: 0.007426
650500 -- (-1474.186) [-1475.965] (-1475.121) (-1470.916) * (-1470.965) (-1475.282) [-1475.253] (-1473.384) -- 0:00:24
651000 -- (-1472.006) [-1476.671] (-1475.811) (-1474.604) * (-1473.731) (-1472.368) [-1473.296] (-1477.391) -- 0:00:24
651500 -- (-1479.698) [-1475.595] (-1478.043) (-1477.186) * (-1472.832) [-1473.943] (-1471.758) (-1472.248) -- 0:00:24
652000 -- (-1478.494) (-1472.182) (-1482.192) [-1470.903] * (-1477.647) (-1472.015) (-1471.114) [-1478.390] -- 0:00:24
652500 -- [-1471.843] (-1473.262) (-1481.374) (-1471.190) * (-1471.987) (-1474.806) [-1472.699] (-1473.271) -- 0:00:23
653000 -- (-1477.530) (-1471.887) (-1478.552) [-1469.927] * (-1471.377) (-1472.858) (-1476.174) [-1472.424] -- 0:00:23
653500 -- (-1475.291) [-1470.515] (-1474.843) (-1474.228) * [-1471.392] (-1476.860) (-1475.533) (-1470.315) -- 0:00:23
654000 -- (-1472.313) [-1475.099] (-1476.278) (-1473.983) * (-1473.576) [-1477.597] (-1472.765) (-1475.032) -- 0:00:23
654500 -- (-1471.740) (-1470.509) (-1477.427) [-1474.349] * (-1472.894) [-1471.191] (-1474.610) (-1473.097) -- 0:00:23
655000 -- (-1472.945) (-1475.366) (-1475.680) [-1473.744] * (-1475.720) (-1471.870) [-1471.191] (-1472.789) -- 0:00:23
Average standard deviation of split frequencies: 0.008454
655500 -- (-1473.286) (-1476.006) [-1475.693] (-1474.273) * [-1475.070] (-1472.831) (-1476.909) (-1472.374) -- 0:00:23
656000 -- [-1471.633] (-1471.701) (-1472.906) (-1470.848) * (-1478.910) (-1470.976) (-1477.660) [-1475.081] -- 0:00:23
656500 -- (-1471.193) (-1476.896) [-1472.445] (-1474.638) * [-1473.712] (-1471.117) (-1475.567) (-1477.828) -- 0:00:23
657000 -- (-1471.533) [-1474.005] (-1472.148) (-1471.668) * [-1471.696] (-1472.479) (-1475.118) (-1473.115) -- 0:00:23
657500 -- (-1477.784) (-1473.870) (-1475.170) [-1469.717] * (-1472.434) (-1473.892) [-1470.838] (-1476.875) -- 0:00:23
658000 -- [-1475.434] (-1473.033) (-1473.867) (-1469.997) * [-1471.143] (-1475.527) (-1474.820) (-1474.742) -- 0:00:23
658500 -- (-1472.879) [-1475.560] (-1475.216) (-1473.910) * (-1473.769) [-1476.155] (-1473.901) (-1472.952) -- 0:00:23
659000 -- (-1473.891) (-1475.453) (-1471.305) [-1471.478] * (-1473.863) (-1472.451) [-1478.040] (-1472.006) -- 0:00:23
659500 -- (-1472.587) [-1474.852] (-1471.564) (-1473.081) * (-1474.574) [-1472.132] (-1475.643) (-1473.493) -- 0:00:23
660000 -- (-1472.404) (-1472.399) [-1472.064] (-1472.967) * (-1473.958) [-1470.300] (-1480.173) (-1474.360) -- 0:00:23
Average standard deviation of split frequencies: 0.008059
660500 -- (-1475.191) [-1474.676] (-1474.846) (-1474.710) * (-1474.892) [-1470.521] (-1479.654) (-1477.584) -- 0:00:23
661000 -- (-1471.672) (-1471.918) (-1472.843) [-1472.692] * (-1473.371) (-1472.133) (-1486.009) [-1469.785] -- 0:00:23
661500 -- (-1470.422) (-1471.548) [-1474.661] (-1472.231) * [-1473.186] (-1470.041) (-1473.583) (-1470.329) -- 0:00:23
662000 -- (-1470.025) [-1473.571] (-1474.616) (-1470.703) * (-1479.983) [-1476.331] (-1471.540) (-1476.477) -- 0:00:23
662500 -- (-1480.225) (-1473.194) (-1473.478) [-1472.419] * (-1471.108) (-1473.199) (-1473.331) [-1472.097] -- 0:00:23
663000 -- [-1471.666] (-1473.599) (-1474.212) (-1476.019) * (-1470.640) (-1473.950) (-1475.140) [-1471.447] -- 0:00:23
663500 -- [-1474.066] (-1472.183) (-1473.299) (-1476.878) * (-1473.717) (-1474.925) (-1477.883) [-1471.338] -- 0:00:23
664000 -- (-1470.968) (-1477.123) (-1471.453) [-1473.298] * (-1471.891) (-1471.235) [-1471.860] (-1471.080) -- 0:00:23
664500 -- (-1472.887) [-1471.495] (-1472.103) (-1473.537) * (-1472.536) (-1474.394) (-1474.004) [-1471.703] -- 0:00:23
665000 -- (-1473.242) [-1471.077] (-1473.406) (-1472.441) * (-1474.194) (-1472.650) (-1474.770) [-1472.507] -- 0:00:23
Average standard deviation of split frequencies: 0.008077
665500 -- [-1471.432] (-1473.075) (-1476.726) (-1473.422) * (-1472.318) (-1472.098) (-1475.305) [-1472.161] -- 0:00:23
666000 -- [-1474.143] (-1473.205) (-1474.105) (-1474.123) * (-1474.927) (-1471.724) (-1478.341) [-1471.884] -- 0:00:23
666500 -- [-1470.066] (-1475.261) (-1472.533) (-1478.461) * (-1472.134) [-1471.537] (-1476.122) (-1472.959) -- 0:00:23
667000 -- (-1471.966) [-1471.257] (-1477.874) (-1472.056) * (-1473.290) (-1473.421) [-1471.687] (-1473.051) -- 0:00:22
667500 -- (-1473.736) [-1472.018] (-1477.679) (-1473.482) * [-1471.461] (-1471.352) (-1475.814) (-1470.067) -- 0:00:22
668000 -- (-1472.626) [-1472.853] (-1472.301) (-1473.828) * (-1474.396) (-1472.475) [-1473.918] (-1477.711) -- 0:00:22
668500 -- (-1474.206) [-1474.584] (-1471.152) (-1471.639) * (-1479.588) (-1474.197) (-1473.487) [-1475.093] -- 0:00:22
669000 -- (-1471.750) (-1473.863) (-1472.215) [-1470.345] * (-1480.153) (-1472.245) [-1471.648] (-1473.535) -- 0:00:22
669500 -- (-1471.850) (-1472.882) (-1474.822) [-1470.788] * (-1478.764) (-1473.399) [-1469.385] (-1471.148) -- 0:00:22
670000 -- (-1474.025) (-1478.106) [-1471.073] (-1473.565) * (-1472.132) (-1476.065) (-1472.389) [-1473.068] -- 0:00:22
Average standard deviation of split frequencies: 0.007773
670500 -- [-1473.185] (-1473.447) (-1470.446) (-1474.001) * [-1470.216] (-1476.717) (-1477.779) (-1470.913) -- 0:00:22
671000 -- (-1473.932) (-1476.191) [-1471.706] (-1469.820) * (-1478.319) (-1472.141) [-1471.582] (-1472.669) -- 0:00:22
671500 -- (-1472.601) [-1471.943] (-1474.267) (-1472.580) * (-1475.088) (-1474.249) (-1472.553) [-1471.508] -- 0:00:22
672000 -- (-1471.903) (-1474.922) [-1470.952] (-1471.577) * [-1476.105] (-1473.999) (-1474.766) (-1474.002) -- 0:00:22
672500 -- [-1471.328] (-1471.701) (-1479.123) (-1469.981) * (-1473.904) (-1470.840) (-1476.342) [-1472.228] -- 0:00:22
673000 -- (-1471.069) (-1475.873) [-1474.973] (-1471.323) * (-1476.047) (-1470.780) (-1473.252) [-1470.266] -- 0:00:22
673500 -- (-1471.205) (-1481.870) (-1473.961) [-1468.650] * (-1472.777) [-1474.530] (-1471.222) (-1472.687) -- 0:00:22
674000 -- [-1473.406] (-1477.590) (-1477.531) (-1470.026) * (-1474.115) [-1470.593] (-1473.202) (-1471.455) -- 0:00:22
674500 -- (-1478.278) [-1471.348] (-1473.728) (-1475.045) * (-1472.473) [-1474.823] (-1471.631) (-1473.849) -- 0:00:22
675000 -- (-1477.345) (-1477.718) [-1471.715] (-1470.082) * (-1477.253) (-1473.827) (-1474.414) [-1471.428] -- 0:00:22
Average standard deviation of split frequencies: 0.007876
675500 -- [-1471.684] (-1474.587) (-1476.099) (-1472.470) * (-1473.464) [-1474.343] (-1475.071) (-1473.337) -- 0:00:22
676000 -- (-1471.965) (-1480.749) [-1472.953] (-1471.135) * (-1473.971) (-1474.992) (-1470.806) [-1471.532] -- 0:00:22
676500 -- (-1472.868) (-1473.052) (-1471.030) [-1473.498] * [-1472.908] (-1472.376) (-1472.458) (-1471.111) -- 0:00:21
677000 -- (-1472.866) (-1471.402) [-1471.730] (-1473.595) * (-1470.591) (-1475.546) (-1475.678) [-1472.017] -- 0:00:22
677500 -- (-1476.166) (-1472.436) [-1473.335] (-1473.254) * (-1473.350) [-1477.314] (-1474.487) (-1470.904) -- 0:00:22
678000 -- [-1472.317] (-1475.558) (-1471.912) (-1471.216) * (-1470.157) (-1472.708) (-1471.051) [-1474.681] -- 0:00:22
678500 -- (-1472.607) (-1477.302) (-1472.236) [-1475.941] * (-1472.147) [-1475.831] (-1474.080) (-1472.356) -- 0:00:22
679000 -- (-1473.370) (-1474.643) (-1480.346) [-1473.335] * (-1472.406) (-1475.745) (-1477.634) [-1472.048] -- 0:00:22
679500 -- [-1473.089] (-1475.728) (-1474.225) (-1471.711) * (-1473.758) [-1470.458] (-1480.027) (-1472.289) -- 0:00:22
680000 -- (-1477.525) (-1476.751) [-1473.715] (-1473.801) * (-1471.126) (-1474.140) [-1474.516] (-1472.476) -- 0:00:22
Average standard deviation of split frequencies: 0.007532
680500 -- [-1473.409] (-1473.409) (-1477.792) (-1477.704) * [-1476.089] (-1472.701) (-1473.625) (-1473.860) -- 0:00:22
681000 -- [-1478.412] (-1476.500) (-1472.222) (-1473.998) * [-1473.306] (-1475.919) (-1472.639) (-1472.604) -- 0:00:22
681500 -- (-1475.062) (-1477.410) [-1472.395] (-1471.305) * (-1470.219) (-1476.251) (-1475.893) [-1473.652] -- 0:00:21
682000 -- [-1479.930] (-1471.653) (-1472.992) (-1470.012) * [-1471.486] (-1473.307) (-1471.828) (-1471.747) -- 0:00:21
682500 -- (-1476.036) [-1470.989] (-1472.718) (-1473.095) * [-1474.781] (-1475.647) (-1472.672) (-1475.743) -- 0:00:21
683000 -- [-1474.832] (-1472.147) (-1474.845) (-1475.272) * (-1476.261) (-1473.779) [-1470.545] (-1473.991) -- 0:00:21
683500 -- (-1481.041) (-1475.850) (-1473.955) [-1473.556] * [-1473.610] (-1473.037) (-1471.352) (-1473.712) -- 0:00:21
684000 -- (-1470.872) (-1473.373) (-1472.718) [-1478.657] * (-1473.088) (-1470.722) (-1471.316) [-1472.209] -- 0:00:21
684500 -- (-1471.833) [-1472.271] (-1471.983) (-1475.822) * [-1471.741] (-1472.798) (-1472.618) (-1472.046) -- 0:00:21
685000 -- (-1472.950) (-1473.295) [-1472.820] (-1475.729) * (-1470.309) [-1472.834] (-1470.916) (-1474.386) -- 0:00:21
Average standard deviation of split frequencies: 0.008117
685500 -- [-1472.303] (-1475.814) (-1473.834) (-1473.009) * (-1471.182) (-1472.626) [-1476.689] (-1471.710) -- 0:00:21
686000 -- (-1473.216) (-1475.947) (-1473.889) [-1472.859] * [-1478.660] (-1476.457) (-1474.436) (-1472.387) -- 0:00:21
686500 -- (-1470.394) [-1480.072] (-1473.439) (-1471.967) * (-1472.368) (-1477.258) [-1472.373] (-1476.184) -- 0:00:21
687000 -- [-1472.054] (-1482.747) (-1473.756) (-1475.108) * (-1475.892) [-1472.018] (-1475.769) (-1473.801) -- 0:00:21
687500 -- (-1476.143) (-1477.135) (-1472.984) [-1474.787] * [-1473.632] (-1475.093) (-1476.079) (-1478.615) -- 0:00:21
688000 -- (-1476.042) (-1477.698) [-1475.364] (-1472.820) * (-1472.605) [-1473.032] (-1472.462) (-1474.002) -- 0:00:21
688500 -- (-1471.743) [-1476.935] (-1476.907) (-1475.291) * (-1473.449) (-1472.285) [-1471.424] (-1477.690) -- 0:00:21
689000 -- [-1473.264] (-1475.662) (-1475.508) (-1471.584) * (-1470.561) (-1473.376) (-1473.343) [-1475.097] -- 0:00:21
689500 -- (-1472.820) (-1476.917) [-1476.254] (-1472.850) * (-1473.730) (-1475.472) [-1478.686] (-1478.156) -- 0:00:21
690000 -- (-1473.176) (-1472.501) (-1473.712) [-1470.412] * [-1472.233] (-1475.591) (-1478.652) (-1482.415) -- 0:00:21
Average standard deviation of split frequencies: 0.008318
690500 -- (-1473.019) [-1473.651] (-1472.437) (-1472.747) * (-1473.075) [-1475.942] (-1476.223) (-1475.331) -- 0:00:21
691000 -- (-1474.079) [-1473.940] (-1472.011) (-1472.897) * (-1473.889) (-1475.697) [-1475.004] (-1477.585) -- 0:00:21
691500 -- (-1474.003) (-1472.602) [-1475.795] (-1473.728) * (-1471.015) (-1475.227) (-1478.318) [-1474.716] -- 0:00:20
692000 -- [-1471.078] (-1473.781) (-1476.864) (-1473.634) * [-1475.519] (-1476.667) (-1475.464) (-1473.324) -- 0:00:21
692500 -- [-1476.449] (-1475.506) (-1478.396) (-1474.910) * [-1474.380] (-1472.736) (-1474.592) (-1475.048) -- 0:00:21
693000 -- (-1474.284) [-1472.772] (-1472.510) (-1472.762) * [-1472.886] (-1473.871) (-1475.741) (-1472.561) -- 0:00:21
693500 -- (-1472.805) [-1476.486] (-1474.000) (-1473.812) * (-1472.880) [-1474.142] (-1475.475) (-1472.075) -- 0:00:21
694000 -- (-1471.360) (-1473.176) [-1471.856] (-1473.093) * (-1473.513) (-1475.825) [-1470.707] (-1475.949) -- 0:00:21
694500 -- (-1472.722) (-1475.877) [-1470.753] (-1474.129) * [-1473.730] (-1475.559) (-1474.940) (-1475.535) -- 0:00:21
695000 -- [-1473.993] (-1470.884) (-1470.048) (-1471.561) * (-1475.226) (-1481.895) (-1473.879) [-1474.121] -- 0:00:21
Average standard deviation of split frequencies: 0.007916
695500 -- (-1471.877) (-1473.437) (-1476.502) [-1471.310] * (-1471.532) [-1472.477] (-1474.740) (-1473.412) -- 0:00:21
696000 -- (-1471.895) (-1473.229) (-1475.406) [-1470.332] * (-1470.621) (-1475.383) (-1478.399) [-1474.057] -- 0:00:20
696500 -- (-1473.498) (-1477.272) (-1476.574) [-1472.722] * [-1472.288] (-1470.681) (-1475.449) (-1475.411) -- 0:00:20
697000 -- (-1471.534) [-1472.258] (-1474.665) (-1473.050) * (-1473.558) [-1472.531] (-1475.460) (-1472.722) -- 0:00:20
697500 -- (-1471.961) (-1472.269) (-1471.056) [-1473.963] * (-1479.060) (-1473.178) [-1473.308] (-1476.230) -- 0:00:20
698000 -- (-1473.127) (-1471.462) [-1471.308] (-1472.695) * [-1473.036] (-1474.515) (-1473.727) (-1474.735) -- 0:00:20
698500 -- (-1477.428) (-1472.753) (-1479.237) [-1474.659] * [-1472.659] (-1472.256) (-1473.489) (-1472.513) -- 0:00:20
699000 -- (-1472.930) (-1474.457) (-1472.733) [-1476.203] * [-1470.800] (-1473.930) (-1472.597) (-1474.915) -- 0:00:20
699500 -- (-1478.041) (-1472.135) [-1475.765] (-1473.983) * (-1471.415) (-1473.157) (-1479.228) [-1472.483] -- 0:00:20
700000 -- (-1475.945) (-1471.992) (-1475.183) [-1476.696] * (-1474.355) (-1472.866) [-1472.654] (-1471.989) -- 0:00:20
Average standard deviation of split frequencies: 0.007233
700500 -- [-1472.887] (-1472.575) (-1473.187) (-1475.166) * (-1475.055) (-1477.764) (-1476.878) [-1472.888] -- 0:00:20
701000 -- (-1480.185) [-1478.619] (-1476.529) (-1475.643) * [-1475.587] (-1474.468) (-1477.340) (-1474.699) -- 0:00:20
701500 -- (-1475.703) (-1471.375) (-1477.791) [-1471.810] * (-1473.799) (-1475.583) [-1472.503] (-1472.544) -- 0:00:20
702000 -- (-1477.355) (-1473.595) (-1475.559) [-1471.235] * (-1475.221) [-1472.395] (-1474.084) (-1472.941) -- 0:00:20
702500 -- (-1477.294) (-1473.996) (-1475.507) [-1471.817] * [-1475.203] (-1476.120) (-1474.668) (-1471.938) -- 0:00:20
703000 -- (-1476.658) (-1472.116) (-1477.315) [-1473.137] * (-1472.646) [-1473.546] (-1478.178) (-1474.877) -- 0:00:20
703500 -- (-1472.530) (-1473.748) [-1475.755] (-1470.735) * (-1474.727) (-1474.184) (-1471.303) [-1475.325] -- 0:00:20
704000 -- (-1475.148) (-1472.479) (-1475.303) [-1475.086] * (-1472.477) [-1472.492] (-1471.511) (-1474.196) -- 0:00:20
704500 -- (-1472.302) [-1470.835] (-1475.573) (-1475.510) * [-1472.534] (-1472.716) (-1471.759) (-1479.145) -- 0:00:20
705000 -- (-1473.286) (-1472.146) [-1474.471] (-1474.830) * [-1471.802] (-1471.902) (-1473.644) (-1473.930) -- 0:00:20
Average standard deviation of split frequencies: 0.006761
705500 -- [-1473.801] (-1472.774) (-1476.398) (-1471.203) * (-1476.652) (-1472.783) (-1475.630) [-1476.367] -- 0:00:20
706000 -- [-1472.957] (-1475.340) (-1474.642) (-1470.307) * (-1472.655) (-1474.785) (-1475.558) [-1472.448] -- 0:00:19
706500 -- (-1473.889) [-1469.783] (-1476.299) (-1472.511) * (-1473.838) (-1472.950) (-1476.765) [-1478.780] -- 0:00:19
707000 -- (-1481.047) [-1473.382] (-1478.104) (-1475.844) * (-1470.886) (-1475.308) [-1479.731] (-1475.344) -- 0:00:20
707500 -- (-1482.187) (-1474.342) (-1475.655) [-1474.611] * [-1472.607] (-1473.778) (-1481.036) (-1475.546) -- 0:00:20
708000 -- [-1474.056] (-1475.353) (-1474.043) (-1474.523) * (-1471.849) [-1472.140] (-1472.010) (-1474.724) -- 0:00:20
708500 -- (-1472.865) [-1473.172] (-1475.066) (-1473.959) * (-1478.783) (-1471.754) [-1473.873] (-1471.116) -- 0:00:20
709000 -- (-1474.202) [-1475.061] (-1477.169) (-1472.195) * [-1474.477] (-1470.937) (-1472.948) (-1473.058) -- 0:00:20
709500 -- (-1471.842) [-1473.582] (-1476.961) (-1470.890) * (-1477.066) [-1473.606] (-1477.190) (-1473.005) -- 0:00:20
710000 -- (-1471.866) [-1473.476] (-1473.319) (-1471.930) * (-1475.301) (-1471.843) [-1472.064] (-1473.519) -- 0:00:20
Average standard deviation of split frequencies: 0.006854
710500 -- (-1472.956) (-1471.011) [-1473.036] (-1472.732) * (-1476.609) [-1471.916] (-1474.867) (-1472.711) -- 0:00:19
711000 -- [-1472.513] (-1471.537) (-1473.511) (-1471.740) * (-1474.793) [-1472.778] (-1473.458) (-1475.093) -- 0:00:19
711500 -- [-1473.080] (-1472.286) (-1473.766) (-1476.057) * [-1474.006] (-1470.896) (-1473.833) (-1475.504) -- 0:00:19
712000 -- (-1470.777) (-1473.178) (-1474.680) [-1474.241] * [-1474.558] (-1469.991) (-1472.613) (-1472.535) -- 0:00:19
712500 -- (-1471.614) (-1475.760) [-1474.533] (-1471.757) * (-1476.480) (-1472.748) (-1475.914) [-1469.639] -- 0:00:19
713000 -- (-1472.382) [-1474.187] (-1474.837) (-1471.786) * (-1475.755) [-1475.423] (-1470.699) (-1478.466) -- 0:00:19
713500 -- (-1472.734) [-1473.669] (-1479.157) (-1472.828) * [-1475.428] (-1473.030) (-1473.017) (-1478.150) -- 0:00:19
714000 -- [-1471.923] (-1470.451) (-1483.078) (-1474.224) * (-1474.028) [-1473.522] (-1473.487) (-1477.041) -- 0:00:19
714500 -- (-1471.841) [-1478.025] (-1472.802) (-1471.642) * [-1475.061] (-1474.739) (-1471.854) (-1472.751) -- 0:00:19
715000 -- (-1472.875) [-1471.780] (-1477.574) (-1470.081) * (-1478.178) (-1477.329) [-1470.914] (-1471.161) -- 0:00:19
Average standard deviation of split frequencies: 0.006408
715500 -- (-1472.941) (-1473.170) [-1477.731] (-1474.838) * (-1474.618) (-1473.695) (-1472.408) [-1475.233] -- 0:00:19
716000 -- (-1471.079) (-1476.690) [-1472.723] (-1475.319) * (-1473.680) (-1471.692) (-1473.356) [-1473.588] -- 0:00:19
716500 -- [-1472.330] (-1474.744) (-1472.403) (-1472.734) * (-1473.192) (-1470.621) (-1474.269) [-1471.632] -- 0:00:19
717000 -- (-1472.509) (-1473.014) (-1470.306) [-1471.619] * (-1473.641) [-1471.478] (-1475.992) (-1473.293) -- 0:00:19
717500 -- (-1476.643) (-1473.732) (-1472.841) [-1471.886] * (-1474.496) [-1471.199] (-1479.535) (-1473.892) -- 0:00:19
718000 -- [-1473.982] (-1473.263) (-1472.495) (-1472.036) * (-1475.134) (-1475.622) [-1476.769] (-1473.338) -- 0:00:19
718500 -- (-1476.846) [-1475.788] (-1471.312) (-1472.045) * (-1475.432) [-1475.200] (-1474.136) (-1473.288) -- 0:00:19
719000 -- (-1470.593) (-1472.690) [-1473.374] (-1472.485) * (-1472.831) (-1480.774) (-1471.172) [-1473.756] -- 0:00:19
719500 -- (-1473.797) (-1475.838) (-1476.895) [-1472.602] * [-1472.772] (-1484.344) (-1475.902) (-1474.056) -- 0:00:19
720000 -- [-1475.721] (-1476.551) (-1472.279) (-1472.032) * [-1475.639] (-1474.004) (-1472.207) (-1475.240) -- 0:00:19
Average standard deviation of split frequencies: 0.006890
720500 -- (-1473.597) (-1473.692) [-1475.972] (-1470.956) * (-1472.553) [-1474.780] (-1474.066) (-1477.005) -- 0:00:19
721000 -- [-1472.002] (-1472.827) (-1478.046) (-1478.427) * (-1478.355) (-1472.672) (-1475.420) [-1474.613] -- 0:00:18
721500 -- (-1475.216) [-1474.638] (-1471.197) (-1479.568) * [-1475.496] (-1472.221) (-1475.105) (-1478.548) -- 0:00:19
722000 -- (-1475.142) (-1476.897) (-1472.496) [-1475.679] * (-1473.264) [-1472.351] (-1476.480) (-1476.207) -- 0:00:19
722500 -- (-1471.813) (-1474.466) [-1474.000] (-1479.379) * (-1472.871) (-1473.649) [-1474.391] (-1474.036) -- 0:00:19
723000 -- [-1473.628] (-1473.080) (-1477.903) (-1477.900) * (-1471.814) [-1470.908] (-1474.456) (-1473.304) -- 0:00:19
723500 -- (-1471.818) [-1473.080] (-1476.061) (-1472.456) * [-1473.617] (-1479.674) (-1473.755) (-1476.346) -- 0:00:19
724000 -- (-1474.856) [-1473.735] (-1472.597) (-1475.145) * [-1472.240] (-1472.593) (-1471.730) (-1483.388) -- 0:00:19
724500 -- (-1472.045) [-1473.593] (-1474.165) (-1477.017) * [-1471.236] (-1473.373) (-1475.898) (-1473.731) -- 0:00:19
725000 -- (-1474.076) (-1476.272) (-1472.839) [-1472.093] * [-1472.586] (-1473.084) (-1472.934) (-1473.053) -- 0:00:18
Average standard deviation of split frequencies: 0.006580
725500 -- (-1473.244) (-1477.573) [-1473.708] (-1475.164) * (-1472.597) [-1473.880] (-1477.259) (-1475.771) -- 0:00:18
726000 -- (-1475.327) (-1475.878) (-1470.785) [-1473.323] * (-1473.986) [-1470.040] (-1475.233) (-1474.547) -- 0:00:18
726500 -- [-1475.725] (-1471.127) (-1475.780) (-1476.308) * (-1473.226) (-1472.363) (-1477.274) [-1472.538] -- 0:00:18
727000 -- (-1476.531) (-1478.746) (-1476.733) [-1471.768] * (-1474.461) (-1475.036) (-1473.186) [-1474.380] -- 0:00:18
727500 -- (-1477.731) (-1472.508) (-1475.383) [-1473.794] * (-1475.038) [-1473.084] (-1473.326) (-1474.496) -- 0:00:18
728000 -- (-1473.544) (-1473.967) [-1470.351] (-1474.920) * (-1476.132) [-1472.747] (-1476.977) (-1473.181) -- 0:00:18
728500 -- [-1471.810] (-1474.461) (-1471.385) (-1472.986) * [-1479.218] (-1475.403) (-1478.177) (-1471.555) -- 0:00:18
729000 -- (-1472.405) (-1476.904) (-1472.615) [-1474.177] * (-1473.207) [-1471.784] (-1475.190) (-1475.405) -- 0:00:18
729500 -- (-1471.611) (-1474.649) [-1473.675] (-1474.653) * (-1473.495) [-1472.297] (-1478.924) (-1471.356) -- 0:00:18
730000 -- (-1473.798) (-1473.588) (-1471.095) [-1470.446] * [-1475.362] (-1471.175) (-1477.118) (-1473.551) -- 0:00:18
Average standard deviation of split frequencies: 0.006495
730500 -- (-1473.164) (-1471.260) [-1473.281] (-1471.000) * [-1471.531] (-1472.674) (-1480.284) (-1470.962) -- 0:00:18
731000 -- (-1473.271) (-1475.795) (-1478.859) [-1472.767] * [-1473.362] (-1477.700) (-1480.234) (-1476.606) -- 0:00:18
731500 -- (-1473.746) (-1474.310) [-1479.033] (-1475.031) * (-1475.148) (-1470.954) (-1477.599) [-1476.625] -- 0:00:18
732000 -- [-1476.293] (-1472.260) (-1476.628) (-1473.005) * (-1473.047) (-1471.592) [-1473.866] (-1473.107) -- 0:00:18
732500 -- (-1473.516) (-1473.717) [-1475.008] (-1475.326) * [-1476.375] (-1474.005) (-1473.303) (-1472.670) -- 0:00:18
733000 -- (-1474.216) (-1474.916) [-1471.463] (-1472.094) * [-1474.206] (-1476.399) (-1470.538) (-1474.387) -- 0:00:18
733500 -- (-1475.693) [-1472.424] (-1471.860) (-1469.327) * (-1480.698) (-1474.915) (-1474.674) [-1471.410] -- 0:00:18
734000 -- (-1474.947) (-1475.942) (-1474.713) [-1473.631] * (-1474.205) (-1472.205) [-1472.608] (-1474.025) -- 0:00:18
734500 -- (-1474.139) (-1472.097) (-1473.437) [-1470.640] * (-1472.425) [-1472.821] (-1472.181) (-1475.431) -- 0:00:18
735000 -- (-1470.432) (-1471.640) [-1472.653] (-1474.214) * (-1477.191) (-1476.209) (-1472.492) [-1474.874] -- 0:00:18
Average standard deviation of split frequencies: 0.006618
735500 -- [-1472.623] (-1474.733) (-1476.970) (-1477.205) * (-1473.873) [-1472.259] (-1474.137) (-1476.855) -- 0:00:17
736000 -- (-1472.208) [-1474.335] (-1476.288) (-1472.219) * [-1475.025] (-1473.818) (-1473.129) (-1476.638) -- 0:00:17
736500 -- (-1472.179) (-1477.265) (-1475.768) [-1472.743] * (-1472.204) (-1470.829) [-1472.293] (-1475.752) -- 0:00:18
737000 -- (-1475.692) (-1475.836) (-1472.994) [-1471.916] * (-1472.654) (-1473.763) (-1473.536) [-1473.033] -- 0:00:18
737500 -- (-1476.321) (-1477.725) (-1473.757) [-1472.191] * (-1479.408) (-1472.270) (-1473.783) [-1470.711] -- 0:00:18
738000 -- (-1474.865) [-1478.022] (-1470.738) (-1473.896) * (-1475.691) (-1472.176) [-1471.219] (-1475.476) -- 0:00:18
738500 -- [-1474.880] (-1474.890) (-1473.857) (-1474.956) * (-1475.253) (-1472.878) (-1473.970) [-1471.135] -- 0:00:18
739000 -- (-1474.640) (-1474.263) [-1471.013] (-1476.089) * (-1473.157) (-1479.007) [-1472.773] (-1473.116) -- 0:00:18
739500 -- (-1471.698) (-1475.234) [-1475.512] (-1478.693) * (-1471.737) (-1474.698) [-1479.292] (-1473.117) -- 0:00:17
740000 -- (-1476.602) [-1473.344] (-1472.872) (-1472.192) * (-1473.254) (-1479.423) [-1471.698] (-1473.890) -- 0:00:17
Average standard deviation of split frequencies: 0.006704
740500 -- (-1477.526) (-1474.951) (-1473.137) [-1473.227] * (-1473.007) (-1477.274) [-1471.425] (-1474.964) -- 0:00:17
741000 -- (-1475.677) [-1474.334] (-1475.714) (-1474.252) * (-1471.448) (-1471.095) [-1475.082] (-1472.184) -- 0:00:17
741500 -- (-1475.578) (-1472.033) (-1473.114) [-1474.753] * (-1471.100) [-1472.540] (-1473.120) (-1472.479) -- 0:00:17
742000 -- (-1477.973) (-1474.588) (-1474.713) [-1474.213] * (-1471.993) [-1471.770] (-1472.951) (-1471.586) -- 0:00:17
742500 -- (-1475.390) (-1471.505) (-1474.473) [-1472.358] * [-1472.484] (-1474.065) (-1471.804) (-1472.761) -- 0:00:17
743000 -- [-1474.763] (-1473.729) (-1473.547) (-1472.296) * (-1472.993) (-1474.006) [-1473.569] (-1478.548) -- 0:00:17
743500 -- (-1474.155) [-1472.803] (-1474.840) (-1473.408) * (-1476.912) [-1471.033] (-1473.971) (-1473.021) -- 0:00:17
744000 -- (-1475.120) (-1473.034) (-1475.972) [-1475.098] * (-1475.124) (-1474.659) (-1473.563) [-1476.275] -- 0:00:17
744500 -- (-1472.097) (-1472.844) (-1470.694) [-1473.678] * [-1477.150] (-1471.918) (-1469.826) (-1470.939) -- 0:00:17
745000 -- (-1472.879) (-1476.443) (-1471.366) [-1475.353] * (-1469.663) (-1472.935) (-1472.773) [-1473.904] -- 0:00:17
Average standard deviation of split frequencies: 0.006951
745500 -- [-1471.896] (-1473.666) (-1480.284) (-1477.068) * [-1472.931] (-1473.444) (-1474.229) (-1472.483) -- 0:00:17
746000 -- (-1473.452) (-1475.139) (-1473.207) [-1473.800] * (-1473.570) (-1473.156) [-1471.321] (-1472.021) -- 0:00:17
746500 -- (-1474.066) (-1478.402) (-1475.236) [-1470.412] * [-1474.447] (-1479.937) (-1472.342) (-1475.445) -- 0:00:17
747000 -- (-1476.281) [-1478.217] (-1477.730) (-1474.457) * (-1476.422) (-1480.287) (-1470.432) [-1471.667] -- 0:00:17
747500 -- (-1471.709) [-1472.012] (-1475.089) (-1474.745) * (-1476.216) [-1475.699] (-1473.810) (-1473.470) -- 0:00:17
748000 -- (-1475.005) (-1470.047) (-1474.990) [-1472.035] * [-1476.148] (-1472.650) (-1472.565) (-1478.857) -- 0:00:17
748500 -- [-1474.380] (-1474.610) (-1474.284) (-1474.144) * (-1477.128) [-1471.781] (-1473.522) (-1479.140) -- 0:00:17
749000 -- (-1472.768) (-1474.113) [-1472.346] (-1475.049) * (-1475.296) [-1472.035] (-1471.905) (-1473.845) -- 0:00:17
749500 -- [-1475.419] (-1478.944) (-1473.690) (-1475.071) * [-1470.766] (-1473.332) (-1473.802) (-1475.059) -- 0:00:17
750000 -- [-1471.840] (-1474.087) (-1474.291) (-1473.377) * [-1471.841] (-1470.861) (-1471.296) (-1475.407) -- 0:00:17
Average standard deviation of split frequencies: 0.007452
750500 -- (-1471.064) (-1475.480) (-1472.396) [-1471.158] * (-1472.949) (-1471.443) [-1470.681] (-1477.109) -- 0:00:16
751000 -- (-1475.882) (-1471.698) [-1473.916] (-1470.942) * (-1471.280) [-1472.136] (-1472.928) (-1472.397) -- 0:00:16
751500 -- (-1474.394) [-1473.265] (-1475.408) (-1470.246) * [-1472.119] (-1472.578) (-1474.897) (-1473.243) -- 0:00:17
752000 -- (-1471.783) (-1474.397) [-1472.417] (-1471.651) * (-1477.431) (-1474.866) [-1471.719] (-1470.522) -- 0:00:17
752500 -- (-1470.667) (-1475.206) (-1471.520) [-1473.527] * [-1470.462] (-1473.806) (-1471.638) (-1471.498) -- 0:00:17
753000 -- (-1471.474) (-1473.497) [-1471.501] (-1475.200) * (-1473.918) (-1471.610) [-1471.640] (-1474.856) -- 0:00:17
753500 -- (-1474.786) [-1471.554] (-1471.899) (-1482.097) * (-1472.064) [-1472.257] (-1475.887) (-1471.329) -- 0:00:17
754000 -- (-1474.245) [-1472.487] (-1473.245) (-1479.324) * (-1471.624) (-1472.595) [-1471.072] (-1475.122) -- 0:00:16
754500 -- (-1473.712) (-1474.960) (-1475.673) [-1471.581] * [-1470.931] (-1473.379) (-1474.190) (-1471.486) -- 0:00:16
755000 -- [-1472.589] (-1477.199) (-1476.947) (-1475.749) * (-1472.293) (-1472.588) [-1473.394] (-1476.259) -- 0:00:16
Average standard deviation of split frequencies: 0.007483
755500 -- [-1474.148] (-1473.919) (-1475.102) (-1474.373) * (-1472.133) (-1475.785) (-1474.125) [-1474.041] -- 0:00:16
756000 -- (-1473.845) (-1471.158) (-1470.904) [-1473.925] * (-1472.964) (-1473.916) (-1472.001) [-1471.207] -- 0:00:16
756500 -- (-1477.539) (-1473.694) [-1474.454] (-1471.974) * (-1472.551) (-1477.409) (-1472.029) [-1473.590] -- 0:00:16
757000 -- (-1471.759) (-1474.694) (-1471.284) [-1471.881] * [-1471.099] (-1470.559) (-1474.133) (-1471.829) -- 0:00:16
757500 -- (-1473.547) (-1471.788) (-1475.682) [-1474.319] * (-1470.962) [-1471.950] (-1472.969) (-1472.132) -- 0:00:16
758000 -- (-1471.001) (-1472.729) [-1474.652] (-1476.231) * (-1473.023) (-1474.290) (-1473.634) [-1470.789] -- 0:00:16
758500 -- [-1475.111] (-1474.450) (-1471.402) (-1472.235) * (-1475.034) (-1473.249) (-1475.417) [-1472.047] -- 0:00:16
759000 -- (-1470.272) (-1471.934) (-1472.437) [-1471.019] * (-1476.375) (-1472.993) (-1474.866) [-1476.776] -- 0:00:16
759500 -- (-1476.455) [-1474.725] (-1473.805) (-1473.676) * (-1474.435) (-1472.554) [-1473.085] (-1473.241) -- 0:00:16
760000 -- [-1476.095] (-1474.937) (-1472.110) (-1472.868) * [-1472.071] (-1474.720) (-1472.383) (-1475.378) -- 0:00:16
Average standard deviation of split frequencies: 0.007519
760500 -- [-1473.455] (-1478.007) (-1476.240) (-1479.836) * (-1474.783) (-1473.904) [-1472.583] (-1472.060) -- 0:00:16
761000 -- (-1477.328) (-1473.229) (-1473.478) [-1473.150] * (-1472.874) [-1471.916] (-1473.693) (-1473.807) -- 0:00:16
761500 -- [-1473.571] (-1478.605) (-1472.163) (-1471.653) * (-1477.075) (-1481.557) [-1472.861] (-1473.646) -- 0:00:16
762000 -- [-1471.557] (-1474.510) (-1470.782) (-1473.091) * [-1474.516] (-1472.573) (-1471.723) (-1478.434) -- 0:00:16
762500 -- (-1472.831) [-1473.901] (-1471.788) (-1474.522) * (-1474.374) (-1474.516) (-1470.831) [-1476.728] -- 0:00:16
763000 -- (-1474.486) (-1475.051) [-1473.645] (-1476.834) * [-1472.409] (-1474.304) (-1470.666) (-1475.039) -- 0:00:16
763500 -- (-1470.621) (-1475.534) [-1471.969] (-1473.727) * [-1471.559] (-1476.350) (-1471.110) (-1472.560) -- 0:00:16
764000 -- (-1477.403) [-1474.232] (-1472.122) (-1476.592) * [-1471.993] (-1473.584) (-1474.519) (-1476.287) -- 0:00:16
764500 -- (-1470.981) [-1474.254] (-1476.827) (-1476.940) * [-1472.805] (-1472.025) (-1470.979) (-1479.045) -- 0:00:16
765000 -- [-1469.499] (-1472.298) (-1473.748) (-1473.869) * [-1473.429] (-1475.684) (-1476.382) (-1472.334) -- 0:00:15
Average standard deviation of split frequencies: 0.007467
765500 -- (-1472.380) (-1474.999) (-1472.590) [-1472.542] * (-1474.099) [-1474.537] (-1469.862) (-1473.906) -- 0:00:15
766000 -- [-1472.055] (-1473.224) (-1477.865) (-1475.467) * (-1477.915) (-1474.979) (-1470.536) [-1474.322] -- 0:00:15
766500 -- (-1473.190) (-1473.102) (-1471.823) [-1472.925] * (-1475.907) (-1474.766) [-1472.840] (-1474.753) -- 0:00:16
767000 -- (-1472.593) (-1473.733) [-1470.800] (-1475.548) * (-1480.217) (-1478.679) [-1469.069] (-1470.659) -- 0:00:16
767500 -- [-1472.055] (-1476.968) (-1471.061) (-1472.624) * (-1472.099) (-1475.320) (-1469.444) [-1473.065] -- 0:00:16
768000 -- [-1473.628] (-1472.193) (-1474.436) (-1472.484) * (-1472.976) (-1474.739) [-1473.226] (-1477.205) -- 0:00:16
768500 -- (-1472.608) (-1475.596) [-1475.722] (-1475.301) * (-1473.180) (-1476.930) [-1471.403] (-1471.581) -- 0:00:15
769000 -- (-1471.555) (-1474.589) [-1472.295] (-1475.545) * [-1475.403] (-1475.039) (-1471.933) (-1472.575) -- 0:00:15
769500 -- (-1472.890) (-1473.786) [-1475.248] (-1474.375) * [-1475.947] (-1475.869) (-1471.569) (-1472.658) -- 0:00:15
770000 -- (-1472.647) (-1478.843) [-1472.780] (-1473.950) * (-1472.932) (-1478.252) [-1473.868] (-1472.607) -- 0:00:15
Average standard deviation of split frequencies: 0.007911
770500 -- (-1473.567) [-1472.809] (-1470.791) (-1476.800) * (-1476.183) (-1476.278) [-1471.821] (-1479.028) -- 0:00:15
771000 -- (-1470.734) (-1473.199) [-1470.759] (-1474.820) * (-1474.262) [-1473.186] (-1476.079) (-1475.212) -- 0:00:15
771500 -- (-1472.402) (-1477.821) [-1473.552] (-1476.349) * (-1473.484) (-1476.283) (-1470.750) [-1475.491] -- 0:00:15
772000 -- (-1474.391) [-1472.453] (-1474.280) (-1473.816) * (-1474.987) (-1475.769) [-1471.025] (-1472.708) -- 0:00:15
772500 -- (-1476.285) [-1471.397] (-1476.710) (-1473.537) * (-1473.889) (-1472.210) (-1470.519) [-1473.017] -- 0:00:15
773000 -- (-1477.492) (-1470.992) (-1474.592) [-1473.576] * (-1471.940) [-1474.601] (-1471.835) (-1478.827) -- 0:00:15
773500 -- [-1475.936] (-1477.887) (-1476.817) (-1472.176) * (-1475.631) [-1472.060] (-1474.018) (-1481.749) -- 0:00:15
774000 -- [-1473.504] (-1472.553) (-1476.470) (-1476.545) * (-1477.652) (-1473.121) (-1476.194) [-1471.568] -- 0:00:15
774500 -- (-1473.878) (-1475.263) (-1474.815) [-1473.466] * (-1477.025) [-1473.519] (-1474.205) (-1476.685) -- 0:00:15
775000 -- (-1471.876) (-1472.708) [-1475.126] (-1471.820) * (-1472.561) [-1471.904] (-1472.767) (-1478.525) -- 0:00:15
Average standard deviation of split frequencies: 0.007978
775500 -- (-1472.771) (-1471.284) [-1473.928] (-1472.454) * [-1475.337] (-1475.085) (-1472.887) (-1472.481) -- 0:00:15
776000 -- (-1473.901) [-1471.828] (-1474.667) (-1475.163) * (-1477.143) [-1474.460] (-1474.884) (-1470.858) -- 0:00:15
776500 -- (-1477.177) (-1471.676) (-1472.973) [-1472.141] * (-1481.442) [-1474.841] (-1472.877) (-1472.684) -- 0:00:15
777000 -- [-1472.626] (-1472.357) (-1473.186) (-1474.886) * (-1479.771) (-1472.449) [-1473.722] (-1472.857) -- 0:00:15
777500 -- (-1473.225) [-1469.819] (-1470.977) (-1475.171) * [-1472.826] (-1476.354) (-1473.986) (-1471.357) -- 0:00:15
778000 -- [-1474.734] (-1473.434) (-1474.936) (-1476.246) * (-1471.451) (-1478.732) [-1473.664] (-1474.371) -- 0:00:15
778500 -- (-1476.061) (-1475.184) [-1470.861] (-1471.873) * (-1471.177) (-1474.404) (-1472.050) [-1473.650] -- 0:00:15
779000 -- [-1472.138] (-1473.267) (-1471.565) (-1471.236) * (-1470.398) (-1474.951) (-1471.162) [-1476.203] -- 0:00:15
779500 -- (-1474.616) (-1476.916) (-1470.985) [-1472.458] * [-1475.187] (-1476.384) (-1471.358) (-1472.890) -- 0:00:14
780000 -- (-1474.575) (-1479.682) [-1472.920] (-1475.625) * (-1471.478) (-1471.053) (-1473.650) [-1471.535] -- 0:00:14
Average standard deviation of split frequencies: 0.007568
780500 -- (-1475.092) (-1476.668) [-1472.273] (-1483.246) * (-1473.746) (-1471.878) [-1472.068] (-1475.134) -- 0:00:14
781000 -- (-1473.549) (-1479.760) [-1473.389] (-1479.177) * (-1473.481) (-1480.314) (-1474.494) [-1472.581] -- 0:00:14
781500 -- (-1473.245) [-1476.163] (-1474.641) (-1482.216) * [-1470.728] (-1474.844) (-1474.407) (-1475.146) -- 0:00:15
782000 -- (-1474.913) (-1479.827) [-1473.049] (-1481.400) * (-1473.837) (-1474.842) (-1474.948) [-1477.385] -- 0:00:15
782500 -- (-1475.114) (-1474.902) (-1473.051) [-1471.355] * [-1474.955] (-1476.899) (-1474.500) (-1472.342) -- 0:00:15
783000 -- [-1473.069] (-1473.565) (-1472.791) (-1472.036) * (-1473.951) (-1474.916) [-1472.291] (-1472.074) -- 0:00:14
783500 -- (-1472.832) [-1471.353] (-1478.480) (-1475.907) * (-1474.232) (-1478.636) (-1472.673) [-1471.301] -- 0:00:14
784000 -- (-1478.436) [-1475.395] (-1473.753) (-1472.320) * (-1472.429) (-1477.204) [-1472.691] (-1473.517) -- 0:00:14
784500 -- [-1473.874] (-1472.539) (-1476.345) (-1470.112) * (-1473.616) (-1472.560) [-1470.711] (-1472.086) -- 0:00:14
785000 -- [-1477.518] (-1473.017) (-1477.090) (-1474.822) * (-1472.964) (-1481.482) (-1474.477) [-1471.973] -- 0:00:14
Average standard deviation of split frequencies: 0.007637
785500 -- (-1473.165) [-1471.466] (-1473.441) (-1472.097) * (-1474.288) (-1481.870) [-1473.302] (-1472.421) -- 0:00:14
786000 -- [-1475.866] (-1472.310) (-1475.096) (-1472.744) * (-1476.097) (-1472.589) (-1474.947) [-1474.468] -- 0:00:14
786500 -- (-1476.057) (-1477.889) (-1477.413) [-1472.758] * (-1473.370) (-1475.972) (-1477.731) [-1471.034] -- 0:00:14
787000 -- (-1477.376) (-1477.071) (-1475.679) [-1472.782] * (-1472.436) (-1476.379) (-1476.153) [-1473.965] -- 0:00:14
787500 -- (-1473.065) (-1482.944) (-1475.155) [-1475.410] * (-1472.404) [-1474.491] (-1474.448) (-1481.567) -- 0:00:14
788000 -- (-1476.160) (-1475.463) (-1474.474) [-1472.790] * [-1471.903] (-1476.634) (-1473.929) (-1484.515) -- 0:00:14
788500 -- (-1470.958) (-1474.836) (-1475.011) [-1470.499] * (-1472.383) (-1475.167) [-1473.220] (-1476.363) -- 0:00:14
789000 -- (-1471.516) (-1473.137) [-1471.913] (-1473.892) * (-1474.755) (-1475.326) [-1473.221] (-1472.818) -- 0:00:14
789500 -- (-1473.702) (-1472.931) [-1471.322] (-1473.161) * [-1472.947] (-1475.904) (-1473.020) (-1474.506) -- 0:00:14
790000 -- (-1471.464) (-1471.215) (-1479.970) [-1471.658] * (-1471.499) (-1473.918) [-1475.894] (-1473.213) -- 0:00:14
Average standard deviation of split frequencies: 0.007433
790500 -- (-1470.096) (-1471.913) (-1473.921) [-1474.904] * (-1475.429) [-1472.441] (-1473.518) (-1474.278) -- 0:00:14
791000 -- [-1470.786] (-1471.497) (-1479.856) (-1476.814) * [-1476.680] (-1477.923) (-1474.786) (-1477.957) -- 0:00:14
791500 -- [-1472.004] (-1474.613) (-1470.877) (-1476.770) * (-1470.902) [-1471.300] (-1481.541) (-1475.006) -- 0:00:14
792000 -- (-1475.041) [-1473.226] (-1470.784) (-1473.749) * (-1473.668) (-1473.409) [-1473.058] (-1474.830) -- 0:00:14
792500 -- [-1477.148] (-1476.900) (-1471.599) (-1471.959) * [-1472.056] (-1474.844) (-1478.515) (-1473.293) -- 0:00:14
793000 -- [-1472.480] (-1478.008) (-1472.660) (-1472.451) * (-1472.302) (-1472.769) (-1478.876) [-1474.923] -- 0:00:14
793500 -- (-1470.517) (-1472.179) [-1473.339] (-1469.949) * (-1473.587) (-1472.339) [-1476.664] (-1475.878) -- 0:00:14
794000 -- [-1474.172] (-1480.506) (-1476.653) (-1473.275) * (-1472.161) (-1475.685) (-1477.542) [-1477.806] -- 0:00:14
794500 -- (-1470.610) (-1473.439) [-1471.840] (-1470.828) * (-1470.659) [-1472.630] (-1473.342) (-1475.829) -- 0:00:13
795000 -- (-1472.278) [-1473.197] (-1474.528) (-1473.516) * (-1474.049) [-1473.388] (-1474.712) (-1475.206) -- 0:00:13
Average standard deviation of split frequencies: 0.007225
795500 -- (-1472.822) (-1476.640) [-1473.254] (-1471.533) * [-1473.823] (-1471.473) (-1478.807) (-1474.591) -- 0:00:13
796000 -- (-1473.113) [-1472.323] (-1471.844) (-1476.535) * [-1472.288] (-1470.670) (-1475.058) (-1474.474) -- 0:00:13
796500 -- (-1472.999) (-1473.124) (-1472.486) [-1474.182] * [-1470.974] (-1473.732) (-1470.905) (-1474.315) -- 0:00:14
797000 -- [-1473.578] (-1472.126) (-1475.600) (-1475.126) * (-1475.170) [-1472.562] (-1473.283) (-1479.198) -- 0:00:14
797500 -- (-1471.028) (-1473.737) (-1471.060) [-1471.446] * [-1476.249] (-1471.092) (-1473.186) (-1474.155) -- 0:00:13
798000 -- (-1471.169) [-1474.334] (-1474.067) (-1476.350) * (-1473.567) (-1471.548) [-1472.152] (-1476.083) -- 0:00:13
798500 -- (-1475.936) (-1470.870) [-1475.251] (-1473.140) * (-1475.065) (-1472.439) (-1472.533) [-1474.023] -- 0:00:13
799000 -- [-1478.174] (-1473.628) (-1473.462) (-1470.672) * (-1480.240) (-1474.589) [-1473.269] (-1475.226) -- 0:00:13
799500 -- [-1474.392] (-1478.265) (-1478.428) (-1471.471) * (-1471.939) (-1475.437) [-1476.536] (-1474.599) -- 0:00:13
800000 -- [-1474.926] (-1484.457) (-1474.528) (-1472.056) * (-1473.545) (-1476.506) [-1472.596] (-1476.742) -- 0:00:13
Average standard deviation of split frequencies: 0.007418
800500 -- (-1475.462) [-1471.609] (-1473.827) (-1476.700) * (-1474.092) (-1473.751) (-1475.363) [-1472.407] -- 0:00:13
801000 -- (-1475.931) [-1472.274] (-1473.579) (-1476.398) * (-1474.636) (-1475.900) (-1475.422) [-1477.443] -- 0:00:13
801500 -- (-1473.169) (-1473.409) [-1473.816] (-1480.263) * [-1472.446] (-1471.477) (-1474.785) (-1475.368) -- 0:00:13
802000 -- (-1473.347) (-1474.129) [-1472.194] (-1477.649) * (-1471.241) (-1471.935) [-1473.675] (-1474.523) -- 0:00:13
802500 -- (-1477.922) (-1473.040) (-1477.147) [-1474.502] * (-1472.954) (-1471.313) (-1472.464) [-1474.612] -- 0:00:13
803000 -- (-1477.382) (-1472.760) (-1472.789) [-1472.054] * (-1477.562) (-1472.032) [-1474.656] (-1477.788) -- 0:00:13
803500 -- (-1475.587) (-1474.185) [-1471.911] (-1472.975) * (-1474.640) (-1474.157) [-1473.361] (-1472.873) -- 0:00:13
804000 -- (-1473.501) (-1473.889) (-1476.014) [-1474.930] * (-1474.488) (-1473.208) [-1473.442] (-1472.591) -- 0:00:13
804500 -- (-1476.103) (-1472.385) [-1473.087] (-1474.151) * (-1473.400) (-1475.111) (-1473.283) [-1472.240] -- 0:00:13
805000 -- (-1474.430) [-1473.874] (-1474.819) (-1475.182) * (-1477.811) [-1476.615] (-1473.506) (-1470.544) -- 0:00:13
Average standard deviation of split frequencies: 0.007291
805500 -- (-1472.844) (-1473.114) (-1472.099) [-1470.724] * (-1471.127) (-1472.159) [-1473.213] (-1474.452) -- 0:00:13
806000 -- (-1475.218) [-1471.471] (-1474.028) (-1474.463) * [-1473.640] (-1474.909) (-1471.551) (-1474.258) -- 0:00:13
806500 -- (-1475.228) [-1474.329] (-1475.860) (-1474.865) * (-1473.424) (-1478.724) (-1473.200) [-1470.930] -- 0:00:13
807000 -- (-1479.485) [-1473.284] (-1474.331) (-1470.120) * (-1470.709) (-1473.116) [-1474.590] (-1477.680) -- 0:00:13
807500 -- (-1476.599) (-1471.106) [-1472.906] (-1470.580) * (-1470.478) (-1474.776) (-1470.160) [-1471.060] -- 0:00:13
808000 -- (-1474.230) [-1471.563] (-1470.284) (-1472.666) * (-1470.371) (-1474.868) [-1471.761] (-1473.578) -- 0:00:13
808500 -- (-1472.440) (-1473.869) (-1473.310) [-1475.785] * (-1470.679) (-1472.233) [-1472.931] (-1472.083) -- 0:00:13
809000 -- (-1471.137) [-1471.246] (-1473.010) (-1474.398) * (-1470.856) (-1471.387) [-1471.859] (-1474.451) -- 0:00:12
809500 -- (-1472.817) [-1476.236] (-1473.989) (-1473.557) * [-1469.417] (-1475.872) (-1475.464) (-1471.570) -- 0:00:12
810000 -- [-1475.088] (-1476.278) (-1473.912) (-1475.070) * (-1474.804) (-1472.908) (-1474.487) [-1473.763] -- 0:00:12
Average standard deviation of split frequencies: 0.007288
810500 -- [-1478.273] (-1474.800) (-1472.194) (-1471.132) * (-1472.133) [-1472.838] (-1471.466) (-1475.394) -- 0:00:12
811000 -- (-1473.387) (-1472.302) [-1471.042] (-1475.007) * (-1473.750) [-1475.994] (-1472.854) (-1472.400) -- 0:00:12
811500 -- (-1471.106) [-1473.309] (-1470.587) (-1475.730) * (-1474.228) (-1472.467) [-1472.069] (-1472.674) -- 0:00:13
812000 -- (-1470.085) [-1470.753] (-1470.260) (-1473.732) * (-1474.005) (-1475.130) [-1474.328] (-1473.701) -- 0:00:12
812500 -- [-1473.281] (-1472.635) (-1471.542) (-1475.501) * [-1471.967] (-1475.520) (-1470.889) (-1479.736) -- 0:00:12
813000 -- [-1471.561] (-1471.503) (-1473.808) (-1473.456) * (-1473.389) (-1473.980) (-1476.287) [-1475.286] -- 0:00:12
813500 -- [-1473.343] (-1473.094) (-1472.614) (-1476.856) * (-1475.986) (-1478.820) (-1476.793) [-1471.599] -- 0:00:12
814000 -- (-1475.985) (-1471.750) [-1473.881] (-1473.830) * (-1473.668) [-1476.737] (-1475.374) (-1473.033) -- 0:00:12
814500 -- (-1473.877) [-1471.416] (-1471.151) (-1475.620) * (-1473.593) (-1476.270) [-1475.054] (-1478.634) -- 0:00:12
815000 -- (-1470.866) (-1472.001) (-1472.233) [-1472.636] * (-1471.055) (-1473.963) (-1472.400) [-1472.681] -- 0:00:12
Average standard deviation of split frequencies: 0.007433
815500 -- [-1473.774] (-1472.362) (-1473.254) (-1473.443) * (-1477.067) [-1476.497] (-1475.977) (-1473.846) -- 0:00:12
816000 -- (-1475.279) (-1471.389) (-1470.719) [-1471.330] * (-1471.563) [-1473.448] (-1476.108) (-1474.875) -- 0:00:12
816500 -- (-1474.519) (-1472.903) (-1474.915) [-1471.594] * [-1472.213] (-1475.361) (-1474.149) (-1474.461) -- 0:00:12
817000 -- (-1471.851) (-1477.750) [-1476.728] (-1474.114) * (-1474.123) [-1474.896] (-1476.694) (-1476.323) -- 0:00:12
817500 -- (-1472.107) (-1473.267) (-1475.410) [-1471.294] * (-1473.217) (-1473.119) [-1474.027] (-1474.217) -- 0:00:12
818000 -- (-1471.560) (-1471.587) [-1471.042] (-1474.177) * (-1477.514) [-1474.613] (-1474.639) (-1475.549) -- 0:00:12
818500 -- (-1476.055) (-1471.110) (-1473.719) [-1473.938] * [-1475.064] (-1475.502) (-1471.891) (-1473.338) -- 0:00:12
819000 -- (-1474.216) [-1471.074] (-1473.596) (-1473.675) * (-1476.387) [-1472.895] (-1470.534) (-1477.750) -- 0:00:12
819500 -- (-1479.488) (-1471.358) [-1475.000] (-1477.757) * (-1472.785) (-1470.738) (-1476.778) [-1471.218] -- 0:00:12
820000 -- [-1475.784] (-1472.021) (-1474.090) (-1473.986) * (-1476.315) (-1471.126) (-1475.028) [-1475.525] -- 0:00:12
Average standard deviation of split frequencies: 0.007812
820500 -- (-1473.256) (-1472.418) (-1479.424) [-1471.488] * (-1473.244) (-1473.527) (-1479.265) [-1474.633] -- 0:00:12
821000 -- [-1476.263] (-1471.481) (-1470.390) (-1470.378) * (-1475.500) [-1471.683] (-1476.979) (-1471.855) -- 0:00:12
821500 -- [-1471.137] (-1475.810) (-1473.288) (-1471.839) * (-1475.364) (-1470.657) (-1472.097) [-1472.189] -- 0:00:12
822000 -- (-1472.314) [-1470.708] (-1476.759) (-1473.933) * (-1471.435) (-1473.604) [-1472.262] (-1471.392) -- 0:00:12
822500 -- (-1475.815) (-1473.550) (-1469.960) [-1470.833] * (-1471.111) (-1474.651) [-1472.681] (-1475.897) -- 0:00:12
823000 -- [-1471.780] (-1470.667) (-1471.918) (-1471.834) * (-1473.004) (-1477.943) (-1472.321) [-1475.836] -- 0:00:12
823500 -- [-1471.661] (-1472.196) (-1470.161) (-1472.690) * [-1471.752] (-1476.558) (-1475.167) (-1474.451) -- 0:00:12
824000 -- (-1472.318) (-1472.002) (-1473.276) [-1474.408] * [-1470.329] (-1474.122) (-1472.009) (-1472.265) -- 0:00:11
824500 -- [-1472.642] (-1475.593) (-1476.299) (-1473.085) * (-1471.080) (-1472.874) [-1473.134] (-1475.695) -- 0:00:11
825000 -- (-1472.978) (-1474.294) (-1474.071) [-1470.938] * [-1469.973] (-1473.847) (-1471.220) (-1474.989) -- 0:00:11
Average standard deviation of split frequencies: 0.007153
825500 -- [-1477.237] (-1473.669) (-1471.234) (-1474.669) * (-1474.850) (-1475.435) (-1471.903) [-1474.476] -- 0:00:11
826000 -- (-1474.631) (-1472.357) [-1473.509] (-1474.709) * [-1471.753] (-1474.165) (-1470.922) (-1477.128) -- 0:00:11
826500 -- (-1476.909) (-1473.215) [-1474.992] (-1474.125) * (-1475.184) (-1471.598) [-1471.394] (-1475.445) -- 0:00:11
827000 -- [-1475.915] (-1474.053) (-1478.123) (-1472.032) * (-1473.660) (-1475.780) [-1471.202] (-1477.047) -- 0:00:11
827500 -- (-1475.151) (-1473.080) [-1475.942] (-1475.865) * (-1472.277) (-1473.242) [-1472.504] (-1472.040) -- 0:00:11
828000 -- [-1473.595] (-1473.979) (-1473.077) (-1473.375) * (-1474.019) [-1471.096] (-1473.471) (-1475.508) -- 0:00:11
828500 -- (-1474.367) (-1472.019) (-1475.179) [-1474.622] * (-1476.407) (-1474.656) [-1472.808] (-1478.762) -- 0:00:11
829000 -- (-1474.884) [-1470.987] (-1470.257) (-1474.015) * (-1471.374) (-1474.554) (-1471.328) [-1472.194] -- 0:00:11
829500 -- [-1472.143] (-1473.311) (-1470.855) (-1471.460) * [-1472.247] (-1474.327) (-1472.775) (-1471.413) -- 0:00:11
830000 -- (-1471.966) (-1472.455) [-1474.256] (-1473.987) * (-1472.274) [-1472.698] (-1472.256) (-1471.127) -- 0:00:11
Average standard deviation of split frequencies: 0.006848
830500 -- (-1473.430) [-1472.842] (-1476.126) (-1473.034) * (-1472.505) (-1473.993) (-1473.884) [-1472.271] -- 0:00:11
831000 -- (-1472.309) (-1473.331) (-1479.386) [-1475.706] * [-1474.972] (-1472.868) (-1473.546) (-1472.845) -- 0:00:11
831500 -- [-1472.055] (-1479.775) (-1479.884) (-1475.727) * (-1474.084) [-1474.112] (-1477.422) (-1473.678) -- 0:00:11
832000 -- (-1488.179) [-1476.427] (-1476.664) (-1476.912) * [-1478.723] (-1472.836) (-1473.394) (-1471.582) -- 0:00:11
832500 -- (-1472.007) (-1475.948) (-1475.556) [-1473.308] * (-1473.156) [-1472.804] (-1472.548) (-1472.417) -- 0:00:11
833000 -- [-1473.419] (-1477.729) (-1471.214) (-1476.386) * [-1477.268] (-1473.964) (-1472.453) (-1471.487) -- 0:00:11
833500 -- (-1474.507) (-1474.719) (-1476.514) [-1476.513] * (-1473.053) [-1469.781] (-1470.543) (-1475.291) -- 0:00:11
834000 -- (-1472.720) (-1475.781) [-1472.780] (-1473.884) * (-1476.141) (-1475.866) (-1475.500) [-1473.116] -- 0:00:11
834500 -- (-1472.042) [-1473.434] (-1472.677) (-1473.990) * (-1480.337) (-1470.771) [-1472.551] (-1472.550) -- 0:00:11
835000 -- (-1474.729) (-1474.658) (-1477.392) [-1476.915] * (-1475.973) (-1473.964) (-1475.417) [-1472.685] -- 0:00:11
Average standard deviation of split frequencies: 0.007481
835500 -- (-1474.936) (-1474.235) (-1472.922) [-1474.757] * (-1476.347) (-1474.723) [-1471.271] (-1471.031) -- 0:00:11
836000 -- (-1472.571) (-1474.669) [-1472.104] (-1476.555) * (-1474.412) (-1472.317) [-1474.206] (-1472.664) -- 0:00:11
836500 -- (-1478.094) (-1474.406) (-1472.481) [-1473.296] * (-1474.158) [-1478.702] (-1477.975) (-1477.082) -- 0:00:11
837000 -- (-1475.565) [-1472.772] (-1474.342) (-1472.661) * (-1471.469) [-1473.138] (-1475.429) (-1471.372) -- 0:00:11
837500 -- [-1471.964] (-1473.950) (-1477.762) (-1472.084) * (-1472.302) (-1474.396) (-1474.358) [-1472.148] -- 0:00:11
838000 -- (-1473.917) (-1472.299) [-1475.772] (-1473.874) * (-1472.717) (-1473.500) (-1473.716) [-1472.018] -- 0:00:11
838500 -- (-1476.026) (-1472.182) [-1473.040] (-1474.575) * (-1471.365) (-1470.983) [-1475.680] (-1472.892) -- 0:00:10
839000 -- (-1478.702) (-1475.325) [-1471.574] (-1475.949) * (-1474.478) (-1473.760) (-1473.447) [-1476.865] -- 0:00:10
839500 -- (-1474.761) (-1475.695) (-1471.740) [-1472.832] * (-1475.550) [-1473.856] (-1472.493) (-1480.328) -- 0:00:10
840000 -- (-1471.170) (-1471.653) (-1475.015) [-1470.923] * (-1477.485) [-1468.497] (-1471.278) (-1473.659) -- 0:00:10
Average standard deviation of split frequencies: 0.007439
840500 -- (-1475.502) (-1473.427) [-1471.051] (-1473.530) * (-1475.312) [-1471.151] (-1470.892) (-1474.770) -- 0:00:10
841000 -- (-1471.426) [-1472.241] (-1473.092) (-1476.059) * (-1474.102) [-1473.324] (-1472.576) (-1472.918) -- 0:00:10
841500 -- (-1473.019) (-1475.191) [-1470.500] (-1481.394) * (-1472.370) (-1475.400) [-1479.387] (-1476.926) -- 0:00:10
842000 -- (-1476.781) (-1473.561) [-1471.434] (-1472.245) * (-1476.457) (-1471.265) [-1474.844] (-1473.325) -- 0:00:10
842500 -- (-1475.903) [-1473.334] (-1471.229) (-1474.889) * (-1472.724) [-1470.605] (-1471.392) (-1473.893) -- 0:00:10
843000 -- (-1471.532) (-1472.870) [-1471.638] (-1476.371) * [-1473.735] (-1470.407) (-1479.143) (-1474.012) -- 0:00:10
843500 -- (-1474.328) [-1474.835] (-1476.387) (-1475.561) * (-1472.755) [-1472.130] (-1473.861) (-1475.544) -- 0:00:10
844000 -- [-1473.272] (-1474.364) (-1471.582) (-1473.624) * [-1472.517] (-1470.854) (-1472.018) (-1472.543) -- 0:00:10
844500 -- (-1471.795) [-1473.276] (-1471.807) (-1473.252) * [-1472.251] (-1474.052) (-1475.860) (-1478.056) -- 0:00:10
845000 -- (-1473.009) [-1471.656] (-1472.979) (-1478.110) * (-1475.460) [-1470.761] (-1472.249) (-1475.165) -- 0:00:10
Average standard deviation of split frequencies: 0.007430
845500 -- (-1471.768) (-1475.637) [-1471.802] (-1476.975) * (-1477.233) [-1473.895] (-1473.929) (-1474.644) -- 0:00:10
846000 -- (-1475.668) (-1476.053) (-1473.535) [-1474.896] * (-1478.263) [-1472.295] (-1471.565) (-1475.415) -- 0:00:10
846500 -- (-1476.187) (-1472.977) [-1472.394] (-1478.361) * (-1478.782) (-1473.366) [-1472.742] (-1477.596) -- 0:00:10
847000 -- (-1478.127) (-1473.259) (-1472.864) [-1476.968] * (-1476.589) (-1473.574) (-1478.667) [-1472.142] -- 0:00:10
847500 -- (-1473.334) [-1472.519] (-1474.198) (-1476.564) * (-1477.681) (-1472.360) (-1475.503) [-1471.954] -- 0:00:10
848000 -- [-1471.052] (-1470.956) (-1474.023) (-1477.698) * (-1472.842) (-1473.238) (-1477.072) [-1473.469] -- 0:00:10
848500 -- (-1472.648) (-1473.376) (-1473.382) [-1476.057] * (-1473.715) [-1472.970] (-1476.221) (-1472.431) -- 0:00:10
849000 -- (-1475.759) [-1470.556] (-1475.603) (-1470.946) * [-1473.191] (-1472.548) (-1473.794) (-1475.050) -- 0:00:10
849500 -- (-1473.545) [-1470.809] (-1470.739) (-1474.335) * (-1473.672) (-1473.746) [-1473.368] (-1475.255) -- 0:00:10
850000 -- [-1471.213] (-1475.592) (-1473.082) (-1474.160) * [-1473.991] (-1476.976) (-1470.740) (-1474.197) -- 0:00:10
Average standard deviation of split frequencies: 0.007426
850500 -- [-1472.961] (-1473.136) (-1475.993) (-1475.278) * (-1475.336) (-1475.605) [-1475.518] (-1477.372) -- 0:00:10
851000 -- (-1481.933) (-1473.560) (-1473.063) [-1473.313] * [-1474.996] (-1474.509) (-1474.624) (-1479.613) -- 0:00:10
851500 -- [-1475.161] (-1475.912) (-1472.847) (-1470.729) * [-1472.318] (-1474.040) (-1476.191) (-1474.522) -- 0:00:10
852000 -- (-1474.738) [-1476.019] (-1473.936) (-1474.851) * (-1474.422) [-1473.203] (-1475.878) (-1471.434) -- 0:00:10
852500 -- (-1474.351) (-1475.814) (-1473.054) [-1471.969] * (-1471.861) [-1472.013] (-1475.241) (-1474.446) -- 0:00:10
853000 -- (-1479.589) (-1473.294) [-1472.510] (-1471.394) * (-1474.896) [-1473.967] (-1476.020) (-1477.373) -- 0:00:09
853500 -- (-1473.514) (-1476.483) (-1471.800) [-1476.087] * [-1473.830] (-1473.212) (-1471.679) (-1475.707) -- 0:00:09
854000 -- [-1474.269] (-1471.430) (-1473.683) (-1475.874) * (-1473.865) (-1473.724) [-1472.278] (-1475.381) -- 0:00:09
854500 -- (-1476.148) (-1472.959) (-1479.020) [-1474.765] * (-1474.200) [-1472.374] (-1474.835) (-1472.101) -- 0:00:09
855000 -- (-1477.381) [-1472.829] (-1472.769) (-1477.632) * (-1473.912) (-1472.260) (-1474.741) [-1472.164] -- 0:00:09
Average standard deviation of split frequencies: 0.007747
855500 -- [-1477.438] (-1473.228) (-1472.179) (-1475.867) * [-1473.120] (-1474.059) (-1475.860) (-1473.603) -- 0:00:09
856000 -- (-1474.275) (-1477.726) (-1471.410) [-1473.511] * (-1473.049) (-1472.873) (-1472.975) [-1473.254] -- 0:00:09
856500 -- (-1475.232) (-1471.007) [-1470.740] (-1474.418) * (-1475.070) (-1471.477) (-1474.692) [-1471.033] -- 0:00:09
857000 -- (-1479.140) (-1476.048) (-1472.308) [-1471.833] * [-1470.511] (-1472.586) (-1475.547) (-1472.317) -- 0:00:09
857500 -- (-1473.438) (-1473.686) [-1471.255] (-1476.306) * [-1475.585] (-1474.196) (-1476.532) (-1482.016) -- 0:00:09
858000 -- [-1471.365] (-1476.171) (-1472.910) (-1473.322) * (-1471.108) [-1472.957] (-1474.210) (-1473.292) -- 0:00:09
858500 -- (-1473.397) [-1472.540] (-1469.593) (-1473.342) * (-1474.024) (-1472.294) [-1473.123] (-1472.103) -- 0:00:09
859000 -- (-1475.266) (-1477.871) [-1472.490] (-1476.387) * (-1476.266) (-1477.291) [-1473.235] (-1470.236) -- 0:00:09
859500 -- (-1478.998) (-1473.444) (-1472.640) [-1471.464] * (-1473.971) [-1473.214] (-1472.553) (-1473.510) -- 0:00:09
860000 -- (-1474.680) [-1471.744] (-1471.985) (-1472.242) * (-1474.027) (-1472.364) (-1472.871) [-1470.960] -- 0:00:09
Average standard deviation of split frequencies: 0.007997
860500 -- (-1475.142) [-1472.883] (-1475.908) (-1470.532) * (-1471.946) [-1471.453] (-1470.449) (-1474.407) -- 0:00:09
861000 -- (-1472.414) [-1472.770] (-1469.989) (-1473.851) * (-1470.913) (-1474.605) (-1471.625) [-1470.617] -- 0:00:09
861500 -- (-1475.885) (-1470.590) (-1471.779) [-1473.578] * (-1472.053) (-1477.180) (-1474.554) [-1471.509] -- 0:00:09
862000 -- [-1475.568] (-1470.709) (-1472.659) (-1472.877) * [-1471.220] (-1474.100) (-1471.288) (-1475.542) -- 0:00:09
862500 -- (-1478.338) (-1474.114) (-1472.208) [-1473.837] * [-1471.459] (-1475.797) (-1473.105) (-1473.205) -- 0:00:09
863000 -- (-1482.206) (-1471.651) [-1470.538] (-1475.403) * (-1471.395) (-1470.958) (-1472.547) [-1471.734] -- 0:00:09
863500 -- (-1483.070) (-1473.031) [-1471.459] (-1475.823) * [-1473.134] (-1471.150) (-1473.296) (-1470.854) -- 0:00:09
864000 -- [-1475.220] (-1475.361) (-1477.355) (-1476.717) * (-1474.456) (-1476.043) (-1472.876) [-1471.805] -- 0:00:09
864500 -- (-1473.516) (-1470.260) (-1474.776) [-1472.580] * (-1476.534) (-1471.572) (-1472.021) [-1471.639] -- 0:00:09
865000 -- [-1471.590] (-1473.871) (-1474.288) (-1472.007) * [-1473.913] (-1472.435) (-1473.430) (-1475.115) -- 0:00:09
Average standard deviation of split frequencies: 0.007548
865500 -- (-1474.609) [-1470.930] (-1477.271) (-1474.961) * (-1479.684) [-1473.131] (-1472.014) (-1473.485) -- 0:00:09
866000 -- [-1470.617] (-1474.444) (-1471.654) (-1475.629) * (-1474.819) [-1472.284] (-1470.990) (-1473.298) -- 0:00:09
866500 -- (-1469.906) (-1472.280) [-1473.976] (-1472.575) * (-1477.738) (-1470.935) (-1473.200) [-1471.767] -- 0:00:09
867000 -- [-1474.436] (-1473.134) (-1472.957) (-1470.711) * (-1471.916) (-1474.038) [-1471.841] (-1475.645) -- 0:00:09
867500 -- (-1472.941) (-1473.463) (-1477.399) [-1473.776] * (-1474.262) (-1475.675) (-1471.885) [-1475.403] -- 0:00:09
868000 -- (-1474.827) (-1473.554) (-1472.696) [-1473.069] * (-1478.809) (-1475.780) [-1472.650] (-1474.224) -- 0:00:08
868500 -- (-1474.630) (-1474.452) (-1474.787) [-1471.625] * (-1473.748) (-1476.125) (-1477.173) [-1473.525] -- 0:00:08
869000 -- (-1475.609) [-1472.321] (-1474.854) (-1477.260) * [-1472.357] (-1471.984) (-1475.522) (-1474.652) -- 0:00:08
869500 -- (-1474.749) (-1471.149) (-1475.574) [-1471.896] * (-1472.539) [-1473.095] (-1474.889) (-1476.618) -- 0:00:08
870000 -- (-1475.778) (-1471.593) [-1472.300] (-1472.251) * (-1473.804) (-1474.563) [-1472.383] (-1473.543) -- 0:00:08
Average standard deviation of split frequencies: 0.007724
870500 -- (-1476.880) [-1474.210] (-1473.763) (-1480.254) * (-1472.150) (-1476.374) (-1472.029) [-1472.370] -- 0:00:08
871000 -- (-1475.271) [-1474.249] (-1475.063) (-1476.443) * (-1473.047) (-1471.692) [-1470.791] (-1471.485) -- 0:00:08
871500 -- [-1473.463] (-1474.840) (-1476.741) (-1473.810) * (-1478.640) (-1471.341) [-1471.551] (-1471.606) -- 0:00:08
872000 -- (-1471.889) [-1473.385] (-1473.295) (-1471.737) * (-1477.024) (-1477.084) (-1471.361) [-1471.607] -- 0:00:08
872500 -- (-1472.394) (-1474.182) (-1480.066) [-1472.093] * [-1471.667] (-1478.722) (-1474.909) (-1472.027) -- 0:00:08
873000 -- (-1475.932) [-1475.478] (-1477.132) (-1474.614) * (-1473.087) (-1472.674) [-1471.715] (-1470.068) -- 0:00:08
873500 -- [-1471.646] (-1473.195) (-1474.677) (-1474.453) * [-1473.406] (-1475.620) (-1474.322) (-1473.010) -- 0:00:08
874000 -- (-1473.513) (-1475.592) (-1471.414) [-1474.254] * (-1476.219) (-1470.865) [-1474.229] (-1473.242) -- 0:00:08
874500 -- (-1474.117) [-1474.666] (-1477.022) (-1474.579) * (-1472.678) (-1471.900) (-1475.239) [-1473.820] -- 0:00:08
875000 -- (-1476.248) [-1474.715] (-1476.719) (-1475.893) * [-1472.727] (-1474.126) (-1474.463) (-1475.508) -- 0:00:08
Average standard deviation of split frequencies: 0.007606
875500 -- (-1478.548) [-1474.015] (-1476.201) (-1475.683) * (-1473.002) (-1477.233) [-1471.697] (-1472.709) -- 0:00:08
876000 -- (-1478.880) [-1471.951] (-1476.981) (-1472.903) * [-1474.070] (-1473.315) (-1470.832) (-1476.812) -- 0:00:08
876500 -- (-1474.254) (-1471.679) (-1474.627) [-1475.538] * [-1470.214] (-1473.284) (-1474.081) (-1473.722) -- 0:00:08
877000 -- [-1473.143] (-1473.569) (-1473.496) (-1472.928) * (-1473.770) [-1473.967] (-1471.339) (-1478.740) -- 0:00:08
877500 -- [-1473.231] (-1473.019) (-1470.776) (-1473.820) * (-1475.886) (-1473.916) [-1470.539] (-1472.649) -- 0:00:08
878000 -- [-1470.806] (-1472.316) (-1477.637) (-1472.188) * (-1477.536) (-1473.022) (-1472.477) [-1474.234] -- 0:00:08
878500 -- [-1472.048] (-1472.483) (-1473.375) (-1472.086) * [-1472.706] (-1474.399) (-1474.474) (-1475.747) -- 0:00:08
879000 -- [-1479.830] (-1472.835) (-1475.842) (-1474.357) * (-1473.446) (-1472.295) [-1471.761] (-1472.758) -- 0:00:08
879500 -- (-1471.979) [-1472.770] (-1473.036) (-1471.860) * (-1471.923) (-1472.985) (-1473.840) [-1471.860] -- 0:00:08
880000 -- (-1474.895) [-1472.580] (-1474.514) (-1474.242) * (-1471.106) [-1473.810] (-1475.615) (-1470.053) -- 0:00:08
Average standard deviation of split frequencies: 0.007387
880500 -- (-1471.048) (-1475.441) [-1471.632] (-1472.328) * [-1474.421] (-1474.678) (-1472.998) (-1474.104) -- 0:00:08
881000 -- (-1470.039) [-1470.332] (-1475.774) (-1477.277) * (-1471.662) (-1474.403) [-1470.499] (-1478.821) -- 0:00:08
881500 -- (-1475.857) [-1476.178] (-1474.414) (-1473.963) * [-1473.097] (-1472.986) (-1475.573) (-1470.199) -- 0:00:08
882000 -- (-1475.975) [-1472.402] (-1475.581) (-1472.709) * (-1472.797) [-1472.335] (-1473.387) (-1472.735) -- 0:00:08
882500 -- [-1473.243] (-1473.330) (-1473.360) (-1475.098) * (-1475.406) (-1471.424) [-1471.216] (-1471.959) -- 0:00:07
883000 -- (-1473.170) [-1471.632] (-1476.706) (-1474.631) * (-1474.167) [-1472.618] (-1475.657) (-1472.319) -- 0:00:07
883500 -- (-1473.018) (-1470.616) [-1471.451] (-1475.884) * (-1471.850) (-1475.913) (-1471.160) [-1478.781] -- 0:00:07
884000 -- (-1473.904) [-1475.347] (-1471.704) (-1476.666) * (-1473.538) (-1473.347) (-1476.095) [-1474.512] -- 0:00:07
884500 -- (-1480.988) [-1470.229] (-1473.417) (-1472.838) * (-1473.876) (-1472.513) (-1471.833) [-1475.458] -- 0:00:07
885000 -- (-1473.822) (-1475.714) [-1470.748] (-1475.098) * [-1471.467] (-1470.935) (-1474.607) (-1473.932) -- 0:00:07
Average standard deviation of split frequencies: 0.007236
885500 -- (-1475.371) [-1471.263] (-1472.480) (-1473.398) * (-1473.720) [-1474.516] (-1473.849) (-1479.323) -- 0:00:07
886000 -- (-1471.368) (-1472.252) [-1473.092] (-1472.117) * (-1473.139) (-1470.948) [-1475.381] (-1482.306) -- 0:00:07
886500 -- (-1472.240) [-1474.071] (-1475.907) (-1474.988) * (-1471.353) [-1470.722] (-1472.978) (-1476.190) -- 0:00:07
887000 -- (-1472.729) [-1476.939] (-1470.972) (-1471.257) * [-1472.725] (-1471.447) (-1471.634) (-1477.079) -- 0:00:07
887500 -- (-1472.018) (-1471.821) (-1476.312) [-1471.394] * (-1472.285) [-1472.408] (-1474.185) (-1484.357) -- 0:00:07
888000 -- (-1471.794) (-1472.199) [-1475.997] (-1473.987) * (-1472.308) [-1470.907] (-1475.517) (-1477.914) -- 0:00:07
888500 -- [-1473.572] (-1477.700) (-1473.707) (-1473.095) * [-1471.333] (-1481.506) (-1476.350) (-1474.383) -- 0:00:07
889000 -- (-1471.659) (-1474.569) [-1475.285] (-1471.916) * (-1471.149) [-1469.979] (-1475.443) (-1471.775) -- 0:00:07
889500 -- (-1471.281) [-1472.343] (-1471.760) (-1471.447) * (-1474.929) (-1472.146) (-1471.318) [-1474.672] -- 0:00:07
890000 -- (-1474.051) [-1473.552] (-1477.130) (-1470.988) * (-1476.550) (-1472.547) (-1473.417) [-1472.854] -- 0:00:07
Average standard deviation of split frequencies: 0.006951
890500 -- (-1477.409) (-1477.255) [-1472.595] (-1475.970) * (-1473.492) (-1471.316) (-1470.894) [-1475.290] -- 0:00:07
891000 -- (-1477.857) (-1472.637) [-1471.847] (-1482.858) * [-1472.140] (-1471.725) (-1470.600) (-1474.620) -- 0:00:07
891500 -- (-1476.907) [-1471.543] (-1477.055) (-1471.440) * (-1474.665) (-1473.065) (-1475.954) [-1473.600] -- 0:00:07
892000 -- [-1470.360] (-1473.028) (-1472.153) (-1470.303) * (-1473.337) [-1470.296] (-1474.659) (-1474.389) -- 0:00:07
892500 -- (-1470.183) (-1470.804) [-1472.052] (-1477.115) * (-1472.088) (-1476.605) (-1470.026) [-1473.593] -- 0:00:07
893000 -- (-1474.182) (-1471.281) [-1474.721] (-1478.493) * (-1473.125) [-1474.075] (-1470.960) (-1474.241) -- 0:00:07
893500 -- (-1471.520) [-1471.826] (-1474.073) (-1472.518) * (-1471.373) (-1471.803) (-1477.227) [-1473.440] -- 0:00:07
894000 -- (-1474.999) (-1474.571) [-1472.721] (-1475.016) * (-1472.656) (-1474.358) [-1476.578] (-1471.837) -- 0:00:07
894500 -- (-1474.937) [-1475.355] (-1472.794) (-1475.039) * (-1476.452) (-1472.619) (-1472.891) [-1474.148] -- 0:00:07
895000 -- [-1472.251] (-1476.899) (-1472.496) (-1474.164) * (-1471.215) (-1474.459) (-1472.035) [-1471.428] -- 0:00:07
Average standard deviation of split frequencies: 0.006910
895500 -- (-1472.994) (-1476.523) [-1470.473] (-1474.130) * (-1471.726) [-1472.672] (-1472.817) (-1470.720) -- 0:00:07
896000 -- [-1474.760] (-1479.960) (-1473.695) (-1470.357) * (-1472.402) (-1470.639) (-1473.577) [-1472.740] -- 0:00:07
896500 -- [-1475.151] (-1474.010) (-1471.566) (-1473.455) * (-1475.570) (-1470.931) (-1476.867) [-1473.084] -- 0:00:07
897000 -- (-1474.930) (-1474.555) [-1474.510] (-1471.261) * (-1474.511) [-1470.462] (-1471.901) (-1470.525) -- 0:00:07
897500 -- (-1474.941) [-1473.694] (-1473.563) (-1474.221) * (-1471.167) [-1473.223] (-1473.018) (-1475.470) -- 0:00:06
898000 -- (-1476.156) [-1472.587] (-1473.962) (-1473.397) * (-1474.869) (-1471.758) [-1473.495] (-1471.123) -- 0:00:06
898500 -- (-1474.707) [-1473.083] (-1470.968) (-1475.680) * (-1473.299) (-1470.983) [-1475.876] (-1470.595) -- 0:00:06
899000 -- (-1472.871) (-1474.972) (-1476.416) [-1474.215] * (-1470.522) [-1478.406] (-1471.838) (-1472.000) -- 0:00:06
899500 -- (-1472.246) (-1475.329) [-1475.327] (-1473.866) * (-1471.907) (-1472.333) (-1475.511) [-1470.744] -- 0:00:06
900000 -- (-1477.752) (-1471.270) [-1470.489] (-1472.213) * [-1470.027] (-1472.672) (-1473.897) (-1473.988) -- 0:00:06
Average standard deviation of split frequencies: 0.007572
900500 -- (-1478.597) (-1474.395) (-1474.537) [-1473.256] * (-1474.951) (-1473.859) (-1474.853) [-1472.204] -- 0:00:06
901000 -- (-1475.007) (-1473.201) [-1473.659] (-1477.532) * (-1472.418) [-1472.699] (-1479.274) (-1474.516) -- 0:00:06
901500 -- (-1474.543) (-1471.829) [-1472.666] (-1474.101) * (-1471.956) (-1472.663) (-1477.135) [-1475.270] -- 0:00:06
902000 -- (-1471.491) (-1470.085) [-1473.012] (-1476.538) * (-1474.277) (-1472.197) (-1469.722) [-1476.322] -- 0:00:06
902500 -- (-1472.046) (-1473.879) (-1472.057) [-1471.108] * (-1475.867) [-1473.085] (-1471.270) (-1476.141) -- 0:00:06
903000 -- (-1472.504) (-1471.644) (-1474.973) [-1472.788] * [-1474.051] (-1473.705) (-1472.027) (-1470.344) -- 0:00:06
903500 -- (-1472.596) (-1474.244) (-1473.738) [-1470.846] * (-1473.537) (-1475.167) (-1471.761) [-1472.074] -- 0:00:06
904000 -- (-1475.589) (-1470.705) [-1475.109] (-1471.114) * (-1470.962) [-1471.970] (-1475.272) (-1476.342) -- 0:00:06
904500 -- [-1472.584] (-1476.174) (-1475.239) (-1478.767) * [-1471.441] (-1476.493) (-1476.477) (-1474.482) -- 0:00:06
905000 -- (-1472.173) [-1475.005] (-1472.036) (-1471.101) * (-1476.678) (-1472.162) (-1472.821) [-1471.510] -- 0:00:06
Average standard deviation of split frequencies: 0.007458
905500 -- (-1473.885) (-1471.327) [-1474.141] (-1473.577) * (-1471.305) (-1475.297) (-1476.328) [-1471.396] -- 0:00:06
906000 -- (-1473.787) (-1471.935) [-1472.092] (-1477.445) * (-1470.211) (-1476.277) (-1472.376) [-1472.078] -- 0:00:06
906500 -- (-1472.028) (-1472.604) (-1470.810) [-1473.670] * (-1471.944) (-1472.517) (-1472.809) [-1473.363] -- 0:00:06
907000 -- [-1469.740] (-1471.081) (-1472.249) (-1475.310) * (-1474.245) [-1474.003] (-1478.996) (-1473.025) -- 0:00:06
907500 -- (-1473.165) [-1471.925] (-1471.163) (-1475.405) * (-1472.539) (-1481.659) (-1474.056) [-1474.264] -- 0:00:06
908000 -- (-1474.297) (-1472.700) (-1469.785) [-1470.683] * [-1475.788] (-1473.680) (-1480.331) (-1472.950) -- 0:00:06
908500 -- (-1472.781) (-1471.073) (-1471.464) [-1472.586] * [-1471.146] (-1474.480) (-1475.962) (-1476.424) -- 0:00:06
909000 -- (-1475.319) (-1473.461) (-1471.177) [-1471.780] * (-1470.747) [-1474.549] (-1473.022) (-1476.375) -- 0:00:06
909500 -- (-1475.770) (-1473.612) (-1475.468) [-1474.334] * (-1472.224) (-1474.011) [-1472.374] (-1475.590) -- 0:00:06
910000 -- [-1471.958] (-1471.280) (-1475.536) (-1472.760) * (-1474.014) [-1475.826] (-1473.302) (-1477.244) -- 0:00:06
Average standard deviation of split frequencies: 0.007420
910500 -- (-1473.563) (-1474.824) [-1471.314] (-1478.731) * (-1475.567) [-1472.267] (-1472.566) (-1478.595) -- 0:00:06
911000 -- (-1479.439) (-1471.062) [-1475.567] (-1473.779) * (-1474.382) [-1473.436] (-1472.039) (-1474.630) -- 0:00:06
911500 -- (-1476.396) [-1471.328] (-1476.770) (-1476.134) * [-1471.970] (-1472.985) (-1472.204) (-1473.456) -- 0:00:06
912000 -- [-1473.496] (-1473.008) (-1474.307) (-1479.280) * (-1478.515) (-1477.678) [-1473.807] (-1474.862) -- 0:00:05
912500 -- (-1480.344) (-1475.635) [-1472.569] (-1473.149) * (-1475.413) (-1473.974) [-1472.691] (-1473.699) -- 0:00:05
913000 -- (-1475.275) (-1474.666) [-1476.095] (-1476.353) * (-1474.330) (-1476.451) [-1472.742] (-1477.088) -- 0:00:05
913500 -- [-1470.053] (-1472.453) (-1471.320) (-1475.957) * (-1474.421) (-1472.571) [-1471.844] (-1473.790) -- 0:00:05
914000 -- (-1471.015) (-1476.501) (-1470.306) [-1472.655] * (-1473.498) (-1475.779) [-1471.910] (-1473.636) -- 0:00:05
914500 -- (-1471.999) [-1475.922] (-1473.273) (-1472.645) * (-1472.454) (-1475.259) [-1471.957] (-1476.080) -- 0:00:05
915000 -- [-1472.699] (-1468.954) (-1471.206) (-1476.224) * (-1473.281) (-1472.635) (-1469.875) [-1476.179] -- 0:00:05
Average standard deviation of split frequencies: 0.007582
915500 -- (-1475.091) [-1471.565] (-1474.722) (-1476.937) * (-1473.155) (-1473.915) [-1471.141] (-1475.829) -- 0:00:05
916000 -- (-1473.835) (-1474.802) (-1477.117) [-1473.662] * (-1472.101) [-1470.707] (-1471.463) (-1477.671) -- 0:00:05
916500 -- (-1474.308) (-1472.789) [-1473.573] (-1475.892) * (-1471.055) [-1471.535] (-1474.773) (-1474.195) -- 0:00:05
917000 -- (-1480.395) [-1474.405] (-1482.104) (-1473.259) * (-1474.940) [-1474.890] (-1478.969) (-1474.291) -- 0:00:05
917500 -- (-1474.542) [-1478.407] (-1479.072) (-1474.017) * (-1478.706) [-1471.497] (-1475.032) (-1472.481) -- 0:00:05
918000 -- (-1471.675) (-1471.824) (-1476.911) [-1475.094] * [-1473.781] (-1473.363) (-1474.503) (-1473.506) -- 0:00:05
918500 -- (-1474.365) (-1471.065) (-1472.686) [-1474.234] * (-1472.192) [-1476.962] (-1470.918) (-1474.629) -- 0:00:05
919000 -- (-1473.370) [-1472.043] (-1473.489) (-1470.327) * (-1472.409) [-1472.359] (-1472.713) (-1480.931) -- 0:00:05
919500 -- (-1473.000) (-1474.223) (-1472.787) [-1470.505] * (-1475.189) (-1474.664) (-1470.758) [-1475.680] -- 0:00:05
920000 -- (-1471.490) (-1474.091) (-1472.550) [-1470.046] * (-1472.681) (-1471.727) [-1472.134] (-1473.632) -- 0:00:05
Average standard deviation of split frequencies: 0.007305
920500 -- [-1474.070] (-1476.107) (-1476.859) (-1472.518) * (-1473.909) (-1471.204) [-1470.223] (-1474.795) -- 0:00:05
921000 -- (-1470.441) (-1470.592) [-1473.558] (-1472.910) * [-1471.671] (-1476.183) (-1471.424) (-1472.326) -- 0:00:05
921500 -- (-1471.734) (-1472.521) [-1473.900] (-1476.027) * (-1473.483) (-1472.312) [-1476.754] (-1473.775) -- 0:00:05
922000 -- (-1473.514) (-1472.074) (-1474.005) [-1476.259] * [-1472.714] (-1475.085) (-1476.826) (-1471.876) -- 0:00:05
922500 -- (-1471.767) (-1471.627) (-1476.427) [-1470.832] * (-1474.640) (-1475.769) (-1473.820) [-1473.517] -- 0:00:05
923000 -- (-1474.362) [-1472.942] (-1474.138) (-1477.353) * [-1474.439] (-1475.797) (-1474.090) (-1472.599) -- 0:00:05
923500 -- (-1475.358) [-1475.156] (-1475.101) (-1473.731) * (-1472.052) (-1478.578) [-1474.074] (-1471.380) -- 0:00:05
924000 -- (-1473.589) [-1477.410] (-1474.962) (-1471.730) * (-1472.148) (-1474.130) [-1473.781] (-1473.826) -- 0:00:05
924500 -- (-1474.985) [-1475.368] (-1472.296) (-1473.078) * (-1471.857) [-1473.258] (-1472.994) (-1475.601) -- 0:00:05
925000 -- (-1473.060) (-1469.551) (-1476.244) [-1472.803] * (-1473.213) [-1474.496] (-1473.264) (-1478.091) -- 0:00:05
Average standard deviation of split frequencies: 0.007263
925500 -- (-1478.791) (-1476.962) (-1475.343) [-1475.838] * [-1471.865] (-1471.779) (-1474.989) (-1472.103) -- 0:00:05
926000 -- (-1475.780) [-1474.015] (-1472.411) (-1472.353) * [-1473.710] (-1474.362) (-1474.403) (-1471.199) -- 0:00:05
926500 -- (-1473.666) [-1473.062] (-1475.718) (-1471.959) * [-1471.713] (-1472.592) (-1478.722) (-1473.472) -- 0:00:04
927000 -- (-1476.153) (-1474.744) [-1474.055] (-1472.278) * (-1475.482) (-1475.902) (-1478.158) [-1476.675] -- 0:00:04
927500 -- (-1473.871) (-1474.396) (-1478.827) [-1478.521] * [-1471.746] (-1472.568) (-1473.754) (-1473.973) -- 0:00:04
928000 -- (-1473.669) (-1472.082) [-1472.564] (-1475.444) * (-1473.819) [-1471.676] (-1474.611) (-1470.907) -- 0:00:04
928500 -- (-1472.361) (-1472.424) [-1475.550] (-1475.989) * (-1475.163) (-1470.031) (-1474.999) [-1470.317] -- 0:00:04
929000 -- (-1472.966) [-1471.440] (-1474.032) (-1472.410) * (-1476.077) (-1473.801) [-1472.861] (-1472.571) -- 0:00:04
929500 -- [-1473.831] (-1476.278) (-1481.060) (-1474.939) * (-1476.854) [-1473.291] (-1474.995) (-1473.618) -- 0:00:04
930000 -- (-1473.450) (-1473.293) [-1478.031] (-1475.282) * (-1475.718) (-1473.691) [-1471.054] (-1471.622) -- 0:00:04
Average standard deviation of split frequencies: 0.007497
930500 -- (-1478.731) (-1470.954) [-1473.904] (-1473.515) * (-1472.620) (-1474.890) (-1476.309) [-1474.284] -- 0:00:04
931000 -- (-1476.197) (-1474.458) (-1471.663) [-1472.872] * [-1473.397] (-1477.825) (-1474.878) (-1473.165) -- 0:00:04
931500 -- (-1474.839) (-1475.610) [-1473.076] (-1471.837) * (-1472.588) [-1472.596] (-1473.062) (-1474.743) -- 0:00:04
932000 -- (-1473.611) (-1475.763) (-1476.686) [-1475.652] * [-1473.668] (-1473.776) (-1474.186) (-1471.413) -- 0:00:04
932500 -- [-1474.645] (-1470.011) (-1477.908) (-1476.801) * (-1475.064) [-1473.731] (-1473.466) (-1472.379) -- 0:00:04
933000 -- (-1471.738) (-1476.795) [-1477.087] (-1474.877) * (-1473.068) [-1472.885] (-1471.881) (-1472.059) -- 0:00:04
933500 -- (-1476.593) (-1471.091) (-1473.342) [-1472.717] * (-1476.825) [-1473.532] (-1470.196) (-1473.349) -- 0:00:04
934000 -- (-1475.918) (-1470.415) [-1471.788] (-1475.210) * (-1472.531) (-1470.751) (-1474.609) [-1474.487] -- 0:00:04
934500 -- (-1477.800) [-1469.979] (-1476.978) (-1475.518) * [-1470.630] (-1485.399) (-1471.737) (-1470.477) -- 0:00:04
935000 -- (-1474.568) (-1470.237) [-1473.454] (-1475.601) * (-1472.467) (-1474.553) (-1473.237) [-1475.269] -- 0:00:04
Average standard deviation of split frequencies: 0.007219
935500 -- [-1477.529] (-1472.365) (-1471.976) (-1479.485) * (-1472.853) (-1475.716) (-1473.722) [-1476.315] -- 0:00:04
936000 -- (-1476.816) [-1472.106] (-1471.761) (-1474.659) * (-1470.511) (-1475.423) (-1472.937) [-1474.189] -- 0:00:04
936500 -- [-1470.225] (-1472.568) (-1475.334) (-1471.843) * (-1471.517) [-1471.980] (-1475.962) (-1474.839) -- 0:00:04
937000 -- [-1472.584] (-1476.975) (-1474.315) (-1476.019) * [-1470.850] (-1477.803) (-1476.052) (-1472.847) -- 0:00:04
937500 -- [-1475.976] (-1470.737) (-1476.527) (-1475.193) * [-1472.759] (-1473.160) (-1475.442) (-1472.270) -- 0:00:04
938000 -- [-1473.777] (-1474.800) (-1476.514) (-1478.424) * (-1474.933) [-1475.903] (-1471.398) (-1473.339) -- 0:00:04
938500 -- (-1476.964) (-1469.196) [-1474.318] (-1472.242) * (-1472.775) (-1474.208) (-1478.706) [-1471.821] -- 0:00:04
939000 -- (-1476.000) [-1473.100] (-1473.785) (-1471.882) * (-1473.119) [-1477.654] (-1473.031) (-1471.335) -- 0:00:04
939500 -- (-1473.534) (-1472.848) (-1472.250) [-1475.652] * (-1473.349) (-1475.345) (-1472.166) [-1471.564] -- 0:00:04
940000 -- (-1475.971) [-1472.157] (-1470.962) (-1472.839) * (-1477.306) [-1471.107] (-1472.050) (-1474.800) -- 0:00:04
Average standard deviation of split frequencies: 0.007751
940500 -- [-1472.200] (-1474.495) (-1471.748) (-1476.073) * [-1477.295] (-1470.262) (-1474.894) (-1473.789) -- 0:00:04
941000 -- (-1472.922) (-1471.960) [-1471.203] (-1475.700) * (-1477.384) [-1473.063] (-1476.299) (-1477.344) -- 0:00:04
941500 -- (-1475.143) (-1471.485) (-1472.220) [-1472.963] * (-1474.448) (-1471.724) [-1471.138] (-1474.931) -- 0:00:03
942000 -- (-1475.110) [-1472.304] (-1474.402) (-1472.510) * (-1476.107) (-1476.878) [-1472.509] (-1471.966) -- 0:00:03
942500 -- (-1474.666) (-1475.444) [-1471.777] (-1472.337) * (-1471.306) (-1472.051) [-1471.704] (-1471.712) -- 0:00:03
943000 -- [-1474.976] (-1469.970) (-1473.354) (-1473.602) * (-1474.021) (-1474.641) [-1471.293] (-1474.025) -- 0:00:03
943500 -- (-1474.208) (-1472.565) (-1475.871) [-1470.492] * (-1472.426) (-1473.817) (-1470.792) [-1473.597] -- 0:00:03
944000 -- (-1475.030) [-1473.970] (-1472.402) (-1476.089) * [-1473.555] (-1474.680) (-1474.189) (-1472.185) -- 0:00:03
944500 -- (-1474.015) [-1472.868] (-1470.906) (-1472.104) * (-1473.509) (-1472.491) (-1475.909) [-1473.606] -- 0:00:03
945000 -- [-1470.006] (-1473.297) (-1473.427) (-1472.185) * (-1471.187) (-1475.917) [-1475.748] (-1472.262) -- 0:00:03
Average standard deviation of split frequencies: 0.007940
945500 -- (-1473.833) (-1473.881) [-1472.900] (-1472.332) * (-1474.217) (-1478.194) [-1474.520] (-1476.063) -- 0:00:03
946000 -- (-1476.084) [-1470.953] (-1472.165) (-1470.768) * (-1476.530) (-1470.974) (-1475.296) [-1474.697] -- 0:00:03
946500 -- (-1482.703) [-1474.636] (-1471.596) (-1472.695) * (-1477.049) (-1475.326) (-1473.398) [-1475.790] -- 0:00:03
947000 -- (-1478.216) (-1477.996) [-1471.708] (-1471.774) * [-1472.803] (-1470.488) (-1481.474) (-1479.689) -- 0:00:03
947500 -- (-1476.271) (-1474.708) (-1472.844) [-1476.416] * (-1474.285) [-1473.005] (-1480.526) (-1473.006) -- 0:00:03
948000 -- (-1475.310) [-1473.823] (-1472.151) (-1474.878) * (-1473.245) (-1475.854) (-1473.064) [-1471.765] -- 0:00:03
948500 -- (-1476.223) (-1474.708) [-1473.534] (-1474.603) * (-1474.645) (-1470.632) (-1475.391) [-1477.633] -- 0:00:03
949000 -- [-1473.734] (-1479.579) (-1475.360) (-1471.990) * (-1471.840) [-1472.813] (-1474.332) (-1471.052) -- 0:00:03
949500 -- [-1474.103] (-1473.189) (-1477.171) (-1475.743) * (-1471.227) [-1472.908] (-1472.101) (-1475.531) -- 0:00:03
950000 -- (-1471.894) (-1472.506) (-1476.635) [-1471.124] * (-1473.255) [-1472.822] (-1477.254) (-1483.633) -- 0:00:03
Average standard deviation of split frequencies: 0.007901
950500 -- (-1472.758) [-1471.581] (-1472.454) (-1470.493) * [-1470.829] (-1474.604) (-1475.502) (-1473.014) -- 0:00:03
951000 -- (-1474.467) (-1473.346) [-1474.892] (-1474.429) * [-1471.312] (-1472.801) (-1475.510) (-1477.922) -- 0:00:03
951500 -- (-1471.594) [-1472.815] (-1475.512) (-1471.222) * (-1475.964) [-1474.752] (-1476.996) (-1475.581) -- 0:00:03
952000 -- (-1471.385) (-1477.761) [-1473.135] (-1471.897) * (-1476.748) [-1472.956] (-1474.481) (-1472.445) -- 0:00:03
952500 -- (-1471.032) [-1473.299] (-1475.962) (-1471.954) * [-1474.901] (-1479.072) (-1477.052) (-1477.289) -- 0:00:03
953000 -- (-1472.120) (-1475.083) [-1475.919] (-1472.496) * (-1472.526) (-1473.404) (-1472.444) [-1473.209] -- 0:00:03
953500 -- [-1472.490] (-1476.427) (-1477.293) (-1471.933) * (-1471.628) [-1471.903] (-1470.706) (-1474.004) -- 0:00:03
954000 -- (-1473.833) (-1473.520) [-1470.569] (-1470.143) * (-1472.491) (-1473.520) (-1474.925) [-1471.149] -- 0:00:03
954500 -- (-1475.099) (-1474.711) (-1472.654) [-1470.921] * (-1471.687) [-1471.649] (-1474.205) (-1473.093) -- 0:00:03
955000 -- (-1472.472) (-1472.889) [-1470.018] (-1475.932) * (-1471.860) (-1475.061) [-1475.906] (-1474.838) -- 0:00:03
Average standard deviation of split frequencies: 0.007890
955500 -- (-1473.013) (-1475.263) [-1472.041] (-1473.815) * (-1471.127) (-1474.539) [-1473.573] (-1475.235) -- 0:00:03
956000 -- (-1471.643) [-1471.654] (-1478.408) (-1471.443) * [-1472.713] (-1475.397) (-1474.285) (-1472.438) -- 0:00:02
956500 -- (-1472.083) (-1471.583) (-1474.611) [-1470.030] * (-1471.106) (-1473.225) [-1473.923] (-1473.349) -- 0:00:02
957000 -- [-1473.190] (-1471.844) (-1471.644) (-1472.510) * (-1470.256) [-1475.684] (-1472.498) (-1472.992) -- 0:00:02
957500 -- (-1472.561) [-1469.820] (-1471.573) (-1479.314) * (-1474.405) (-1480.552) (-1475.164) [-1472.803] -- 0:00:02
958000 -- (-1471.105) (-1472.346) [-1470.893] (-1477.576) * [-1470.831] (-1475.960) (-1476.618) (-1472.813) -- 0:00:02
958500 -- [-1472.161] (-1475.643) (-1474.511) (-1474.288) * [-1470.937] (-1477.907) (-1471.479) (-1474.215) -- 0:00:02
959000 -- (-1474.563) (-1472.218) (-1471.036) [-1474.898] * (-1477.105) (-1473.057) [-1473.981] (-1477.500) -- 0:00:02
959500 -- [-1472.115] (-1475.098) (-1474.109) (-1472.186) * (-1472.049) [-1475.439] (-1472.584) (-1479.267) -- 0:00:02
960000 -- [-1474.253] (-1474.708) (-1473.709) (-1473.851) * [-1473.684] (-1475.655) (-1476.022) (-1472.031) -- 0:00:02
Average standard deviation of split frequencies: 0.008113
960500 -- (-1475.201) [-1482.990] (-1472.216) (-1471.431) * [-1471.226] (-1478.922) (-1474.333) (-1474.469) -- 0:00:02
961000 -- [-1471.148] (-1475.757) (-1475.215) (-1474.865) * [-1473.590] (-1474.286) (-1475.404) (-1471.343) -- 0:00:02
961500 -- (-1471.349) (-1476.885) (-1479.067) [-1472.759] * (-1473.575) [-1473.206] (-1474.183) (-1474.243) -- 0:00:02
962000 -- (-1477.071) (-1472.515) [-1475.098] (-1470.243) * [-1474.866] (-1473.599) (-1473.187) (-1472.216) -- 0:00:02
962500 -- (-1474.857) (-1476.883) (-1475.057) [-1473.142] * [-1475.795] (-1472.674) (-1476.680) (-1478.640) -- 0:00:02
963000 -- (-1474.477) [-1472.221] (-1475.720) (-1476.858) * (-1475.422) (-1474.635) [-1473.086] (-1483.056) -- 0:00:02
963500 -- (-1477.022) [-1472.083] (-1473.519) (-1477.698) * [-1478.023] (-1472.070) (-1470.404) (-1473.379) -- 0:00:02
964000 -- (-1473.437) [-1472.713] (-1471.063) (-1471.677) * (-1475.341) [-1474.725] (-1475.222) (-1473.128) -- 0:00:02
964500 -- [-1473.574] (-1482.252) (-1470.776) (-1473.658) * [-1478.332] (-1471.663) (-1473.099) (-1475.972) -- 0:00:02
965000 -- (-1473.661) (-1477.204) [-1469.903] (-1472.206) * (-1474.599) (-1473.774) [-1471.497] (-1476.780) -- 0:00:02
Average standard deviation of split frequencies: 0.008166
965500 -- (-1476.044) (-1474.328) (-1472.897) [-1472.703] * (-1475.601) (-1474.859) [-1475.440] (-1478.404) -- 0:00:02
966000 -- [-1472.015] (-1474.131) (-1473.248) (-1473.329) * [-1474.488] (-1475.388) (-1473.970) (-1474.806) -- 0:00:02
966500 -- (-1470.994) (-1471.964) (-1472.847) [-1472.222] * (-1471.785) (-1477.532) [-1472.144] (-1477.789) -- 0:00:02
967000 -- (-1473.375) (-1472.079) (-1474.623) [-1471.248] * [-1472.118] (-1477.913) (-1477.044) (-1474.957) -- 0:00:02
967500 -- (-1475.058) [-1473.108] (-1474.098) (-1473.762) * [-1470.941] (-1472.908) (-1473.377) (-1471.537) -- 0:00:02
968000 -- (-1473.738) (-1474.107) (-1472.464) [-1472.426] * (-1473.621) [-1471.183] (-1474.198) (-1472.045) -- 0:00:02
968500 -- [-1471.471] (-1476.848) (-1478.121) (-1470.693) * (-1474.204) [-1474.131] (-1473.128) (-1473.128) -- 0:00:02
969000 -- (-1470.944) [-1473.069] (-1472.384) (-1471.623) * (-1477.068) (-1472.931) (-1471.063) [-1474.744] -- 0:00:02
969500 -- (-1471.690) [-1474.284] (-1472.211) (-1473.431) * (-1475.943) (-1471.794) (-1475.114) [-1473.554] -- 0:00:02
970000 -- (-1472.216) (-1474.247) [-1476.121] (-1472.213) * (-1472.931) (-1472.613) [-1473.548] (-1472.424) -- 0:00:02
Average standard deviation of split frequencies: 0.007673
970500 -- (-1471.754) (-1476.131) [-1474.313] (-1471.722) * (-1472.403) [-1472.795] (-1475.161) (-1479.411) -- 0:00:02
971000 -- [-1474.225] (-1472.968) (-1475.806) (-1472.004) * [-1472.113] (-1473.448) (-1482.358) (-1472.161) -- 0:00:01
971500 -- (-1471.384) (-1478.232) (-1474.757) [-1471.530] * (-1472.621) (-1474.527) [-1477.920] (-1472.215) -- 0:00:01
972000 -- (-1473.848) [-1472.719] (-1475.938) (-1471.704) * (-1470.977) (-1472.464) [-1477.347] (-1474.563) -- 0:00:01
972500 -- (-1471.324) [-1472.227] (-1472.110) (-1471.508) * [-1471.094] (-1475.490) (-1472.445) (-1471.839) -- 0:00:01
973000 -- (-1472.554) (-1471.631) (-1471.111) [-1472.390] * (-1478.338) (-1469.863) [-1471.080] (-1476.280) -- 0:00:01
973500 -- (-1478.679) (-1475.735) [-1470.260] (-1473.902) * (-1474.633) (-1476.377) [-1471.477] (-1470.743) -- 0:00:01
974000 -- (-1476.390) (-1472.524) (-1472.374) [-1471.295] * (-1475.873) (-1481.144) [-1472.043] (-1474.232) -- 0:00:01
974500 -- (-1471.923) (-1476.012) (-1476.146) [-1473.173] * (-1477.398) [-1472.204] (-1473.078) (-1475.008) -- 0:00:01
975000 -- (-1471.743) [-1470.314] (-1472.081) (-1473.442) * (-1473.116) (-1477.689) (-1474.083) [-1472.895] -- 0:00:01
Average standard deviation of split frequencies: 0.007696
975500 -- (-1471.613) [-1471.239] (-1475.457) (-1474.760) * (-1474.768) [-1471.755] (-1473.276) (-1472.575) -- 0:00:01
976000 -- (-1471.877) [-1474.167] (-1473.381) (-1474.943) * (-1474.572) [-1471.755] (-1474.870) (-1471.267) -- 0:00:01
976500 -- (-1473.807) [-1470.827] (-1471.532) (-1476.204) * (-1474.075) (-1470.974) (-1474.686) [-1473.347] -- 0:00:01
977000 -- (-1474.859) (-1470.251) [-1470.430] (-1476.379) * (-1473.802) [-1475.002] (-1471.507) (-1473.896) -- 0:00:01
977500 -- [-1471.580] (-1472.862) (-1473.358) (-1473.819) * (-1476.075) (-1472.599) (-1473.630) [-1475.536] -- 0:00:01
978000 -- (-1473.752) (-1474.867) [-1472.718] (-1475.194) * [-1474.490] (-1474.610) (-1472.623) (-1474.365) -- 0:00:01
978500 -- (-1470.760) [-1473.380] (-1471.461) (-1487.025) * (-1470.572) (-1473.091) (-1472.903) [-1474.239] -- 0:00:01
979000 -- [-1475.060] (-1471.987) (-1477.326) (-1479.044) * (-1472.020) [-1472.661] (-1473.442) (-1476.820) -- 0:00:01
979500 -- [-1471.951] (-1474.605) (-1472.901) (-1479.162) * (-1472.338) [-1475.999] (-1477.012) (-1478.574) -- 0:00:01
980000 -- (-1470.581) (-1475.668) [-1471.415] (-1474.856) * [-1472.984] (-1475.122) (-1474.495) (-1472.679) -- 0:00:01
Average standard deviation of split frequencies: 0.007275
980500 -- (-1472.657) (-1472.030) (-1471.138) [-1473.629] * (-1474.981) (-1471.592) (-1471.494) [-1476.610] -- 0:00:01
981000 -- (-1473.287) (-1474.907) [-1473.138] (-1472.869) * [-1471.433] (-1471.954) (-1474.777) (-1472.972) -- 0:00:01
981500 -- (-1471.823) (-1473.913) (-1476.933) [-1471.444] * (-1476.447) [-1471.882] (-1474.072) (-1473.949) -- 0:00:01
982000 -- (-1473.128) (-1472.428) (-1473.206) [-1474.515] * [-1473.262] (-1475.210) (-1478.408) (-1472.531) -- 0:00:01
982500 -- [-1471.643] (-1470.416) (-1470.768) (-1475.214) * (-1473.025) (-1470.634) [-1472.844] (-1474.873) -- 0:00:01
983000 -- (-1475.163) (-1475.648) (-1471.455) [-1471.726] * (-1473.063) [-1474.976] (-1474.502) (-1476.001) -- 0:00:01
983500 -- (-1476.521) [-1474.938] (-1470.721) (-1471.955) * (-1472.540) (-1471.975) [-1477.478] (-1475.379) -- 0:00:01
984000 -- (-1471.777) (-1475.396) [-1470.598] (-1472.738) * [-1471.375] (-1473.738) (-1474.930) (-1473.532) -- 0:00:01
984500 -- (-1478.529) [-1472.321] (-1478.694) (-1472.890) * [-1471.808] (-1475.218) (-1478.710) (-1473.982) -- 0:00:01
985000 -- (-1473.264) [-1469.816] (-1473.686) (-1472.990) * (-1472.295) [-1471.089] (-1474.107) (-1475.447) -- 0:00:01
Average standard deviation of split frequencies: 0.007650
985500 -- (-1472.483) [-1472.017] (-1476.473) (-1473.510) * [-1471.740] (-1474.759) (-1475.634) (-1478.353) -- 0:00:00
986000 -- [-1472.078] (-1473.947) (-1477.491) (-1473.873) * (-1473.670) [-1474.315] (-1473.158) (-1475.177) -- 0:00:00
986500 -- [-1476.544] (-1483.659) (-1476.938) (-1472.066) * (-1471.754) (-1474.856) [-1472.905] (-1475.913) -- 0:00:00
987000 -- (-1472.568) (-1474.276) (-1474.016) [-1473.785] * (-1471.525) (-1470.445) (-1475.028) [-1473.986] -- 0:00:00
987500 -- [-1471.293] (-1474.408) (-1475.900) (-1473.086) * (-1471.889) (-1473.482) (-1471.579) [-1472.832] -- 0:00:00
988000 -- (-1471.542) (-1474.308) [-1475.564] (-1471.794) * (-1472.843) (-1475.888) [-1474.896] (-1472.771) -- 0:00:00
988500 -- (-1477.001) [-1473.225] (-1472.405) (-1471.055) * (-1479.023) [-1472.555] (-1474.018) (-1471.784) -- 0:00:00
989000 -- [-1471.886] (-1476.265) (-1476.341) (-1471.211) * (-1472.049) (-1474.823) (-1474.848) [-1472.260] -- 0:00:00
989500 -- (-1475.913) (-1477.010) [-1473.435] (-1475.389) * (-1470.626) (-1472.625) (-1477.999) [-1471.997] -- 0:00:00
990000 -- (-1478.606) (-1474.410) [-1470.682] (-1477.953) * (-1474.295) (-1471.674) [-1473.120] (-1474.007) -- 0:00:00
Average standard deviation of split frequencies: 0.007550
990500 -- (-1475.713) (-1474.597) (-1472.114) [-1473.482] * (-1475.906) [-1472.828] (-1474.283) (-1474.369) -- 0:00:00
991000 -- [-1471.515] (-1473.267) (-1472.209) (-1472.256) * (-1471.150) [-1472.952] (-1470.822) (-1472.923) -- 0:00:00
991500 -- [-1473.107] (-1473.005) (-1474.452) (-1472.266) * (-1475.129) (-1472.921) [-1471.210] (-1473.750) -- 0:00:00
992000 -- (-1477.941) [-1471.708] (-1473.982) (-1474.622) * (-1477.031) (-1476.148) [-1471.277] (-1474.681) -- 0:00:00
992500 -- [-1476.688] (-1470.766) (-1471.324) (-1474.499) * (-1475.871) (-1472.898) [-1473.159] (-1474.245) -- 0:00:00
993000 -- [-1473.837] (-1476.325) (-1473.381) (-1475.628) * [-1476.591] (-1471.028) (-1472.823) (-1478.604) -- 0:00:00
993500 -- (-1477.307) (-1481.305) [-1472.687] (-1475.566) * [-1474.946] (-1471.405) (-1471.350) (-1479.051) -- 0:00:00
994000 -- (-1476.401) (-1476.562) [-1472.163] (-1476.391) * (-1473.786) (-1469.518) [-1477.988] (-1474.438) -- 0:00:00
994500 -- (-1473.251) [-1476.368] (-1474.016) (-1474.063) * (-1476.127) (-1474.557) (-1474.168) [-1474.527] -- 0:00:00
995000 -- (-1475.264) [-1474.741] (-1476.356) (-1473.698) * (-1472.760) (-1470.368) [-1473.343] (-1472.971) -- 0:00:00
Average standard deviation of split frequencies: 0.007478
995500 -- (-1472.715) [-1472.326] (-1475.240) (-1477.881) * (-1475.809) [-1471.171] (-1472.088) (-1473.310) -- 0:00:00
996000 -- (-1473.993) [-1474.957] (-1472.160) (-1479.823) * (-1475.544) [-1472.734] (-1471.409) (-1477.783) -- 0:00:00
996500 -- (-1474.490) (-1476.467) (-1476.244) [-1477.048] * (-1475.406) [-1471.973] (-1473.008) (-1475.709) -- 0:00:00
997000 -- (-1474.042) (-1474.936) (-1471.795) [-1475.679] * (-1476.418) (-1472.203) (-1475.501) [-1473.404] -- 0:00:00
997500 -- (-1472.682) (-1476.905) [-1472.573] (-1475.106) * (-1472.408) [-1473.894] (-1474.548) (-1472.948) -- 0:00:00
998000 -- (-1474.934) (-1476.056) [-1474.985] (-1475.523) * (-1475.586) (-1472.430) (-1474.346) [-1473.146] -- 0:00:00
998500 -- (-1475.908) [-1472.350] (-1471.980) (-1477.573) * (-1477.404) (-1471.916) (-1473.260) [-1475.525] -- 0:00:00
999000 -- [-1477.087] (-1475.998) (-1470.718) (-1477.011) * (-1471.732) [-1474.316] (-1476.624) (-1475.206) -- 0:00:00
999500 -- (-1472.936) (-1474.801) (-1470.977) [-1477.876] * [-1470.778] (-1474.583) (-1474.677) (-1473.361) -- 0:00:00
1000000 -- (-1475.061) (-1474.423) [-1473.113] (-1474.566) * (-1471.865) [-1473.783] (-1470.537) (-1473.233) -- 0:00:00
Average standard deviation of split frequencies: 0.007475
Analysis completed in 1 mins 8 seconds
Analysis used 66.38 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1467.46
Likelihood of best state for "cold" chain of run 2 was -1467.47
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.4 % ( 68 %) Dirichlet(Revmat{all})
97.3 % ( 92 %) Slider(Revmat{all})
25.9 % ( 20 %) Dirichlet(Pi{all})
27.3 % ( 24 %) Slider(Pi{all})
54.8 % ( 40 %) Multiplier(Alpha{1,2})
80.0 % ( 45 %) Multiplier(Alpha{3})
23.7 % ( 22 %) Slider(Pinvar{all})
97.7 % ( 97 %) ExtSPR(Tau{all},V{all})
69.5 % ( 65 %) ExtTBR(Tau{all},V{all})
98.7 % ( 96 %) NNI(Tau{all},V{all})
88.2 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 28 %) Multiplier(V{all})
90.2 % ( 89 %) Nodeslider(V{all})
30.4 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 67 %) Dirichlet(Revmat{all})
97.8 % ( 95 %) Slider(Revmat{all})
25.9 % ( 37 %) Dirichlet(Pi{all})
27.3 % ( 25 %) Slider(Pi{all})
54.8 % ( 31 %) Multiplier(Alpha{1,2})
79.4 % ( 56 %) Multiplier(Alpha{3})
23.4 % ( 24 %) Slider(Pinvar{all})
97.6 % ( 98 %) ExtSPR(Tau{all},V{all})
69.0 % ( 68 %) ExtTBR(Tau{all},V{all})
98.7 % ( 98 %) NNI(Tau{all},V{all})
88.3 % ( 85 %) ParsSPR(Tau{all},V{all})
28.0 % ( 22 %) Multiplier(V{all})
90.2 % ( 90 %) Nodeslider(V{all})
30.6 % ( 19 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 166836 0.81 0.65
3 | 167027 166431 0.83
4 | 166180 166653 166873
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.79 0.62 0.48
2 | 166261 0.81 0.65
3 | 166040 167096 0.83
4 | 166652 167403 166548
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1472.00
| 1 |
| 2 2 |
| 2 2 |
| 1 2 2 1 |
| 2 1 1 1 1 |
| 2 21 1 22 1 2 1 |
| 2 2 1 1 2 2 |
|1 1 1 2 1 2 1 2 1 2 12 2 |
|22 1 22 12 2 12121 2 1 12 2212 |
| 2 1 1 1 1 1 11 21* 1 |
| 1 1 2 * 112 1 * 2 22|
| 2 1 2 2 221 2 2 2 |
| 1 1 1 1 1 2 |
| 2 1 1 2 1 2 1|
| 2 2 2 1 1 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1474.02
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1471.93 -1476.61
2 -1471.94 -1475.50
--------------------------------------
TOTAL -1471.94 -1476.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.862235 0.088601 0.328010 1.451642 0.829720 1329.41 1415.20 1.000
r(A<->C){all} 0.139220 0.015641 0.000044 0.397418 0.104641 143.27 267.58 1.004
r(A<->G){all} 0.217931 0.023879 0.000365 0.518513 0.190113 193.27 230.41 1.013
r(A<->T){all} 0.127084 0.013909 0.000032 0.371709 0.091967 261.72 299.87 1.000
r(C<->G){all} 0.183699 0.022835 0.000082 0.479258 0.145010 203.70 216.76 1.006
r(C<->T){all} 0.163129 0.018741 0.000019 0.439634 0.128715 248.96 261.33 1.004
r(G<->T){all} 0.168937 0.019484 0.000081 0.447223 0.134151 220.94 277.37 1.008
pi(A){all} 0.153916 0.000119 0.131051 0.174148 0.153735 1308.64 1329.93 1.000
pi(C){all} 0.270048 0.000184 0.244318 0.296899 0.269784 1166.58 1258.01 1.000
pi(G){all} 0.323632 0.000202 0.295318 0.351491 0.323711 1118.89 1244.66 1.000
pi(T){all} 0.252403 0.000169 0.225014 0.275572 0.252343 1351.95 1426.48 1.000
alpha{1,2} 0.189123 0.040844 0.016292 0.445431 0.138513 1101.91 1207.37 1.000
alpha{3} 0.399753 0.206909 0.000111 1.364910 0.229912 580.77 972.74 1.000
pinvar{all} 0.996610 0.000007 0.991545 0.999892 0.997278 1253.46 1345.92 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- ...*.*
9 -- ..**..
10 -- ..*..*
11 -- ..****
12 -- .**.**
13 -- ..*.*.
14 -- .**...
15 -- .*.*..
16 -- ...**.
17 -- .****.
18 -- .*...*
19 -- ....**
20 -- .*..*.
21 -- .*.***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 470 0.156562 0.012248 0.147901 0.165223 2
8 456 0.151899 0.007537 0.146569 0.157229 2
9 445 0.148235 0.012719 0.139241 0.157229 2
10 443 0.147568 0.006124 0.143238 0.151899 2
11 442 0.147235 0.009422 0.140573 0.153897 2
12 439 0.146236 0.005182 0.142572 0.149900 2
13 438 0.145903 0.007537 0.140573 0.151233 2
14 437 0.145570 0.012719 0.136576 0.154564 2
15 431 0.143571 0.010835 0.135909 0.151233 2
16 426 0.141905 0.000942 0.141239 0.142572 2
17 423 0.140906 0.013662 0.131246 0.150566 2
18 420 0.139907 0.001884 0.138574 0.141239 2
19 407 0.135576 0.006124 0.131246 0.139907 2
20 391 0.130247 0.003298 0.127915 0.132578 2
21 386 0.128581 0.001884 0.127249 0.129913 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/mraY/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.170458 0.016293 0.000511 0.418795 0.140146 1.001 2
length{all}[2] 0.089232 0.008601 0.000003 0.271001 0.059823 1.000 2
length{all}[3] 0.086339 0.007421 0.000054 0.264147 0.060251 1.000 2
length{all}[4] 0.086449 0.008584 0.000015 0.271886 0.056819 1.000 2
length{all}[5] 0.083350 0.007043 0.000022 0.253697 0.055846 1.000 2
length{all}[6] 0.087656 0.007927 0.000018 0.267751 0.060266 1.000 2
length{all}[7] 0.083544 0.006514 0.000324 0.254248 0.056214 0.998 2
length{all}[8] 0.078975 0.006567 0.000281 0.245197 0.051701 0.998 2
length{all}[9] 0.088499 0.007077 0.000185 0.256607 0.064120 0.998 2
length{all}[10] 0.090175 0.006996 0.000079 0.273919 0.065126 0.998 2
length{all}[11] 0.085106 0.007541 0.000430 0.281351 0.055869 0.998 2
length{all}[12] 0.088729 0.007722 0.000119 0.261869 0.060934 0.999 2
length{all}[13] 0.089972 0.009406 0.000259 0.281039 0.059193 0.999 2
length{all}[14] 0.086670 0.006725 0.000014 0.251506 0.063953 1.009 2
length{all}[15] 0.082090 0.008051 0.000304 0.243551 0.051691 1.003 2
length{all}[16] 0.087116 0.007138 0.000038 0.254581 0.058582 0.999 2
length{all}[17] 0.088346 0.007428 0.000112 0.276348 0.063197 0.998 2
length{all}[18] 0.085178 0.007468 0.000030 0.280952 0.059063 0.998 2
length{all}[19] 0.086009 0.007554 0.000032 0.268265 0.057516 1.003 2
length{all}[20] 0.086979 0.008755 0.000106 0.253378 0.060974 1.012 2
length{all}[21] 0.083048 0.007211 0.000284 0.266306 0.055277 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007475
Maximum standard deviation of split frequencies = 0.013662
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.012
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------- C2 (2)
|
|------------------------------- C3 (3)
+
|----------------------------- C4 (4)
|
|----------------------------- C5 (5)
|
\------------------------------- C6 (6)
|---------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1077
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 60 patterns at 359 / 359 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 60 patterns at 359 / 359 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
58560 bytes for conP
5280 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.106651 0.107196 0.036018 0.044825 0.027620 0.028024 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1536.405046
Iterating by ming2
Initial: fx= 1536.405046
x= 0.10665 0.10720 0.03602 0.04482 0.02762 0.02802 0.30000 1.30000
1 h-m-p 0.0000 0.0001 862.6002 ++ 1478.532997 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 1166.4589 ++ 1477.227007 m 0.0000 24 | 2/8
3 h-m-p 0.0000 0.0001 210.7623 ++ 1467.766885 m 0.0001 35 | 3/8
4 h-m-p 0.0001 0.0008 117.0392 ++ 1450.796971 m 0.0008 46 | 4/8
5 h-m-p 0.0001 0.0003 238.4492 ++ 1427.814959 m 0.0003 57 | 5/8
6 h-m-p 0.0011 0.0167 20.1994 ++ 1423.031456 m 0.0167 68 | 5/8
7 h-m-p 0.2352 8.0000 1.4334 YCYYYCYCCC 1416.912858 9 0.0965 92 | 5/8
8 h-m-p 0.0692 8.0000 1.9988 ++++ 1414.614539 m 8.0000 105 | 5/8
9 h-m-p 1.6000 8.0000 0.0659 ++ 1414.607476 m 8.0000 116 | 5/8
10 h-m-p 0.0496 8.0000 10.6158 +++CYY 1414.451740 2 3.1053 136 | 5/8
11 h-m-p 1.6000 8.0000 0.0112 ++ 1414.451538 m 8.0000 147 | 5/8
12 h-m-p 0.0160 8.0000 20.7466 +++CYC 1414.428034 2 1.2862 167 | 5/8
13 h-m-p 1.6000 8.0000 6.6019 +CC 1414.411862 1 5.7257 181 | 5/8
14 h-m-p 1.6000 8.0000 16.7519 YCC 1414.401845 2 3.3957 195 | 5/8
15 h-m-p 1.6000 8.0000 26.1567 YC 1414.394521 1 3.2797 207 | 5/8
16 h-m-p 1.6000 8.0000 37.7007 YC 1414.389992 1 3.3622 219 | 5/8
17 h-m-p 1.6000 8.0000 55.6790 YC 1414.386823 1 3.1444 231 | 5/8
18 h-m-p 1.6000 8.0000 83.0676 YC 1414.384662 1 3.5820 243 | 5/8
19 h-m-p 0.5967 2.9837 123.4601 ++ 1414.383272 m 2.9837 254 | 6/8
20 h-m-p 1.6000 8.0000 25.9301 YC 1414.383112 1 1.1690 266 | 6/8
21 h-m-p 0.7770 8.0000 39.0108 ++ 1414.382903 m 8.0000 277 | 6/8
22 h-m-p 0.0052 0.0259 282.5108 ++ 1414.382899 m 0.0259 288 | 7/8
23 h-m-p 0.0264 8.0000 0.0000 +++Y 1414.382899 0 1.0633 302 | 7/8
24 h-m-p 1.6000 8.0000 0.0000 -----C 1414.382899 0 0.0004 319
Out..
lnL = -1414.382899
320 lfun, 320 eigenQcodon, 1920 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.042793 0.061945 0.030884 0.037270 0.109623 0.046548 999.000000 0.539748 0.304858
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.023728
np = 9
lnL0 = -1523.737226
Iterating by ming2
Initial: fx= 1523.737226
x= 0.04279 0.06195 0.03088 0.03727 0.10962 0.04655 951.42857 0.53975 0.30486
1 h-m-p 0.0000 0.0001 801.5515 ++ 1463.802752 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 14332.4370 ++ 1452.712741 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0001 241.0539 ++ 1442.840089 m 0.0001 38 | 3/9
4 h-m-p 0.0001 0.0008 128.6127 ++ 1430.231245 m 0.0008 50 | 4/9
5 h-m-p 0.0000 0.0002 209.9426 ++ 1415.681099 m 0.0002 62 | 5/9
6 h-m-p 0.0102 0.3635 1.5208 +++ 1415.012564 m 0.3635 75 | 6/9
7 h-m-p 0.4512 2.2559 0.1488 ++ 1414.780823 m 2.2559 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0003 YYC 1414.753976 2 2.2687 104 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 C 1414.753975 0 1.5652 118
Out..
lnL = -1414.753975
119 lfun, 357 eigenQcodon, 1428 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.077972 0.044013 0.037961 0.071525 0.057258 0.058450 951.428593 1.579111 0.319419 0.166129 1144.291574
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000185
np = 11
lnL0 = -1454.766224
Iterating by ming2
Initial: fx= 1454.766224
x= 0.07797 0.04401 0.03796 0.07152 0.05726 0.05845 951.42859 1.57911 0.31942 0.16613 951.42857
1 h-m-p 0.0000 0.0008 106.1768 ++++ 1439.932557 m 0.0008 18 | 1/11
2 h-m-p 0.0025 0.0123 29.6158 ++ 1428.947076 m 0.0123 32 | 2/11
3 h-m-p 0.0000 0.0001 588.8880 ++ 1428.391304 m 0.0001 46 | 3/11
4 h-m-p 0.0000 0.0000 31741.7803 ++ 1428.352997 m 0.0000 60 | 4/11
5 h-m-p 0.0000 0.0000 123768.8411 ++ 1428.153276 m 0.0000 74 | 5/11
6 h-m-p 0.0001 0.0018 170.8806 +++ 1419.982699 m 0.0018 89 | 5/11
7 h-m-p 0.0870 0.4349 2.9732 YYCYCYC 1414.386309 6 0.0292 112 | 5/11
8 h-m-p 1.6000 8.0000 0.0011 ++ 1414.386288 m 8.0000 126 | 5/11
9 h-m-p 0.0160 8.0000 0.8075 ++++YC 1414.384640 1 2.6217 151 | 5/11
10 h-m-p 1.6000 8.0000 0.0555 Y 1414.384633 0 3.0343 171 | 5/11
11 h-m-p 1.6000 8.0000 0.0032 ++ 1414.384624 m 8.0000 191 | 5/11
12 h-m-p 0.0533 8.0000 0.4833 +++YC 1414.384192 1 2.3900 215 | 5/11
13 h-m-p 1.6000 8.0000 0.4014 +YC 1414.383511 1 5.0008 237 | 5/11
14 h-m-p 1.6000 8.0000 0.0362 C 1414.383509 0 2.2393 257 | 5/11
15 h-m-p 1.6000 8.0000 0.0046 ++ 1414.383504 m 8.0000 277 | 5/11
16 h-m-p 0.2110 8.0000 0.1754 +YC 1414.383429 1 1.9726 299 | 5/11
17 h-m-p 1.5607 8.0000 0.2217 ++ 1414.383142 m 8.0000 319 | 5/11
18 h-m-p 1.0347 5.1733 0.6832 ++ 1414.383039 m 5.1733 339 | 6/11
19 h-m-p 1.6000 8.0000 0.3211 ++ 1414.383032 m 8.0000 359 | 6/11
20 h-m-p 1.6000 8.0000 0.4810 C 1414.383031 0 1.7218 378 | 6/11
21 h-m-p 1.6000 8.0000 0.3495 Y 1414.383030 0 3.0813 397 | 6/11
22 h-m-p 1.6000 8.0000 0.6653 Y 1414.383030 0 3.9848 416 | 6/11
23 h-m-p 1.6000 8.0000 0.3779 Y 1414.383030 0 1.1666 435 | 6/11
24 h-m-p 0.6080 8.0000 0.7250 +Y 1414.383030 0 1.7720 455 | 6/11
25 h-m-p 1.0204 8.0000 1.2590 ++ 1414.383030 m 8.0000 474 | 6/11
26 h-m-p 0.6357 6.8042 15.8433 +Y 1414.383029 0 1.8111 489 | 6/11
27 h-m-p 0.6986 3.4931 22.6384 ++ 1414.383028 m 3.4931 503 | 6/11
28 h-m-p -0.0000 -0.0000 2297.7924
h-m-p: -0.00000000e+00 -0.00000000e+00 2.29779242e+03 1414.383028
.. | 6/11
29 h-m-p 0.0160 8.0000 0.2942 ----Y 1414.383027 0 0.0000 532 | 6/11
30 h-m-p 1.1058 8.0000 0.0000 ---C 1414.383027 0 0.0039 554
Out..
lnL = -1414.383027
555 lfun, 2220 eigenQcodon, 9990 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1419.322190 S = -1417.883305 -2.367448
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 60 patterns 0:04
did 20 / 60 patterns 0:04
did 30 / 60 patterns 0:04
did 40 / 60 patterns 0:04
did 50 / 60 patterns 0:04
did 60 / 60 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.104456 0.077140 0.012232 0.098668 0.094965 0.044905 952.280878 0.566952 1.985251
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.039047
np = 9
lnL0 = -1559.332295
Iterating by ming2
Initial: fx= 1559.332295
x= 0.10446 0.07714 0.01223 0.09867 0.09496 0.04490 952.28088 0.56695 1.98525
1 h-m-p 0.0000 0.0000 798.0723 ++ 1536.429905 m 0.0000 14 | 1/9
2 h-m-p 0.0003 0.0017 65.2444 +YYYCYYYCC 1531.984842 8 0.0015 37 | 1/9
3 h-m-p 0.0039 0.0780 25.2193 ------------.. | 1/9
4 h-m-p 0.0000 0.0000 702.2677 +CCYYYCCCCC 1513.911048 9 0.0000 87 | 1/9
5 h-m-p 0.0000 0.0000 5163.5134 ++ 1465.292373 m 0.0000 99 | 2/9
6 h-m-p 0.0000 0.0001 281.3450 ++ 1449.870232 m 0.0001 111 | 2/9
7 h-m-p -0.0000 -0.0000 20.3003
h-m-p: -2.62778640e-19 -1.31389320e-18 2.03002888e+01 1449.870232
.. | 2/9
8 h-m-p 0.0000 0.0000 236550.1484 ---YCYYYCYCCC 1444.323137 9 0.0000 148 | 2/9
9 h-m-p 0.0000 0.0000 611.8376 ++ 1429.228680 m 0.0000 160 | 3/9
10 h-m-p 0.0009 0.2072 22.6268 -----------.. | 3/9
11 h-m-p 0.0000 0.0000 505.3981 ++ 1416.796314 m 0.0000 193 | 4/9
12 h-m-p 0.0000 0.0000 6008.0398 ++ 1415.586554 m 0.0000 205 | 5/9
13 h-m-p 0.0136 6.8027 0.9995 +++YCYCC 1414.991183 4 1.6585 226 | 5/9
14 h-m-p 1.6000 8.0000 0.1633 +YC 1414.868866 1 4.0041 244 | 5/9
15 h-m-p 0.6932 3.4661 0.3588 +
QuantileBeta(0.85, 3.37055, 0.00500) = 1.000000e+00 2000 rounds
+ 1414.763866 m 3.4661 260
QuantileBeta(0.85, 3.37055, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.37055, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.37055, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.37055, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.37055, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.37055, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.37055, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.37055, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.37055, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.37070, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.37040, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
16 h-m-p 1.6000 8.0000 0.0451
QuantileBeta(0.85, 3.44275, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.65936, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.41374, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 3.41128, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 3.39091, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40987, 0.00500) = 1.000000e+00 2000 rounds
C 1414.753971 2 0.8713 279
QuantileBeta(0.85, 3.40987, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40987, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40987, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40987, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40987, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40987, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40987, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40987, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40987, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.41002, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40972, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40987, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
17 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.85, 3.40977, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40947, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
C 1414.753971 0 1.7423 294
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40961, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
18 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 3.40982, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40977, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
C 1414.753971 0 0.0063 312
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -1414.753971
313 lfun, 3443 eigenQcodon, 18780 P(t)
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40976, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.041723 0.012940 0.087122 0.033378 0.032566 0.017474 952.280913 0.900000 0.596774 1.796819 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000255
np = 11
lnL0 = -1441.556083
Iterating by ming2
Initial: fx= 1441.556083
x= 0.04172 0.01294 0.08712 0.03338 0.03257 0.01747 952.28091 0.90000 0.59677 1.79682 951.42857
1 h-m-p 0.0000 0.0002 222.3271 +++ 1431.373135 m 0.0002 17 | 1/11
2 h-m-p 0.0000 0.0000 1015.4387 ++ 1429.553851 m 0.0000 31 | 2/11
3 h-m-p 0.0000 0.0000 2292.4166 +YYYYYCYCYC 1420.380278 10 0.0000 58 | 2/11
4 h-m-p 0.0000 0.0002 58.4741 ++ 1419.720385 m 0.0002 72 | 3/11
5 h-m-p 0.0000 0.0002 130.5775 ++ 1419.157390 m 0.0002 86 | 4/11
6 h-m-p 0.0003 0.0013 44.1006 ++ 1417.008716 m 0.0013 100 | 5/11
7 h-m-p 0.0355 0.5727 0.8116 ++YYYCYCYC 1414.579122 7 0.5468 126 | 5/11
8 h-m-p 0.0812 0.4058 0.1906 CC 1414.577597 1 0.0285 148 | 5/11
9 h-m-p 0.0160 8.0000 0.7806 +++CYCC 1414.464313 3 0.9074 176 | 5/11
10 h-m-p 1.2089 6.0445 0.0758 YCCCC 1414.440286 4 1.4541 203 | 5/11
11 h-m-p 0.9672 8.0000 0.1140 ++ 1414.413196 m 8.0000 223 | 5/11
12 h-m-p 1.6000 8.0000 0.3591 C 1414.407937 0 1.5917 243 | 5/11
13 h-m-p 1.0370 8.0000 0.5511 CCC 1414.399580 2 1.7819 267 | 5/11
14 h-m-p 1.3948 6.9741 0.5206 +
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
+ 1414.392154 m 6.9741 287
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82821, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82776, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.82798, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
15 h-m-p 1.6000 8.0000 1.2253
QuantileBeta(0.85, 8.78837, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.66953, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.04106, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 8.16975, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 8.47906, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19138, 0.00500) = 1.000000e+00 2000 rounds
C 1414.389198 2 1.1128 310
QuantileBeta(0.85, 8.19138, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19138, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19138, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19138, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19138, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19138, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19138, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19138, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19138, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19138, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.19138, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
16 h-m-p 1.6000 8.0000 0.7990
QuantileBeta(0.85, 9.46978, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.30498, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
+ 1414.386247 m 8.0000 324
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58303, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.58338, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
17 h-m-p 1.6000 8.0000 2.6592
QuantileBeta(0.85, 18.83798, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 31.60177, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 35.85637, 0.00500) = 1.000000e+00 2000 rounds
+ 1414.384205 m 8.0000 343
QuantileBeta(0.85, 35.85637, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 35.85637, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 35.85637, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 35.85637, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 35.85637, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 35.85637, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 35.85637, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 35.85637, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 35.85639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 35.85637, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 35.85637, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
18 h-m-p 1.6000 8.0000 5.2262
QuantileBeta(0.85, 44.21809, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 41.06544, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 41.17995, 0.00500) = 1.000000e+00 2000 rounds
C 1414.383898 1 1.0187 358
QuantileBeta(0.85, 41.17995, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 41.17995, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 41.17995, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 41.17995, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 41.17995, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 41.17995, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 41.17995, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 41.17995, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 41.17997, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 41.17995, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 41.17995, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
19 h-m-p 1.3428 8.0000 3.9647
QuantileBeta(0.85, 46.50353, 0.00500) = 1.000000e+00 2000 rounds
++ 1414.383320 m 8.0000 372 | 6/11
20 h-m-p 0.3601 1.8004 14.4988 ++ 1414.383133 m 1.8004 386 | 6/11
21 h-m-p 0.0000 0.0000 30.2088
h-m-p: 0.00000000e+00 0.00000000e+00 3.02087837e+01 1414.383133
.. | 6/11
22 h-m-p 0.0160 8.0000 0.8157 ----Y 1414.383130 0 0.0000 415 | 6/11
23 h-m-p 0.0000 0.0002 0.0007 ++ 1414.383130 m 0.0002 434
Out..
lnL = -1414.383130
435 lfun, 5220 eigenQcodon, 28710 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1418.846721 S = -1417.667709 -1.981613
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 60 patterns 0:18
did 20 / 60 patterns 0:18
did 30 / 60 patterns 0:18
did 40 / 60 patterns 0:19
did 50 / 60 patterns 0:19
did 60 / 60 patterns 0:19
Time used: 0:19
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/10res/mraY/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 359
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 4 4 4 4 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 1 1 1 1 1 1
TTC 15 15 15 15 15 15 | TCC 2 2 2 2 2 2 | TAC 2 2 2 2 2 2 | TGC 4 4 4 4 4 4
Leu TTA 2 2 2 2 2 2 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 16 16 16 16 16 16 | TCG 6 6 6 6 6 6 | TAG 0 0 0 0 0 0 | Trp TGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 3 3 3 3 3 3 | Arg CGT 4 4 4 4 4 4
CTC 3 3 3 3 3 3 | CCC 1 1 1 1 1 1 | CAC 4 4 4 4 4 4 | CGC 6 6 6 6 6 6
CTA 2 2 2 2 2 2 | CCA 3 3 3 3 3 3 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 22 22 22 22 22 22 | CCG 6 6 6 6 6 6 | CAG 5 5 5 5 5 5 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 9 10 10 10 10 10 | Thr ACT 5 5 5 5 5 5 | Asn AAT 5 5 5 5 5 5 | Ser AGT 3 3 3 3 3 3
ATC 12 12 12 12 12 12 | ACC 15 15 15 15 15 15 | AAC 4 4 4 4 4 4 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 5 5 5 5 5 5 | Lys AAA 1 1 1 1 1 1 | Arg AGA 2 2 2 2 2 2
Met ATG 7 7 7 7 7 7 | ACG 3 3 3 3 3 3 | AAG 4 4 4 4 4 4 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 6 5 5 5 5 5 | Ala GCT 8 8 8 8 8 8 | Asp GAT 5 5 5 5 5 5 | Gly GGT 11 11 11 11 11 11
GTC 14 14 14 14 14 14 | GCC 17 17 17 17 17 17 | GAC 5 5 5 5 5 5 | GGC 21 21 21 21 21 21
GTA 2 2 2 2 2 2 | GCA 3 3 3 3 3 3 | Glu GAA 6 6 6 6 6 6 | GGA 4 4 4 4 4 4
GTG 16 16 16 16 16 16 | GCG 20 20 20 20 20 20 | GAG 3 3 3 3 3 3 | GGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_012634423_1_949_MLBR_RS04485
position 1: T:0.18663 C:0.18663 A:0.22006 G:0.40669
position 2: T:0.37047 C:0.27019 A:0.14485 G:0.21448
position 3: T:0.20056 C:0.35376 A:0.09192 G:0.35376
Average T:0.25255 C:0.27019 A:0.15227 G:0.32498
#2: NC_002677_1_NP_301694_1_566_mraY
position 1: T:0.18663 C:0.18663 A:0.22284 G:0.40390
position 2: T:0.37047 C:0.27019 A:0.14485 G:0.21448
position 3: T:0.20056 C:0.35376 A:0.09192 G:0.35376
Average T:0.25255 C:0.27019 A:0.15320 G:0.32405
#3: NZ_LVXE01000007_1_WP_010908018_1_2519_A3216_RS03985
position 1: T:0.18663 C:0.18663 A:0.22284 G:0.40390
position 2: T:0.37047 C:0.27019 A:0.14485 G:0.21448
position 3: T:0.20056 C:0.35376 A:0.09192 G:0.35376
Average T:0.25255 C:0.27019 A:0.15320 G:0.32405
#4: NZ_LYPH01000011_1_WP_010908018_1_341_A8144_RS01615
position 1: T:0.18663 C:0.18663 A:0.22284 G:0.40390
position 2: T:0.37047 C:0.27019 A:0.14485 G:0.21448
position 3: T:0.20056 C:0.35376 A:0.09192 G:0.35376
Average T:0.25255 C:0.27019 A:0.15320 G:0.32405
#5: NZ_CP029543_1_WP_010908018_1_969_DIJ64_RS04920
position 1: T:0.18663 C:0.18663 A:0.22284 G:0.40390
position 2: T:0.37047 C:0.27019 A:0.14485 G:0.21448
position 3: T:0.20056 C:0.35376 A:0.09192 G:0.35376
Average T:0.25255 C:0.27019 A:0.15320 G:0.32405
#6: NZ_AP014567_1_WP_010908018_1_986_JK2ML_RS05005
position 1: T:0.18663 C:0.18663 A:0.22284 G:0.40390
position 2: T:0.37047 C:0.27019 A:0.14485 G:0.21448
position 3: T:0.20056 C:0.35376 A:0.09192 G:0.35376
Average T:0.25255 C:0.27019 A:0.15320 G:0.32405
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 24 | Ser S TCT 12 | Tyr Y TAT 24 | Cys C TGT 6
TTC 90 | TCC 12 | TAC 12 | TGC 24
Leu L TTA 12 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 96 | TCG 36 | TAG 0 | Trp W TGG 48
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 18 | Arg R CGT 24
CTC 18 | CCC 6 | CAC 24 | CGC 36
CTA 12 | CCA 18 | Gln Q CAA 6 | CGA 0
CTG 132 | CCG 36 | CAG 30 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 59 | Thr T ACT 30 | Asn N AAT 30 | Ser S AGT 18
ATC 72 | ACC 90 | AAC 24 | AGC 12
ATA 6 | ACA 30 | Lys K AAA 6 | Arg R AGA 12
Met M ATG 42 | ACG 18 | AAG 24 | AGG 6
------------------------------------------------------------------------------
Val V GTT 31 | Ala A GCT 48 | Asp D GAT 30 | Gly G GGT 66
GTC 84 | GCC 102 | GAC 30 | GGC 126
GTA 12 | GCA 18 | Glu E GAA 36 | GGA 24
GTG 96 | GCG 120 | GAG 18 | GGG 30
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18663 C:0.18663 A:0.22238 G:0.40436
position 2: T:0.37047 C:0.27019 A:0.14485 G:0.21448
position 3: T:0.20056 C:0.35376 A:0.09192 G:0.35376
Average T:0.25255 C:0.27019 A:0.15305 G:0.32420
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -1414.382899 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.002929 0.000004 0.000004 0.000004 0.000004 0.000004 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002949
(1: 0.002929, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634423_1_949_MLBR_RS04485: 0.002929, NC_002677_1_NP_301694_1_566_mraY: 0.000004, NZ_LVXE01000007_1_WP_010908018_1_2519_A3216_RS03985: 0.000004, NZ_LYPH01000011_1_WP_010908018_1_341_A8144_RS01615: 0.000004, NZ_CP029543_1_WP_010908018_1_969_DIJ64_RS04920: 0.000004, NZ_AP014567_1_WP_010908018_1_986_JK2ML_RS05005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.003 765.4 311.6 999.0000 0.0014 0.0000 1.1 0.0
7..2 0.000 765.4 311.6 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 765.4 311.6 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 765.4 311.6 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 765.4 311.6 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 765.4 311.6 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0014
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1414.753975 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.002843 0.000004 0.000004 0.000004 0.000004 0.000004 951.428593 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002863
(1: 0.002843, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634423_1_949_MLBR_RS04485: 0.002843, NC_002677_1_NP_301694_1_566_mraY: 0.000004, NZ_LVXE01000007_1_WP_010908018_1_2519_A3216_RS03985: 0.000004, NZ_LYPH01000011_1_WP_010908018_1_341_A8144_RS01615: 0.000004, NZ_CP029543_1_WP_010908018_1_969_DIJ64_RS04920: 0.000004, NZ_AP014567_1_WP_010908018_1_986_JK2ML_RS05005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42859
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.003 765.4 311.6 1.0000 0.0009 0.0009 0.7 0.3
7..2 0.000 765.4 311.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 765.4 311.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 765.4 311.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 765.4 311.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 765.4 311.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1414.383027 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.002929 0.000004 0.000004 0.000004 0.000004 0.000004 952.280878 0.000000 0.000000 1.000000 952.353504
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002949
(1: 0.002929, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634423_1_949_MLBR_RS04485: 0.002929, NC_002677_1_NP_301694_1_566_mraY: 0.000004, NZ_LVXE01000007_1_WP_010908018_1_2519_A3216_RS03985: 0.000004, NZ_LYPH01000011_1_WP_010908018_1_341_A8144_RS01615: 0.000004, NZ_CP029543_1_WP_010908018_1_969_DIJ64_RS04920: 0.000004, NZ_AP014567_1_WP_010908018_1_986_JK2ML_RS05005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 952.28088
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 952.35350
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.003 765.4 311.6 952.3535 0.0014 0.0000 1.1 0.0
7..2 0.000 765.4 311.6 952.3535 0.0000 0.0000 0.0 0.0
7..3 0.000 765.4 311.6 952.3535 0.0000 0.0000 0.0 0.0
7..4 0.000 765.4 311.6 952.3535 0.0000 0.0000 0.0 0.0
7..5 0.000 765.4 311.6 952.3535 0.0000 0.0000 0.0 0.0
7..6 0.000 765.4 311.6 952.3535 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634423_1_949_MLBR_RS04485)
Pr(w>1) post mean +- SE for w
1 M 1.000** 952.354
2 R 1.000** 952.354
3 Q 1.000** 952.354
4 I 1.000** 952.354
5 L 1.000** 952.354
6 V 1.000** 952.354
7 A 1.000** 952.354
8 V 1.000** 952.354
9 T 1.000** 952.354
10 V 1.000** 952.354
11 A 1.000** 952.354
12 L 1.000** 952.354
13 V 1.000** 952.354
14 V 1.000** 952.354
15 S 1.000** 952.354
16 I 1.000** 952.354
17 L 1.000** 952.354
18 L 1.000** 952.354
19 T 1.000** 952.354
20 P 1.000** 952.354
21 A 1.000** 952.354
22 L 1.000** 952.354
23 I 1.000** 952.354
24 R 1.000** 952.354
25 L 1.000** 952.354
26 F 1.000** 952.354
27 T 1.000** 952.354
28 R 1.000** 952.354
29 H 1.000** 952.354
30 G 1.000** 952.354
31 F 1.000** 952.354
32 G 1.000** 952.354
33 Q 1.000** 952.354
34 E 1.000** 952.354
35 I 1.000** 952.354
36 R 1.000** 952.354
37 E 1.000** 952.354
38 D 1.000** 952.354
39 G 1.000** 952.354
40 P 1.000** 952.354
41 P 1.000** 952.354
42 S 1.000** 952.354
43 H 1.000** 952.354
44 H 1.000** 952.354
45 N 1.000** 952.354
46 K 1.000** 952.354
47 R 1.000** 952.354
48 G 1.000** 952.354
49 T 1.000** 952.354
50 P 1.000** 952.354
51 S 1.000** 952.354
52 M 1.000** 952.354
53 G 1.000** 952.354
54 G 1.000** 952.354
55 V 1.000** 952.354
56 A 1.000** 952.354
57 I 1.000** 952.354
58 V 1.000** 952.354
59 A 1.000** 952.354
60 G 1.000** 952.354
61 I 1.000** 952.354
62 W 1.000** 952.354
63 A 1.000** 952.354
64 G 1.000** 952.354
65 Y 1.000** 952.354
66 L 1.000** 952.354
67 G 1.000** 952.354
68 T 1.000** 952.354
69 H 1.000** 952.354
70 L 1.000** 952.354
71 A 1.000** 952.354
72 G 1.000** 952.354
73 L 1.000** 952.354
74 A 1.000** 952.354
75 F 1.000** 952.354
76 D 1.000** 952.354
77 G 1.000** 952.354
78 E 1.000** 952.354
79 G 1.000** 952.354
80 V 1.000** 952.354
81 S 1.000** 952.354
82 A 1.000** 952.354
83 S 1.000** 952.354
84 G 1.000** 952.354
85 V 1.000** 952.354
86 L 1.000** 952.354
87 V 1.000** 952.354
88 L 1.000** 952.354
89 G 1.000** 952.354
90 L 1.000** 952.354
91 A 1.000** 952.354
92 T 1.000** 952.354
93 A 1.000** 952.354
94 L 1.000** 952.354
95 G 1.000** 952.354
96 G 1.000** 952.354
97 V 1.000** 952.354
98 G 1.000** 952.354
99 F 1.000** 952.354
100 L 1.000** 952.354
101 D 1.000** 952.354
102 D 1.000** 952.354
103 L 1.000** 952.354
104 I 1.000** 952.354
105 K 1.000** 952.354
106 I 1.000** 952.354
107 R 1.000** 952.354
108 R 1.000** 952.354
109 S 1.000** 952.354
110 R 1.000** 952.354
111 N 1.000** 952.354
112 L 1.000** 952.354
113 G 1.000** 952.354
114 L 1.000** 952.354
115 N 1.000** 952.354
116 K 1.000** 952.354
117 T 1.000** 952.354
118 A 1.000** 952.354
119 K 1.000** 952.354
120 T 1.000** 952.354
121 V 1.000** 952.354
122 G 1.000** 952.354
123 Q 1.000** 952.354
124 I 1.000** 952.354
125 T 1.000** 952.354
126 A 1.000** 952.354
127 A 1.000** 952.354
128 V 1.000** 952.354
129 L 1.000** 952.354
130 F 1.000** 952.354
131 G 1.000** 952.354
132 V 1.000** 952.354
133 L 1.000** 952.354
134 V 1.000** 952.354
135 L 1.000** 952.354
136 Q 1.000** 952.354
137 F 1.000** 952.354
138 R 1.000** 952.354
139 N 1.000** 952.354
140 G 1.000** 952.354
141 A 1.000** 952.354
142 G 1.000** 952.354
143 L 1.000** 952.354
144 T 1.000** 952.354
145 P 1.000** 952.354
146 A 1.000** 952.354
147 S 1.000** 952.354
148 A 1.000** 952.354
149 D 1.000** 952.354
150 L 1.000** 952.354
151 S 1.000** 952.354
152 Y 1.000** 952.354
153 V 1.000** 952.354
154 R 1.000** 952.354
155 E 1.000** 952.354
156 I 1.000** 952.354
157 A 1.000** 952.354
158 T 1.000** 952.354
159 V 1.000** 952.354
160 T 1.000** 952.354
161 L 1.000** 952.354
162 A 1.000** 952.354
163 P 1.000** 952.354
164 A 1.000** 952.354
165 L 1.000** 952.354
166 F 1.000** 952.354
167 V 1.000** 952.354
168 L 1.000** 952.354
169 F 1.000** 952.354
170 C 1.000** 952.354
171 M 1.000** 952.354
172 V 1.000** 952.354
173 I 1.000** 952.354
174 V 1.000** 952.354
175 S 1.000** 952.354
176 A 1.000** 952.354
177 W 1.000** 952.354
178 S 1.000** 952.354
179 N 1.000** 952.354
180 A 1.000** 952.354
181 V 1.000** 952.354
182 N 1.000** 952.354
183 F 1.000** 952.354
184 T 1.000** 952.354
185 D 1.000** 952.354
186 G 1.000** 952.354
187 L 1.000** 952.354
188 D 1.000** 952.354
189 G 1.000** 952.354
190 L 1.000** 952.354
191 A 1.000** 952.354
192 A 1.000** 952.354
193 G 1.000** 952.354
194 S 1.000** 952.354
195 M 1.000** 952.354
196 A 1.000** 952.354
197 M 1.000** 952.354
198 V 1.000** 952.354
199 T 1.000** 952.354
200 A 1.000** 952.354
201 A 1.000** 952.354
202 Y 1.000** 952.354
203 V 1.000** 952.354
204 L 1.000** 952.354
205 I 1.000** 952.354
206 T 1.000** 952.354
207 F 1.000** 952.354
208 W 1.000** 952.354
209 Q 1.000** 952.354
210 Y 1.000** 952.354
211 R 1.000** 952.354
212 N 1.000** 952.354
213 A 1.000** 952.354
214 C 1.000** 952.354
215 V 1.000** 952.354
216 T 1.000** 952.354
217 A 1.000** 952.354
218 P 1.000** 952.354
219 G 1.000** 952.354
220 L 1.000** 952.354
221 G 1.000** 952.354
222 C 1.000** 952.354
223 Y 1.000** 952.354
224 N 1.000** 952.354
225 V 1.000** 952.354
226 R 1.000** 952.354
227 D 1.000** 952.354
228 P 1.000** 952.354
229 L 1.000** 952.354
230 D 1.000** 952.354
231 L 1.000** 952.354
232 T 1.000** 952.354
233 L 1.000** 952.354
234 I 1.000** 952.354
235 A 1.000** 952.354
236 A 1.000** 952.354
237 A 1.000** 952.354
238 T 1.000** 952.354
239 V 1.000** 952.354
240 G 1.000** 952.354
241 A 1.000** 952.354
242 C 1.000** 952.354
243 I 1.000** 952.354
244 G 1.000** 952.354
245 F 1.000** 952.354
246 L 1.000** 952.354
247 W 1.000** 952.354
248 W 1.000** 952.354
249 N 1.000** 952.354
250 A 1.000** 952.354
251 A 1.000** 952.354
252 P 1.000** 952.354
253 A 1.000** 952.354
254 K 1.000** 952.354
255 V 1.000** 952.354
256 F 1.000** 952.354
257 M 1.000** 952.354
258 G 1.000** 952.354
259 D 1.000** 952.354
260 T 1.000** 952.354
261 G 1.000** 952.354
262 S 1.000** 952.354
263 L 1.000** 952.354
264 A 1.000** 952.354
265 L 1.000** 952.354
266 G 1.000** 952.354
267 G 1.000** 952.354
268 V 1.000** 952.354
269 I 1.000** 952.354
270 A 1.000** 952.354
271 G 1.000** 952.354
272 L 1.000** 952.354
273 S 1.000** 952.354
274 V 1.000** 952.354
275 T 1.000** 952.354
276 S 1.000** 952.354
277 R 1.000** 952.354
278 T 1.000** 952.354
279 E 1.000** 952.354
280 I 1.000** 952.354
281 L 1.000** 952.354
282 A 1.000** 952.354
283 V 1.000** 952.354
284 V 1.000** 952.354
285 L 1.000** 952.354
286 G 1.000** 952.354
287 S 1.000** 952.354
288 L 1.000** 952.354
289 F 1.000** 952.354
290 V 1.000** 952.354
291 A 1.000** 952.354
292 E 1.000** 952.354
293 I 1.000** 952.354
294 T 1.000** 952.354
295 S 1.000** 952.354
296 V 1.000** 952.354
297 V 1.000** 952.354
298 L 1.000** 952.354
299 Q 1.000** 952.354
300 I 1.000** 952.354
301 L 1.000** 952.354
302 A 1.000** 952.354
303 F 1.000** 952.354
304 R 1.000** 952.354
305 T 1.000** 952.354
306 T 1.000** 952.354
307 G 1.000** 952.354
308 R 1.000** 952.354
309 R 1.000** 952.354
310 V 1.000** 952.354
311 F 1.000** 952.354
312 R 1.000** 952.354
313 M 1.000** 952.354
314 A 1.000** 952.354
315 P 1.000** 952.354
316 F 1.000** 952.354
317 H 1.000** 952.354
318 H 1.000** 952.354
319 H 1.000** 952.354
320 F 1.000** 952.354
321 E 1.000** 952.354
322 L 1.000** 952.354
323 A 1.000** 952.354
324 G 1.000** 952.354
325 W 1.000** 952.354
326 A 1.000** 952.354
327 E 1.000** 952.354
328 T 1.000** 952.354
329 T 1.000** 952.354
330 V 1.000** 952.354
331 I 1.000** 952.354
332 I 1.000** 952.354
333 R 1.000** 952.354
334 F 1.000** 952.354
335 W 1.000** 952.354
336 L 1.000** 952.354
337 L 1.000** 952.354
338 T 1.000** 952.354
339 A 1.000** 952.354
340 I 1.000** 952.354
341 A 1.000** 952.354
342 C 1.000** 952.354
343 G 1.000** 952.354
344 L 1.000** 952.354
345 G 1.000** 952.354
346 V 1.000** 952.354
347 V 1.000** 952.354
348 L 1.000** 952.354
349 F 1.000** 952.354
350 Y 1.000** 952.354
351 G 1.000** 952.354
352 E 1.000** 952.354
353 W 1.000** 952.354
354 L 1.000** 952.354
355 A 1.000** 952.354
356 T 1.000** 952.354
357 I 1.000** 952.354
358 G 1.000** 952.354
359 A 1.000** 952.354
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634423_1_949_MLBR_RS04485)
Pr(w>1) post mean +- SE for w
255 V 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -1414.753971 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.002843 0.000004 0.000004 0.000004 0.000004 0.000004 952.280913 3.409759 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002863
(1: 0.002843, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634423_1_949_MLBR_RS04485: 0.002843, NC_002677_1_NP_301694_1_566_mraY: 0.000004, NZ_LVXE01000007_1_WP_010908018_1_2519_A3216_RS03985: 0.000004, NZ_LYPH01000011_1_WP_010908018_1_341_A8144_RS01615: 0.000004, NZ_CP029543_1_WP_010908018_1_969_DIJ64_RS04920: 0.000004, NZ_AP014567_1_WP_010908018_1_986_JK2ML_RS05005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 952.28091
Parameters in M7 (beta):
p = 3.40976 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.003 765.4 311.6 1.0000 0.0009 0.0009 0.7 0.3
7..2 0.000 765.4 311.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 765.4 311.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 765.4 311.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 765.4 311.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 765.4 311.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -1414.383130 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.002931 0.000004 0.000004 0.000004 0.000004 0.000004 952.285765 0.193048 99.000000 0.005000 951.487687
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.002951
(1: 0.002931, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634423_1_949_MLBR_RS04485: 0.002931, NC_002677_1_NP_301694_1_566_mraY: 0.000004, NZ_LVXE01000007_1_WP_010908018_1_2519_A3216_RS03985: 0.000004, NZ_LYPH01000011_1_WP_010908018_1_341_A8144_RS01615: 0.000004, NZ_CP029543_1_WP_010908018_1_969_DIJ64_RS04920: 0.000004, NZ_AP014567_1_WP_010908018_1_986_JK2ML_RS05005: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 952.28577
Parameters in M8 (beta&w>1):
p0 = 0.19305 p = 99.00000 q = 0.00500
(p1 = 0.80695) w = 951.48769
MLEs of dN/dS (w) for site classes (K=11)
p: 0.01930 0.01930 0.01930 0.01930 0.01930 0.01930 0.01930 0.01930 0.01930 0.01930 0.80695
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 951.48769
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.003 765.4 311.6 767.9984 0.0014 0.0000 1.1 0.0
7..2 0.000 765.4 311.6 767.9984 0.0000 0.0000 0.0 0.0
7..3 0.000 765.4 311.6 767.9984 0.0000 0.0000 0.0 0.0
7..4 0.000 765.4 311.6 767.9984 0.0000 0.0000 0.0 0.0
7..5 0.000 765.4 311.6 767.9984 0.0000 0.0000 0.0 0.0
7..6 0.000 765.4 311.6 767.9984 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634423_1_949_MLBR_RS04485)
Pr(w>1) post mean +- SE for w
1 M 0.806 766.949
2 R 0.807 767.858
3 Q 0.807 767.816
4 I 0.806 767.046
5 L 0.807 767.691
6 V 0.806 767.130
7 A 0.806 767.459
8 V 0.806 767.130
9 T 0.807 767.773
10 V 0.806 767.130
11 A 0.806 767.047
12 L 0.807 767.769
13 V 0.806 767.506
14 V 0.806 767.130
15 S 0.807 767.691
16 I 0.806 767.046
17 L 0.807 767.769
18 L 0.807 767.769
19 T 0.806 767.129
20 P 0.807 767.857
21 A 0.806 767.047
22 L 0.807 767.769
23 I 0.806 767.046
24 R 0.807 767.694
25 L 0.807 767.769
26 F 0.806 767.455
27 T 0.806 767.129
28 R 0.807 767.858
29 H 0.807 767.694
30 G 0.806 767.516
31 F 0.806 767.455
32 G 0.806 767.516
33 Q 0.807 767.816
34 E 0.807 767.858
35 I 0.806 767.046
36 R 0.807 767.826
37 E 0.807 767.858
38 D 0.806 767.458
39 G 0.806 767.516
40 P 0.807 767.857
41 P 0.806 767.456
42 S 0.806 767.459
43 H 0.807 767.694
44 H 0.807 767.694
45 N 0.806 767.516
46 K 0.807 767.873
47 R 0.807 767.694
48 G 0.807 767.873
49 T 0.806 767.129
50 P 0.807 767.857
51 S 0.807 767.691
52 M 0.806 766.949
53 G 0.807 767.725
54 G 0.807 767.725
55 V 0.806 767.506
56 A 0.806 767.047
57 I 0.806 767.459
58 V 0.806 767.130
59 A 0.806 767.047
60 G 0.806 767.516
61 I 0.806 767.459
62 W 0.807 767.816
63 A 0.806 767.047
64 G 0.806 767.516
65 Y 0.807 767.694
66 L 0.807 767.769
67 G 0.806 767.516
68 T 0.806 767.506
69 H 0.807 767.826
70 L 0.807 767.769
71 A 0.807 767.751
72 G 0.806 767.516
73 L 0.807 767.769
74 A 0.806 767.047
75 F 0.806 767.455
76 D 0.807 767.692
77 G 0.807 767.725
78 E 0.807 767.858
79 G 0.806 767.516
80 V 0.807 767.773
81 S 0.806 767.456
82 A 0.806 767.047
83 S 0.806 767.456
84 G 0.807 767.725
85 V 0.806 767.130
86 L 0.807 767.769
87 V 0.806 767.130
88 L 0.807 767.769
89 G 0.807 767.725
90 L 0.807 767.769
91 A 0.806 767.459
92 T 0.806 767.506
93 A 0.806 767.047
94 L 0.807 767.769
95 G 0.806 767.516
96 G 0.806 767.516
97 V 0.806 767.130
98 G 0.807 767.873
99 F 0.806 767.455
100 L 0.806 767.456
101 D 0.807 767.692
102 D 0.806 767.458
103 L 0.807 767.769
104 I 0.806 767.046
105 K 0.806 767.516
106 I 0.806 767.046
107 R 0.807 767.694
108 R 0.806 767.459
109 S 0.806 767.456
110 R 0.807 767.694
111 N 0.806 767.516
112 L 0.806 767.456
113 G 0.806 767.516
114 L 0.807 767.769
115 N 0.806 767.516
116 K 0.806 767.516
117 T 0.807 767.773
118 A 0.806 767.047
119 K 0.806 767.516
120 T 0.806 767.129
121 V 0.806 767.130
122 G 0.806 767.516
123 Q 0.807 767.816
124 I 0.806 767.378
125 T 0.807 767.773
126 A 0.806 767.047
127 A 0.806 767.047
128 V 0.806 767.130
129 L 0.807 767.769
130 F 0.806 767.455
131 G 0.806 767.516
132 V 0.806 767.130
133 L 0.807 767.769
134 V 0.806 767.130
135 L 0.807 767.769
136 Q 0.807 767.816
137 F 0.806 767.455
138 R 0.807 767.694
139 N 0.807 767.725
140 G 0.806 767.516
141 A 0.806 767.047
142 G 0.806 767.516
143 L 0.807 767.769
144 T 0.807 767.773
145 P 0.806 767.456
146 A 0.806 767.047
147 S 0.806 767.459
148 A 0.806 767.047
149 D 0.807 767.692
150 L 0.807 767.769
151 S 0.806 767.456
152 Y 0.807 767.694
153 V 0.806 767.130
154 R 0.807 767.826
155 E 0.806 767.458
156 I 0.806 767.459
157 A 0.806 767.047
158 T 0.806 767.129
159 V 0.806 767.130
160 T 0.806 767.129
161 L 0.807 767.769
162 A 0.806 767.047
163 P 0.806 767.456
164 A 0.806 767.047
165 L 0.807 767.938
166 F 0.806 767.455
167 V 0.806 767.130
168 L 0.807 767.769
169 F 0.806 767.455
170 C 0.807 767.693
171 M 0.806 766.949
172 V 0.806 767.130
173 I 0.806 767.046
174 V 0.806 767.130
175 S 0.807 767.692
176 A 0.806 767.047
177 W 0.807 767.816
178 S 0.807 767.858
179 N 0.807 767.725
180 A 0.806 767.047
181 V 0.806 767.130
182 N 0.806 767.516
183 F 0.806 767.455
184 T 0.806 767.129
185 D 0.806 767.458
186 G 0.806 767.516
187 L 0.807 767.938
188 D 0.806 767.458
189 G 0.806 767.516
190 L 0.807 767.769
191 A 0.806 767.047
192 A 0.806 767.459
193 G 0.806 767.516
194 S 0.807 767.692
195 M 0.806 766.949
196 A 0.806 767.047
197 M 0.806 766.949
198 V 0.806 767.130
199 T 0.806 767.129
200 A 0.806 767.047
201 A 0.806 767.047
202 Y 0.807 767.826
203 V 0.806 767.506
204 L 0.807 767.769
205 I 0.806 767.046
206 T 0.806 767.129
207 F 0.807 767.690
208 W 0.807 767.816
209 Q 0.807 767.951
210 Y 0.807 767.826
211 R 0.807 767.694
212 N 0.807 767.725
213 A 0.806 767.047
214 C 0.807 767.693
215 V 0.806 767.130
216 T 0.806 767.129
217 A 0.806 767.047
218 P 0.806 767.456
219 G 0.807 767.873
220 L 0.807 767.769
221 G 0.807 767.725
222 C 0.807 767.693
223 Y 0.807 767.826
224 N 0.807 767.725
225 V 0.806 767.130
226 R 0.807 767.694
227 D 0.807 767.692
228 P 0.806 767.456
229 L 0.807 767.769
230 D 0.806 767.458
231 L 0.807 767.769
232 T 0.806 767.129
233 L 0.807 767.769
234 I 0.806 767.459
235 A 0.807 767.751
236 A 0.806 767.459
237 A 0.806 767.047
238 T 0.806 767.129
239 V 0.806 767.130
240 G 0.806 767.516
241 A 0.806 767.047
242 C 0.807 767.825
243 I 0.806 767.459
244 G 0.806 767.516
245 F 0.807 767.690
246 L 0.807 767.769
247 W 0.807 767.816
248 W 0.807 767.816
249 N 0.807 767.725
250 A 0.806 767.047
251 A 0.807 767.751
252 P 0.806 767.456
253 A 0.806 767.047
254 K 0.806 767.516
255 V 1.000** 951.248
256 F 0.806 767.455
257 M 0.806 766.949
258 G 0.807 767.873
259 D 0.807 767.692
260 T 0.806 767.129
261 G 0.806 767.516
262 S 0.806 767.456
263 L 0.807 767.939
264 A 0.806 767.047
265 L 0.807 767.769
266 G 0.807 767.725
267 G 0.806 767.516
268 V 0.806 767.130
269 I 0.806 767.046
270 A 0.806 767.459
271 G 0.806 767.516
272 L 0.807 767.769
273 S 0.806 767.456
274 V 0.806 767.130
275 T 0.806 767.129
276 S 0.807 767.692
277 R 0.807 767.694
278 T 0.806 767.506
279 E 0.806 767.458
280 I 0.806 767.459
281 L 0.807 767.691
282 A 0.806 767.047
283 V 0.806 767.130
284 V 0.806 767.130
285 L 0.807 767.769
286 G 0.807 767.725
287 S 0.806 767.456
288 L 0.807 767.769
289 F 0.806 767.455
290 V 0.806 767.506
291 A 0.806 767.047
292 E 0.807 767.858
293 I 0.806 767.046
294 T 0.806 767.129
295 S 0.806 767.456
296 V 0.806 767.506
297 V 0.807 767.773
298 L 0.807 767.769
299 Q 0.807 767.816
300 I 0.806 767.459
301 L 0.807 767.769
302 A 0.806 767.459
303 F 0.806 767.455
304 R 0.807 767.694
305 T 0.806 767.129
306 T 0.806 767.506
307 G 0.807 767.725
308 R 0.807 767.826
309 R 0.807 767.694
310 V 0.806 767.130
311 F 0.807 767.690
312 R 0.807 767.694
313 M 0.806 766.949
314 A 0.806 767.047
315 P 0.806 767.456
316 F 0.806 767.455
317 H 0.807 767.694
318 H 0.807 767.826
319 H 0.807 767.826
320 F 0.806 767.455
321 E 0.807 767.858
322 L 0.807 767.769
323 A 0.806 767.047
324 G 0.807 767.725
325 W 0.807 767.816
326 A 0.806 767.047
327 E 0.807 767.858
328 T 0.806 767.129
329 T 0.806 767.506
330 V 0.806 767.130
331 I 0.806 767.046
332 I 0.806 767.459
333 R 0.807 767.826
334 F 0.807 767.690
335 W 0.807 767.816
336 L 0.807 767.769
337 L 0.806 767.456
338 T 0.807 767.773
339 A 0.806 767.047
340 I 0.806 767.046
341 A 0.806 767.459
342 C 0.807 767.693
343 G 0.807 767.725
344 L 0.807 767.769
345 G 0.806 767.516
346 V 0.806 767.130
347 V 0.806 767.130
348 L 0.807 767.769
349 F 0.806 767.455
350 Y 0.807 767.826
351 G 0.806 767.516
352 E 0.806 767.458
353 W 0.807 767.816
354 L 0.807 767.939
355 A 0.806 767.047
356 T 0.806 767.129
357 I 0.806 767.459
358 G 0.806 767.516
359 A 0.806 767.459
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634423_1_949_MLBR_RS04485)
Pr(w>1) post mean +- SE for w
1 M 0.639 4.859 +- 3.856
2 R 0.639 4.859 +- 3.856
3 Q 0.639 4.859 +- 3.856
4 I 0.639 4.859 +- 3.856
5 L 0.639 4.859 +- 3.856
6 V 0.639 4.859 +- 3.856
7 A 0.639 4.859 +- 3.856
8 V 0.639 4.859 +- 3.856
9 T 0.639 4.859 +- 3.856
10 V 0.639 4.859 +- 3.856
11 A 0.639 4.859 +- 3.856
12 L 0.639 4.859 +- 3.856
13 V 0.639 4.859 +- 3.856
14 V 0.639 4.859 +- 3.856
15 S 0.639 4.859 +- 3.856
16 I 0.639 4.859 +- 3.856
17 L 0.639 4.859 +- 3.856
18 L 0.639 4.859 +- 3.856
19 T 0.639 4.859 +- 3.856
20 P 0.639 4.859 +- 3.856
21 A 0.639 4.859 +- 3.856
22 L 0.639 4.859 +- 3.856
23 I 0.639 4.859 +- 3.856
24 R 0.639 4.859 +- 3.856
25 L 0.639 4.859 +- 3.856
26 F 0.639 4.859 +- 3.856
27 T 0.639 4.859 +- 3.856
28 R 0.639 4.859 +- 3.856
29 H 0.639 4.859 +- 3.856
30 G 0.639 4.859 +- 3.856
31 F 0.639 4.859 +- 3.856
32 G 0.639 4.859 +- 3.856
33 Q 0.639 4.859 +- 3.856
34 E 0.639 4.859 +- 3.856
35 I 0.639 4.859 +- 3.856
36 R 0.639 4.859 +- 3.856
37 E 0.639 4.859 +- 3.856
38 D 0.639 4.859 +- 3.856
39 G 0.639 4.859 +- 3.856
40 P 0.639 4.859 +- 3.856
41 P 0.639 4.859 +- 3.856
42 S 0.639 4.859 +- 3.856
43 H 0.639 4.859 +- 3.856
44 H 0.639 4.859 +- 3.856
45 N 0.639 4.859 +- 3.856
46 K 0.639 4.859 +- 3.856
47 R 0.639 4.859 +- 3.856
48 G 0.639 4.859 +- 3.856
49 T 0.639 4.859 +- 3.856
50 P 0.639 4.859 +- 3.856
51 S 0.639 4.859 +- 3.856
52 M 0.639 4.859 +- 3.856
53 G 0.639 4.859 +- 3.856
54 G 0.639 4.859 +- 3.856
55 V 0.639 4.859 +- 3.856
56 A 0.639 4.859 +- 3.856
57 I 0.639 4.859 +- 3.856
58 V 0.639 4.859 +- 3.856
59 A 0.639 4.859 +- 3.856
60 G 0.639 4.859 +- 3.856
61 I 0.639 4.859 +- 3.856
62 W 0.639 4.859 +- 3.856
63 A 0.639 4.859 +- 3.856
64 G 0.639 4.859 +- 3.856
65 Y 0.639 4.859 +- 3.856
66 L 0.639 4.859 +- 3.856
67 G 0.639 4.859 +- 3.856
68 T 0.639 4.859 +- 3.856
69 H 0.639 4.859 +- 3.856
70 L 0.639 4.859 +- 3.856
71 A 0.639 4.859 +- 3.856
72 G 0.639 4.859 +- 3.856
73 L 0.639 4.859 +- 3.856
74 A 0.639 4.859 +- 3.856
75 F 0.639 4.859 +- 3.856
76 D 0.639 4.859 +- 3.856
77 G 0.639 4.859 +- 3.856
78 E 0.639 4.859 +- 3.856
79 G 0.639 4.859 +- 3.856
80 V 0.639 4.859 +- 3.856
81 S 0.639 4.859 +- 3.856
82 A 0.639 4.859 +- 3.856
83 S 0.639 4.859 +- 3.856
84 G 0.639 4.859 +- 3.856
85 V 0.639 4.859 +- 3.856
86 L 0.639 4.859 +- 3.856
87 V 0.639 4.859 +- 3.856
88 L 0.639 4.859 +- 3.856
89 G 0.639 4.859 +- 3.856
90 L 0.639 4.859 +- 3.856
91 A 0.639 4.859 +- 3.856
92 T 0.639 4.859 +- 3.856
93 A 0.639 4.859 +- 3.856
94 L 0.639 4.859 +- 3.856
95 G 0.639 4.859 +- 3.856
96 G 0.639 4.859 +- 3.856
97 V 0.639 4.859 +- 3.856
98 G 0.639 4.859 +- 3.856
99 F 0.639 4.859 +- 3.856
100 L 0.639 4.859 +- 3.856
101 D 0.639 4.859 +- 3.856
102 D 0.639 4.859 +- 3.856
103 L 0.639 4.859 +- 3.856
104 I 0.639 4.859 +- 3.856
105 K 0.639 4.859 +- 3.856
106 I 0.639 4.859 +- 3.856
107 R 0.639 4.859 +- 3.856
108 R 0.639 4.859 +- 3.856
109 S 0.639 4.859 +- 3.856
110 R 0.639 4.859 +- 3.856
111 N 0.639 4.859 +- 3.856
112 L 0.639 4.859 +- 3.856
113 G 0.639 4.859 +- 3.856
114 L 0.639 4.859 +- 3.856
115 N 0.639 4.859 +- 3.856
116 K 0.639 4.859 +- 3.856
117 T 0.639 4.859 +- 3.856
118 A 0.639 4.859 +- 3.856
119 K 0.639 4.859 +- 3.856
120 T 0.639 4.859 +- 3.856
121 V 0.639 4.859 +- 3.856
122 G 0.639 4.859 +- 3.856
123 Q 0.639 4.859 +- 3.856
124 I 0.639 4.859 +- 3.856
125 T 0.639 4.859 +- 3.856
126 A 0.639 4.859 +- 3.856
127 A 0.639 4.859 +- 3.856
128 V 0.639 4.859 +- 3.856
129 L 0.639 4.859 +- 3.856
130 F 0.639 4.859 +- 3.856
131 G 0.639 4.859 +- 3.856
132 V 0.639 4.859 +- 3.856
133 L 0.639 4.859 +- 3.856
134 V 0.639 4.859 +- 3.856
135 L 0.639 4.859 +- 3.856
136 Q 0.639 4.859 +- 3.856
137 F 0.639 4.859 +- 3.856
138 R 0.639 4.859 +- 3.856
139 N 0.639 4.859 +- 3.856
140 G 0.639 4.859 +- 3.856
141 A 0.639 4.859 +- 3.856
142 G 0.639 4.859 +- 3.856
143 L 0.639 4.859 +- 3.856
144 T 0.639 4.859 +- 3.856
145 P 0.639 4.859 +- 3.856
146 A 0.639 4.859 +- 3.856
147 S 0.639 4.859 +- 3.856
148 A 0.639 4.859 +- 3.856
149 D 0.639 4.859 +- 3.856
150 L 0.639 4.859 +- 3.856
151 S 0.639 4.859 +- 3.856
152 Y 0.639 4.859 +- 3.856
153 V 0.639 4.859 +- 3.856
154 R 0.639 4.859 +- 3.856
155 E 0.639 4.859 +- 3.856
156 I 0.639 4.859 +- 3.856
157 A 0.639 4.859 +- 3.856
158 T 0.639 4.859 +- 3.856
159 V 0.639 4.859 +- 3.856
160 T 0.639 4.859 +- 3.856
161 L 0.639 4.859 +- 3.856
162 A 0.639 4.859 +- 3.856
163 P 0.639 4.859 +- 3.856
164 A 0.639 4.859 +- 3.856
165 L 0.639 4.859 +- 3.856
166 F 0.639 4.859 +- 3.856
167 V 0.639 4.859 +- 3.856
168 L 0.639 4.859 +- 3.856
169 F 0.639 4.859 +- 3.856
170 C 0.639 4.859 +- 3.856
171 M 0.639 4.859 +- 3.856
172 V 0.639 4.859 +- 3.856
173 I 0.639 4.859 +- 3.856
174 V 0.639 4.859 +- 3.856
175 S 0.639 4.859 +- 3.856
176 A 0.639 4.859 +- 3.856
177 W 0.639 4.859 +- 3.856
178 S 0.639 4.859 +- 3.856
179 N 0.639 4.859 +- 3.856
180 A 0.639 4.859 +- 3.856
181 V 0.639 4.859 +- 3.856
182 N 0.639 4.859 +- 3.856
183 F 0.639 4.859 +- 3.856
184 T 0.639 4.859 +- 3.856
185 D 0.639 4.859 +- 3.856
186 G 0.639 4.859 +- 3.856
187 L 0.639 4.859 +- 3.856
188 D 0.639 4.859 +- 3.856
189 G 0.639 4.859 +- 3.856
190 L 0.639 4.859 +- 3.856
191 A 0.639 4.859 +- 3.856
192 A 0.639 4.859 +- 3.856
193 G 0.639 4.859 +- 3.856
194 S 0.639 4.859 +- 3.856
195 M 0.639 4.859 +- 3.856
196 A 0.639 4.859 +- 3.856
197 M 0.639 4.859 +- 3.856
198 V 0.639 4.859 +- 3.856
199 T 0.639 4.859 +- 3.856
200 A 0.639 4.859 +- 3.856
201 A 0.639 4.859 +- 3.856
202 Y 0.639 4.859 +- 3.856
203 V 0.639 4.859 +- 3.856
204 L 0.639 4.859 +- 3.856
205 I 0.639 4.859 +- 3.856
206 T 0.639 4.859 +- 3.856
207 F 0.639 4.859 +- 3.856
208 W 0.639 4.859 +- 3.856
209 Q 0.639 4.859 +- 3.856
210 Y 0.639 4.859 +- 3.856
211 R 0.639 4.859 +- 3.856
212 N 0.639 4.859 +- 3.856
213 A 0.639 4.859 +- 3.856
214 C 0.639 4.859 +- 3.856
215 V 0.639 4.859 +- 3.856
216 T 0.639 4.859 +- 3.856
217 A 0.639 4.859 +- 3.856
218 P 0.639 4.859 +- 3.856
219 G 0.639 4.859 +- 3.856
220 L 0.639 4.859 +- 3.856
221 G 0.639 4.859 +- 3.856
222 C 0.639 4.859 +- 3.856
223 Y 0.639 4.859 +- 3.856
224 N 0.639 4.859 +- 3.856
225 V 0.639 4.859 +- 3.856
226 R 0.639 4.859 +- 3.856
227 D 0.639 4.859 +- 3.856
228 P 0.639 4.859 +- 3.856
229 L 0.639 4.859 +- 3.856
230 D 0.639 4.859 +- 3.856
231 L 0.639 4.859 +- 3.856
232 T 0.639 4.859 +- 3.856
233 L 0.639 4.859 +- 3.856
234 I 0.639 4.859 +- 3.856
235 A 0.639 4.859 +- 3.856
236 A 0.639 4.859 +- 3.856
237 A 0.639 4.859 +- 3.856
238 T 0.639 4.859 +- 3.856
239 V 0.639 4.859 +- 3.856
240 G 0.639 4.859 +- 3.856
241 A 0.639 4.859 +- 3.856
242 C 0.639 4.859 +- 3.856
243 I 0.639 4.859 +- 3.856
244 G 0.639 4.859 +- 3.856
245 F 0.639 4.859 +- 3.856
246 L 0.639 4.859 +- 3.856
247 W 0.639 4.859 +- 3.856
248 W 0.639 4.859 +- 3.856
249 N 0.639 4.859 +- 3.856
250 A 0.639 4.859 +- 3.856
251 A 0.639 4.859 +- 3.856
252 P 0.639 4.859 +- 3.856
253 A 0.639 4.859 +- 3.856
254 K 0.639 4.859 +- 3.856
255 V 0.923 6.857 +- 3.004
256 F 0.639 4.859 +- 3.856
257 M 0.639 4.859 +- 3.856
258 G 0.639 4.859 +- 3.856
259 D 0.639 4.859 +- 3.856
260 T 0.639 4.859 +- 3.856
261 G 0.639 4.859 +- 3.856
262 S 0.639 4.859 +- 3.856
263 L 0.639 4.859 +- 3.856
264 A 0.639 4.859 +- 3.856
265 L 0.639 4.859 +- 3.856
266 G 0.639 4.859 +- 3.856
267 G 0.639 4.859 +- 3.856
268 V 0.639 4.859 +- 3.856
269 I 0.639 4.859 +- 3.856
270 A 0.639 4.859 +- 3.856
271 G 0.639 4.859 +- 3.856
272 L 0.639 4.859 +- 3.856
273 S 0.639 4.859 +- 3.856
274 V 0.639 4.859 +- 3.856
275 T 0.639 4.859 +- 3.856
276 S 0.639 4.859 +- 3.856
277 R 0.639 4.859 +- 3.856
278 T 0.639 4.859 +- 3.856
279 E 0.639 4.859 +- 3.856
280 I 0.639 4.859 +- 3.856
281 L 0.639 4.859 +- 3.856
282 A 0.639 4.859 +- 3.856
283 V 0.639 4.859 +- 3.856
284 V 0.639 4.859 +- 3.856
285 L 0.639 4.859 +- 3.856
286 G 0.639 4.859 +- 3.856
287 S 0.639 4.859 +- 3.856
288 L 0.639 4.859 +- 3.856
289 F 0.639 4.859 +- 3.856
290 V 0.639 4.859 +- 3.856
291 A 0.639 4.859 +- 3.856
292 E 0.639 4.859 +- 3.856
293 I 0.639 4.859 +- 3.856
294 T 0.639 4.859 +- 3.856
295 S 0.639 4.859 +- 3.856
296 V 0.639 4.859 +- 3.856
297 V 0.639 4.859 +- 3.856
298 L 0.639 4.859 +- 3.856
299 Q 0.639 4.859 +- 3.856
300 I 0.639 4.859 +- 3.856
301 L 0.639 4.859 +- 3.856
302 A 0.639 4.859 +- 3.856
303 F 0.639 4.859 +- 3.856
304 R 0.639 4.859 +- 3.856
305 T 0.639 4.859 +- 3.856
306 T 0.639 4.859 +- 3.856
307 G 0.639 4.859 +- 3.856
308 R 0.639 4.859 +- 3.856
309 R 0.639 4.859 +- 3.856
310 V 0.639 4.859 +- 3.856
311 F 0.639 4.859 +- 3.856
312 R 0.639 4.859 +- 3.856
313 M 0.639 4.859 +- 3.856
314 A 0.639 4.859 +- 3.856
315 P 0.639 4.859 +- 3.856
316 F 0.639 4.859 +- 3.856
317 H 0.639 4.859 +- 3.856
318 H 0.639 4.859 +- 3.856
319 H 0.639 4.859 +- 3.856
320 F 0.639 4.859 +- 3.856
321 E 0.639 4.859 +- 3.856
322 L 0.639 4.859 +- 3.856
323 A 0.639 4.859 +- 3.856
324 G 0.639 4.859 +- 3.856
325 W 0.639 4.859 +- 3.856
326 A 0.639 4.859 +- 3.856
327 E 0.639 4.859 +- 3.856
328 T 0.639 4.859 +- 3.856
329 T 0.639 4.859 +- 3.856
330 V 0.639 4.859 +- 3.856
331 I 0.639 4.859 +- 3.856
332 I 0.639 4.859 +- 3.856
333 R 0.639 4.859 +- 3.856
334 F 0.639 4.859 +- 3.856
335 W 0.639 4.859 +- 3.856
336 L 0.639 4.859 +- 3.856
337 L 0.639 4.859 +- 3.856
338 T 0.639 4.859 +- 3.856
339 A 0.639 4.859 +- 3.856
340 I 0.639 4.859 +- 3.856
341 A 0.639 4.859 +- 3.856
342 C 0.639 4.859 +- 3.856
343 G 0.639 4.859 +- 3.856
344 L 0.639 4.859 +- 3.856
345 G 0.639 4.859 +- 3.856
346 V 0.639 4.859 +- 3.856
347 V 0.639 4.859 +- 3.856
348 L 0.639 4.859 +- 3.856
349 F 0.639 4.859 +- 3.856
350 Y 0.639 4.859 +- 3.856
351 G 0.639 4.859 +- 3.856
352 E 0.639 4.859 +- 3.856
353 W 0.639 4.859 +- 3.856
354 L 0.639 4.859 +- 3.856
355 A 0.639 4.859 +- 3.856
356 T 0.639 4.859 +- 3.856
357 I 0.639 4.859 +- 3.856
358 G 0.639 4.859 +- 3.856
359 A 0.639 4.859 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:19